3PY9A

X-ray structural studies of the entire extra-cellular region of the ser/thr kinase prkc from staphylococcus aureus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
285
structure length
280
Chain Sequence
ETPDVIGKSVKEAEQIFNKNNLKLGKISRSYSDKYPENEIIKTTPNTGERVERGDSVDVVISKGPEKVKMPNVIGLPKEEALQKLKSLGLKDVTIEKVYNNQAPKGYIANQSVTATEIAIHDSNIKLYESLGIKQVYVEDFEHKSFSKAKKALEEKGFKVESKEEYSDDIDEGDVISQSPKGKSVDEGSTISFVVSKGKKSVKTTTESVDVPYTGKNDKSQKVKVYIKDKDNDGSTEKGSFDITSDQRIDIPLRIEKGKTASYIVKVDGKTVAEKEVSYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase
publication title X-ray structural studies of the entire extracellular region of the serine/threonine kinase PrkC from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Transferase
total genus 58
structure length 280
sequence length 285
ec nomenclature
pdb deposition date 2010-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03793 PASTA PASTA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2560 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3py9A04
3.30.10.20 Alpha Beta 2-Layer Sandwich Trypsin Inhibitor V; Chain A Trypsin Inhibitor V; Chain A 3py9A02
3.30.10.20 Alpha Beta 2-Layer Sandwich Trypsin Inhibitor V; Chain A Trypsin Inhibitor V; Chain A 3py9A01
3.30.10.20 Alpha Beta 2-Layer Sandwich Trypsin Inhibitor V; Chain A Trypsin Inhibitor V; Chain A 3py9A03
5E0YA 2KUIA 3M9GA 5E0ZA 5E10A 3OUVA 2KUDA 2MGVA 2KUEA 3PY9A 2KUFA
chains in the Genus database with same CATH superfamily
5E6IB 1HXMB 1U8JA 4XCEB 1MI5A 3AM8A 3MBEA 1T20A 4Y9FA 3BXNB 2IPKA 4XVTL 2BFVH 3L81A 4NAQA 2JTDA 4KJWD 4GEIA 2BSEA 4ZNCD 1CYWA 1WWWX 1MHEA 1EZLA 4AM0A 5KSAC 4HS6B 5AVXB 2R29H 1MLBB 1CQKA 3IGUA 4ZTPH 1D6VL 1FAIH 3VM7A 5GS0H 2MTAA 3QUZD 4C55A 4ZS7H 4KXAA 3BCDA 1PY0A 4XNMB 1H15B 3U9UA 4N6RB 4P5SA 2AJXH 1DUZB 2EDOA 1LTXA 1PX8A 2PXYA 1M6UA 4XNUL 4ZMOA 3GXUB 1M4KA 3LX9A 2R7EA 4C4KO 4PLNC 3SZ6A 2YJLA 4OB5H 4XP1L 2NY6D 2X87A 2I9TA 5BCAA 2VERA 1V54B 4PP2A 2B4CC 3X1BA 3FCSA 4WO0A 4A04A 5L8KB 1S7SB 5FGBA 3GSWB 1E9OB 1CK0H 1XIWA 4FAAB 2AJ3B 5AB9A 4AL8L 4N26A 2VISA 4LARL 1D5MA 9CGTA 2VSKB 1I9RH 2BVYA 3HNTL 3LN5A 2RFXB 3HG4A 3T6WA 2PWHA 4E5XG 4A7SA 2G4GA 1SUHA 1QEXA 1Z5HA 2OJEB 1A6AA 2AJSL 3TM6A 2IV9A 3OXSA 4MASA 1BD2A 1DZBA 1RJYA 3F6IA 4NHUA 5CUSH 4TNWF 2Q86B 3S8WA 5C6TL 1Z1WA 1D5IL 1AXTH 2VC2H 3MLZH 5C7XH 3QEGL 2D7MA 2DQUL 2L7QA 1MH5B 4IJTA 4W6YB 3NCJL 3C5ZB 4OJFH 5FXCH 1ZAGA 4CMMA 1FZMB 1LP9E 5DF0A 1JHKL 1F11A 1KLUB 2XQYG 3PXHA 4IDJL 5FO7A 4BZ2H 4HKZB 4OJAA 1A9VA 2D4DA 2P8MA 3IS0X 1GY1A 4XP4L 4RRPM 3BZEA 2IWFA 3I2CL 1D6EB 2OX5B 5I1EL 5KBLA 1PKQB 4LNRA 5EO0A 5ESAB 1IIIA 1UJ3A 4XR8C 2UUDH 4PRHA 2JFCA 3FUHA 3L1OL 3ZE2E 3B4NA 2A9NL 1KNOB 3SE3A 4EI5D 1GYWA 2WLIA 4U05A 4UQIM 1ZWIB 4NBZB 2F54A 1I8MA 1P84J 5K39A 3RURA 3ET9F 2GHZA 2NY5H 3E1ZA 3B1TA 3KYMA 1ZDQA 3TBVA 4KXZI 3SDAC 3H0TB 1N70A 1BZQK 3ARDC 2VLLA 3PYCA 1IV8A 2FSEB 2LHAA 3ABZA 5DO2D 1NFAA 4W4NA 3FFDB 3HC3H 2CCLA 1XGPA 4WGVB 3TO4A 5IHZA 1CO1A 2K6ZA 5KSVB 3AXHA 2L7EA 2C4XA 3NSYA 2NXYD 3CC5B 2P4AB 1U93A 3FTZA 3LKPB 4Q0XH 1WAAE 2VTFA 5AZ2H 1KY6A 2DF3A 3ULVC 1RERA 1EHNA 2P5EA 1P7KB 2X4RB 4P2QA 3ZQ9A 4E41D 3DGDA 4GBXD 4TUKL 4I3GA 1CWVA 4KO5A 5F3BA 1MUJA 4GRLC 4XAWH 1T2QL 3ALWA 2FGWH 1IVLA 4N0UB 3ULVE 4YHPA 4QWWD 1TMCB 5IJBC 1MWAH 2WB1A 3IKKA 1T5WB 1W2KT 3W0EA 1Z6JT 3FN0H 3VXOB 3S8GB 4PD4K 4DP2X 5E4EC 1A7QH 4NI6A 2LFGA 4ZAKA 4M03A 1LP9F 3VSUA 2X4TB 2YD1A 3MBWB 5F1IB 4CDGC 4ETQA 2EXYC 3OHXC 2W65A 2X0WA 4K8RH 4XN8A 4UQAA 3QJHB 3WGVB 2Y3NA 4XXCC 3GJFA 2PP8A 1IGYA 4LGSB 2E7CA 1IFHH 4Y9CA 3DV6B 3TGXA 1Y3FI 2HKFL 4NRZB 4Y0GA 3ZE2F 2IANA 8FABB 1DO5A 1ZK9A 4C4KT 1M7IA 4H2AA 4LRIC 4AMXA 1NH6A 3ME0A 4Y9GA 4BKLA 1CL7H 1DCEA 1X5MA 5K59E 5IREA 5AB2A 1ED3A 3ECWA 2IDUA 3WO4B 4U7MA 4GXUM 2NYYD 5DTFB 4GG6B 5C8JA 2ADIB 4XO4A 2XTLA 3G04B 1WYJA 3SE6A 1AP2A 3LB6C 1W8NA 5E9DD 5D4JA 1CC3A 1JGEB 3GBMH 1VKXA 1Y4AI 2VDRH 5JHAA 3QG6B 1NFIA 2CLRA 1UWGL 5F2FA 3BDYL 3MACH 5JPNA 5T1DH 1AC0A 3BEVB 3HB3D 1TU2B 3FH8A 3GKZA 3MO1A 2AANA 5T1LB 4CMHC 1BQRA 1NC4B 1I1FB 2O5XH 2Z4TA 1BOYA 3CBJB 1MLCB 4KKAC 1OB1A 3K72B 4YPGB 1WAAF 1PZ2A 3STBA 4R5TA 4CSSA 3ZHLA 1F2XK 4PJIA 1JG9A 4ACTA 1G9NH 2VZOA 4X6BB 4UTAH 4CSTA 2UZYA 1A8ZA 1I85A 3JWOH 3WTXA 4L9LB 3W11C 3RWEA 5T3ZH 5A16A 1A6TB 4LBAA 3I3DA 5B39B 5KTEH 3BQUB 3FNKA 3HLAB 2XTJB 2BVPB 4MMZB 3SPGA 1ULVA 1YJDH 1CE6B 3QJRB 3F5WB 3K0WA 4UUJB 3ULVF 4Y4FA 1FYTE 3BPOB 1BPLB 1FO0H 4HEPG 2X4OB 1PSKH 3LY6A 4PMEA 4D7PA 1F8TL 4XP9L 3VJ6B 5F89A 1EZSA 4FFVD 5IQ9B 5TQ2H 3T2PA 3WY4A 5BO1H 2IPTL 2GUYA 2ZKYA 3WFHB 3SKNA 4Y4HB 1BFTA 4G43A 5E56A 4FYSA 4HPHA 1HIML 3T8XA 3QRFM 4ZT1A 2AQQA 5KVGE 3TO2A 1OK8A 4FQHB 4H8PA 4DH2A 3PABB 4PWFA 5HI3D 4JFDE 4B50A 4EUPA 3GK8H 2N0KA 1BYNA 3GSXA 3TH4T 4PJ5B 3DROB 4LCVA 5D6CB 2Y36H 3TWCH 2BOLA 4DQOH 4PRNB 1R75A 5T1MA 3TCTA 1T0MA 2X4PB 3FHAA 3HBZA 3HKFA 1A7PL 2A1WL 3NG5A 2O61B 2SNII 1DBKL 2ZXAA 2CKBB 3ULUF 5HGBB 3QUZA 2FJHB 4LCWB 1HX0A 4HXBH 3UGEA 5K59F 3IGKA 5CHNB 2C7UA 1H3PL 3CSYB 3BUQA 3KR3H 2LLLA 4TUJB 1H5BA 1K4DA 4Y1TA 3RWCB 1HJBC 2M2DA 2MCAA 3VRLE 3BAWA 4XXDA 3IDMA 2VR6A 4DZ8B 3UAJA 4LMQE 4DNLA 1NFDA 4NQEB 1W0WB 1A9BA 4WFEE 4WY7H 4PHXA 3SQOH 2Z1KA 4FGMA 4JQXC 1VB9A 1P2CB 2XN2A 4LSUH 1MAJA 4DEWA 1G7MB 4Y2OB 4HUXB 2YKLL 4ALAL 1VRSA 3LVTA 3VMNA 1DVFA 1T21A 1SOXA 4AMKL 2BXYA 1KXTB 1S9VA 3HS0C 3MJ9H 2DQGH 1GVIA 2NY2B 2NNRA 1TF4A 4YHIA 5DLML 5IOPA 4NP9A 4UOW1 4KK5C 5MENB 2WXIA 4J39A 3W0WD 4HISA 5J6GB 1YPZE 4WI3A 3ZKND 2HVBA 1GC1C 4G8AC 2BHYA 3N41F 2ZJSL 5DWPA 5HDQH 3LKRA 1UH2A 1UD3A 5CSBA 1HXYA 1OF2A 5AOIA 5C0FA 2H8PB 4QO1B 1LO5A 4U1NB 3QUKB 4F8OA 3D3VE 5CCJA 1W15A 2W07A 1PJWA 2XJLA 3T09A 3MAWA 3P73A 1QFWL 1HHIA 2D73A 1JNNL 2FE0A 4LPWA 5EU4A 4LFHD 3UJJL 3NTCH 5CZXC 1X5FA 1KB5L 5IJVB 3QUXC 3S5LB 1UT1A 3TN0C 3MCKA 3QB7C 3F7QA 3QGVA 5FKPA 1IGTB 4PJXF 3CU1A 1AD0A 1FH2A 3VRIB 1XCTB 5SWZD 2CHWA 2HT2D 4PV9B 1HYSC 4ODHL 1J0ZA 5CZVH 4TSBL 1LLAA 2E8ZA 4WFHD 3WCYA 2AMUA 5L88L 4Q7DA 3QCTH 2QHRH 1CG9A 1HE7A 5IEHB 1OGPA 2RMNA 3H85A 3D48R 2XT1B 3T4AC 1RJZA 4J1UB 4FKHA 1AQDB 3MRBB 5L9DH 1HT6A 3VRLF 2EDHA 3KXFB 5GZOA 1DQDH 3ZOAA 4Z7NE 2J1ZA 3DETC 3Q6FB 4JRXB 2IDQA 5A43C 5E0ZA 4Y1AA 4LLMA 1SZNA 1JGUL 1JTOA 4WTQA 4OVVA 4NYLB 3QCVL 2JTYA 5KYWB 1KELL 4UV7H 3QIBD 2JJUA 4JGMA 4F1ZA 5DT1L 5FYLL 5DC2A 5H37A 3WNOA 3EGDB 3F05A 4WU5B 3KPTA 4NUGL 4D9QD 1JGVL 3T0XA 1F13A 5L8LB 3IDUA 3SDCA 4KNQA 4Y5VA 4KTDL 5F6IB 4HHGA 3BT2H 2ZTBA 3U2SB 1PLAA 1YPZF 4YHML 3VXUB 1FZKA 1FVCA 2C9UA 3SGJA 4DAGL 4AEIL 3PGCB 3EYFA 3FT3A 5EZIL 4QT5A 3IMVA 4AYID 1BOGA 3WFDH 1QP1A 3MJWA 1A4BA 5I76B 1RULH 3ZY7A 2AQ3A 1J87A 3DVFA 5JYMA 1HN1A 3ROOA 4MHHG 2KZWA 3ZHNA 1B4RA 2BRQA 1FE8L 5IY5B 3GGWB 3EO9L 1L9NA 2H41A 5DYOB 3KH3A 1OAYL 4RAVA 1I3RA 2HT4D 4QYAA 4G5AA 1LEGB 4TQEH 3UL4A 4QHLA 5FKAA 2EVIA 1C5BL 5BMFL 2VCOA 1B3JA 5GS0D 3FOLA 1SBSH 2XUWA 4M61A 2ENYA 3LKQA 3VFGL 5MEQA 4R7LA 3QUYC 1VENA 1UFGA 3KPNA 4XNZB 3D0LA 3UYPA 3V4VA 1LJMA 2OYMA 3VXRB 3WDHA 3EJUA 4Z7OB 1AD9A 5I1AB 4OH2A 4HU8A 3FRUB 5EU6E 5BV7B 1F3JA 2P24B 3MXVH 5KVMC 4U1MB 3WXVH 2V0AA 3HE7B 3VGBA 2VQTA 2Y25A 3BVVA 2ADYA 2YD6A 4X4MA 1Q9WB 1F18A 2CHXA 4WW1A 5IV2A 4MVBD 4Z7NF 2J1YA 5KW9L 2WLHA 3LKNA 2FNBA 2WQSA 3O3AB 1JGLH 3V5HB 5C07B 2H7WA 5F96L 1L7TL 5KZCB 1NLBH 4GB9A 5E9DA 2IVFC 3REVA 4KHXH 4KDTA 1Q1JL 2VMCA 3ULAB 1AO7D 4IKIA 3EYOA 3PWUA 3ROLA 5FA3B 4J12A 4U3XA 2KZKA 2CK2A 4OD1L 3C60C 4DPRA 5CJQL 2BSSA 3HAEA 1RHHB 4UT9A 5CS7A 3BDBA 5GIRA 1UWXH 2R4RH 4FTVB 2VDNB 2EECA 5IB2B 2YD5A 2Z91A 2NW2B 4JM2D 4OU3A 1IILE 3IFLL 1AGDB 2QV2A 2ENQA 5D1QA 1T4KB 4IMKC 1MJ7L 1I8AA 3C09C 2Y06L 3WE6B 2Y7QA 2J2ZA 2UY7B 3OKKA 5I74B 3F6LA 3O6FA 4HX1A 1UXSA 4DN4L 1VCAA 3WMSA 5E51A 4RBPK 4WTXA 2WMPB 4HGWB 3VGDA 1OLZA 4UYPA 4EAEA 3AQDA 4G8GE 5GPRA 3PAVA 3VFMB 1CICB 2IPUK 5IHBA 2APFA 3L3OA 2XJKA 4P2RE 4ZFGL 1PX4A 1YN6A 3ATBA 1NC2A 2ZCKH 5DDHA 3QC5X 3KPSD 4ONGH 4B0MB 1CGSH 3OR6B 3PWPA 4HJTA 5JIHA 4QDGA 4MMXB 1XF2A 1LK3L 4IBUA 3G6JE 5KUKA 1DBMH 2AI0L 3QEQB 4GKSA 1YEIL 3MUHL 3ILPA 2HFFB 1ZLWK 1KENL 3BSZH 1RUMH 1DN0B 1EZVX 2I25N 3QWQB 2DJMA 1OT2A 4BUGA 2EYRA 1B6DA 4A2HA 1T4WA 4HCGA 1R4XA 3OR7A 4XOBA 4DJMA 1IBGL 3WFEL 3ES6A 1S3RA 1QTYT 4M48L 3S3JA 2CQVA 3RP1A 2SECI 1J9RA 3RVTD 4AYSA 1I9IL 1H3UA 2E4TA 3D51A 3M1BA 4X6CA 1J1PH 1AG0A 1TZIA 4WV1B 4HJJL 3BVXA 5INDB 1BZOA 2N7BA 3PUCA 5E7FA 1QLRB 2WBWB 5IR1A 3ARQA 2FVNA 5J6HB 5AAMC 5HVHB 1SY6A 1X6LA 1F3RB 1U8HA 2BWIA 2ZZUT 1OOAA 1RUQL 5SWSB 4B5ZA 1JDAA 1O0VA 2FIRT 3RIAF 4F5CA 1AR2A 3CBKB 3F62A 5EZOH 3U9PL 4LQ1A 2J8HA 3SSGA 3NJKA 1E8ZA 1P5VA 2V5SA 3TFKC 3R19A 4MXVF 3WKQA 3EUUA 1LO2H 1PS3A 2Z6FA 2KLRA 2NW3B 2WLLB 3O4OC 4K8RD 2A83B 5KN5B 2OMYA 2PPFA 2G60H 2WHVA 3NAAH 2ZPKL 2OZNA 2K6WA 4RFNC 4LEXL 5B8CA 4TVUA 4XVJH 3PWVB 2KI6A 2XETA 1SEBB 4AXWA 5KSBB 4LSDA 1A3QA 2Q10A 3AG1B 5CO1A 1G6RH 1BM3H 3KLAA 2ZKXA 4IRJC 3HZYA 5JOPE 1R5WB 2X44D 3QORA 1P6WA 2W8CA 5BRQA 4OZIE 5DJZB 3G6JF 2GK0B 4JKMA 1GOFA 4M5YL 5SWZA 1OD7A 2H6PB 1RKRA 2XIIA 3QA3A 4UU9A 3GXDA 3TX4A 1VPOH 2GTZB 3LN9A 1PQZB 4U6TA 3W5NA 2QTVA 3RVUC 4Q9BA 2CNYA 1OM3L 2VXSL 3X1GA 2M83A 4KQ4H 3QIUA 1AQKL 2HVJB 1UQSA 2GSGB 4HLZH 2BY0A 1N6VA 1V8HA 4L5FE 2CO7B 4L8BA 4P3DA 3KLSA 4NZTH 1RQ5A 5GGRA 1NICA 4LHQB 4UT9L 4GRWH 1SXAA 4NJ9L 4YL9A 1GW0A 5I1KH 2VLKB 1PZ5B 4ZYKA 2CUIA 5T3ZD 4OV5B 5J13B 3FU9A 4L23A 5AVUB 2A5UA 5H35A 4G9DB 1QW9A 4L4JA 4NQDA 4XWOC 5M7QA 2V2WA 4Z3HA 3BFQG 4FQJL 3SKUD 4S0SD 5JW5A 1VZHA 5AFAA 3PE9A 4FQQB 5E5UB 4Q9QL 4NQUA 2YQ2A 4HG4J 4HCRL 4DFIA 3N06B 3SKOA 2R1YB 3OM3B 1RZ8B 3M88A 2BVOA 5ISZE 1EAPB 2H1LM 1MFCL 4FQ2L 1J8HE 4OD2B 3EO1A 1TJGH 4PR5B 2YZ8A 2LU7A 4PUBL 5C0BB 2ZXBA 1YYMH 2XCMC 4JHAL 2IWGA 4PS3A 2QQNL 5IMKB 2MOGA 3IWUA 3DRTB 2J3SA 3EGXB 4K94L 1W0VB 4BK5A 5E10A 3OKLA 4OLUL 3UBXB 1FAKT 2R29A 4KVNL 1EPFA 3C08H 4PBDA 5F9DC 3K3QA 4RNRA 4UTBH 5E03A 4OZIF 4YGAB 4AC2A 5C2BH 2LTQB 3CXHK 2R2EA 2MOQA 2YBRA 3QJSB 4L8DA 4JZJA 4S10A 3GXNA 1Z5YD 4KQ3L 4DPBX 4PPTA 4HMCA 1CLVA 1JXKA 1K2DB 1CE1L 1WAPA 3SHSA 3CN2A 2GFBA 1VZIA 3ETTA 2Y72A 2ZOUA 4RRPA 4F7TA 4OZGE 1QUPA 5F7EH 2GJZA 2WWMD 3Q06A 5IBTH 5D4QA 1VFAA 4NKDB 3INUH 4NN6B 3GB7B 4PGDA 3EDDA 3ZW3A 5DVKA 4UOZA 4GUCA 1XCQA 1T66C 3BYYA 3C5SA 1TM5I 4A39A 4R7XA 1WQVT 3FPXA 3PPSA 3US0A 4HJ0C 1JGDB 3LMJL 4M6NH 5TFSH 4JFZH 3GS4A 3QZMA 4JO8A 3B5HA 2EIBA 4JM4H 2GABA 1JOIA 2A9AA 1OM9A 1UWEH 3D4GA 1A0QL 3RWHA 1RUAL 4NFCA 1RXLA 2EEBA 3QCUL 1KJ2B 2K8MA 1C12A 1EO8L 1S7UB 3H8NA 3RUGF 4M5ZL 4BDVB 2OYPA 1A6WL 1EHAA 4A2LA 3WS6C 3SYCA 5IJKA 1LGVA 4UF7C 2PYEE 4JM2A 4RMSA 1ZA3B 4RMWA 5F9WC 1R6VA 2X1QA 3B1UA 3E7JA 1LVEA 4JZNB 4RZCA 3GRWH 1HZHL 4B0MM 2QGEA 1T0PB 4PJ8B 1OANA 2BDNH 4LGPB 3DO7A 1IAII 2XN0A 4AQOA 3IJYB 3VG0H 4BZ2A 3FN9A 3P54A 1LO4H 4QXUL 1H3XA 5L2KD 2N1KA 1KTDA 3TCXA 5DD1L 1JD7A 4GYBA 4LPUA 1F6AB 1QFPA 4HBCH 5E94B 4XPBL 3H9SE 1ROCA 4DOHE 1L9TA 2G0KA 1IGMH 2DQFB 4PS8A 5HYSB 3D2UB 4TVPH 4XPTL 3T2QA 5K33A 1FC2D 1MRFL 3HI5L 3SE8L 4JFOA 4X7SL 3WLWC 3BRFA 3DXAE 4F3FA 1IKNA 3II1A 4LHUB 4ZS6D 4OZGF 4QPEA 1G43A 2GITA 4TSAH 4Y19B 1UVQA 4LDLB 5JHDB 5JLZB 1KBKA 2VLRB 1ZIAA 4LLYB 5TE6L 1XTLA 2NR6A 4GW4B 3TPUB 3G5WA 3WO3B 1ORSB 1JFHA 2P47B 3ARFC 2DWDA 1R3JB 4PGEA 3B37A 3UC0L 2VSDA 4L3EA 1QSEB 3MLUH 5EU3B 5FDWA 1XF5B 4ADIA 5KUMA 4XBEL 2ISDA 4F7CA 3CX5K 3HG1B 5FK9A 1N19A 1RIUH 2ADGA 2ZSVB 4GQQA 2H2PC 3CMOL 3GSNL 4LEEA 4XBPA 1SOQA 4WUUB 3FL7A 1FA4A 2WYIA 3Q0HA 4N4YB 3PV7A 3EFOB 4OCLC 3VRJA 4TYUA 1Z5LA 2WXGA 3M1OA 2BFVL 3B2VH 4JFFA 4JRYE 1ET8A 4RDBA 2NTFA 1KJ3H 4RWHA 4X4KA 3QUMA 4EZJA 3FONA 4HKXA 1MWAA 4PB9L 3LZLA 4JMNA 1BZ7A 2IBZY 3RKDD 2R29L 4QHMA 1BAFH 4ZTPL 1A22B 1UJTA 5GS0L 4APQD 5E6IA 3PIQA 2WXFA 1HXMA 5E4AA 2EC8A 4XCEA 4ZS7L 3KWXA 5ANMB 1DDHB 2X2HA 1XGUA 1BDYA 2NUTB 4P46C 5C0CD 2AJXL 2DRUA 2IOIA 2VGLM 2QJDA 1U9KA 3CFIC 4OCSH 1RL1A 4I88A 3TBWB 1KLFB 4HS6A 4OB5L 1MCCA 4LLQB 1MLBA 2IO5A 1XCXA 2CRMA 1KGIA 3CPUA 4NENB 5A2KH 2FSDA 4KZ0A 5DK2A 2LAAA 5I5IA 4FXLA 1NKRA 2HLFD 4HD5A 4RAUB 3OG6B 3IVKA 1L9MA 4DUXA 5TH2B 4RGMC 2WTOA 1AIZA 4PMFA 2XV6B 1DUZA 3KWTA 1I9RL 1U33A 3E9UA 5FO8B 3IDGB 1S8DB 1AYOA 1H8SA 3VFRB 4S0HA 5HHMB 5DJXA 4TNFA 3RDTB 3FJTA 4CL7A 3RRQA 1LWRA 4UM9B 1L0QA 1E9OA 3GSWA 3FQXA 3ZUCA 3ABGA 3FFCD 5CUSL 2GAZA 2YMTA 1NIFA 1TO1I 2FCBA 4UTAA 3O3DA 2C3VB 4N2IA 1AXTL 2VC2L 4EKXA 1HESA 3MLZL 5C7XL 3V0IA 4ZW5A 3EXJA 4P04A 6TAAA 1WH0A 3NIFE 4QAMB 2RFXA 3L5XH 2HTLD 3OKYA 3HCVB 2IDSA 3CSBA 1JZGA 3RJOA 2OJEA 4OJFL 1XFPA 3IBOA 3B2XA 1E28A 3J7HA 4M43H 4AOFA 4HD9A 5GSVB 5KAQF 4BZ2L 4OSUH 2A9CA 3WBDA 3I75B 5DFTA 1GXEA 4ODXB 2DQHH 3HI6H 2FD6H 1XEUA 1UD8A 3HMWH 4PI0A 1MQKH 4F7MA 4Y2DC 4FMFA 2G3ZA 1MH5A 1UGNA 4LE8A 4PRAB 1R33A 3DIVA 3HE6D 1NCOA 2CR3A 1KLUA 5HP5A 3KE0A 3RI5K 5I5RA 1TZHB 2DZEA 2KUIA 1IC5H 2NY5L 1MVFA 1D7DA 2OX5A 4JFTA 4KKNA 1I31A 1K8DA 4KZCA 5E6SB 1HE8A 1YEGH 1XB8A 3FB8B 4KROD 5ESAA 2Z8SA 3IN2A 3HC3L 3TVMC 2G3XA 2PNDA 4L9DA 2GJPA 3M1CA 4QIRA 3V4UH 1C8QA 2ILLA 1FNSH 3DYOA 1DANU 2R2BA 4LIQH 4Q0XL 2FEDD 4WNJA 5AZ2L 4ALAC 4NKIH 4XX5A 1IJNA 1B4TA 3F85A 3GMNA 1EEZB 3KPOB 2RHEA 3FUKA 3H0TA 2G9KA 4XPHH 1OWWA 4GMTH 4L29A 1BWWA 2ICWI 4OFQA 2VR8A 2EE2A 2FQFA 2W92A 5DXWA 4DCQA 1TZGH 3FFDA 4I4WB 2FBJH 5IJCC 1RU9H 4XAWL 1OLLA 2YWYA 3BJ91 4V1DE 2FGWL 4JDVB 5KSVA 2B8OT 4CILA 1BPVA 1THCA 5J3HD 3MRIA 4UNIA 5FHBH 1CXIA 3ULUC 3FDWA 4NQQA 1MWAL 3QW9A 3ZMNA 1JF1B 2ED6A 2ZSWA 1HVXA 3ZO0A 4U0QB 1UA7A 4BGLA 1A7QL 2ZUWA 4L2YA 1WA1X 2IMMA 5D6DC 4EN3C 4G6KH 2JKIS 1IKFH 4A66A 1NGQH 4OF5A 5AAWC 5L4JA 5JHBA 4K8RL 3ULUE 3EJPA 4ZODA 4E36A 4YBHA 5LBGA 5KVEH 1SGKA 1E7UA 1CL7I 5BRZB 1VEMA 4L3CB 3STZB 2FLMA 3B7RL 3QRGH 3QI9D 1IFHL 2VDLB 5I6NA 1S7QB 1NGZB 4QRTA 5D1XB 3VXOA 2ZX9A 4P2AA 1JN6B 3VD7A 1ZHKB 4R97C 3ETSA 3ILQD 1K72A 4F33B 4WFGE 4WJG3 3NBNA 1EFXB 4D8PA 4EZKA 2BP0B 2D0FA 4FD0A 3MBWA 3CBRA 3B7YA 4ERSH 3BGFB 5F1IA 1CL7L 2A6JB 5AWNH 3CSPA 3S48A 2HCZX 3NFNA 5BRPA 3MU3A 4NFBA 5DWUH 4PJ7B 4NUJB 3DV6A 3GBML 4DP8X 4AVJA 2VDRL 2QTEA 3B9KD 4GT0A 2X1XR 4GH7B 3MACL 2BY3A 4HJGA 3O6LH 1FWXA 5GS2H 2BRRH 2CA4A 2NNXA 1DUYB 2NX5D 2O5XL 3L9YA 3ZYZA 2DM3A 3VU1A 4NWUH 2DY2A 3O3EB 1ZHBB 1G9NL 4UTAL 2YPLD 5C92A 3G04A 3JWOL 1XR9B 5ICXB 1DSFH 4IK7A 5T3ZL 4Z0BH 1I9EA 1BZ8A 5KTEL 3MV8D 4LL4A 4DP1X 3QXWA 1HNFA 4XE5B 1EBAA 1YJDL 1WIUA 2X6BA 2BM3A 3HPJA 5T1LA 4DPCX 4YPGA 1FO0L 2WWKT 1PSKL 2CDGB 3K72A 2EO9A 3SKJH 4BQ6A 3FUDA 4PJCE 4JVUA 2MSPA 4PYHA 5BO1L 4X6BA 4JQVA 3KPRD 4F7PA 1ZJBA 1N64H 1A6TA 1AGBB 2BZ7A 2W0FA 3FUFA 4F9LA 4F80A 3BQUA 1OOWA 4U0RB 1WDAA 2OXGA 3K5SA 3NZHH 3OAUH 3GS0A 1D2OA 4F27A 5J56B 3GK8L 3BH8A 4PJDB 4UUJA 4BHUI 1U91B 1RZPA 5FYJH 1KGJA 2RBLA 2Y36L 5TDPB 3TWCL 4XMKH 2FHFA 4DQOL 3MLTA 1RZJC 3ZZSA 4O2CB 3WFHA 4Y4KB 3T6QC 2DQEH 3QJOA 4IIZA 3P40A 2NY6C 3QDGD 4HXBL 5FLUA 1LEIA 4HGMA 5TF1H 3U0WL 3KR3L 4XOAA 1T6WA 2WP3O 1BSIA 3KDMB 3T0EC 3HZKA 1WA2X 1YEDB 3DROA 5D6CA 5SV3A 3WNKA 1ADQH 3PP4H 4WY7L 4PRNA 2O61A 3A0OA 3MYZA 3SQOL 1S7TB 2CO6B 2CKBA 3UG4A 3ATFA 2FJHA 2BSDA 4NQVB 4LSUL 1XF4B 3T0EE 4TUJA 2QKIA 4I0PC 3CK0H 4ZQTA 1G1YA 3EUDA 4IGBB 4D0BB 1P1VA 3MJ9L 2DQGL 4DZ8A 5CD5D 5LAXA 4HOMA 4B9PA 5GISH 4HFUH 5HDQL 1QI4A 1A1NA 2X4SB 1J5OH 1P2CA 1G7MA 4HUXA 4PJCF 5DJCA 1L9RA 3MROB 3Q2VA 3PRZA 4MB4A 5DRNB 2X05A 3EGSB 4OLVH 3ETBF 2F8VA 3EYQC 5EUOA 4MFHA 3TBTB 4FFYA 4NERA 1JDDA 5F6HI 3TECI 2O5YH 3NIDB 1WJ3A 2Q7AA 4DK6A 1Q72H 3NTCL 5MENA 3CUPA 4FQCH 4CGTA 1CFMA 3WELA 1ODUA 1DEEB 2OMZB 4ZUTA 3HPLB 3ZN6A 3APNA 1TVBA 4QO1A 4M9PA 3RBSA 4I0CC 2VZ1A 1XEDA 4ESKA 5CZVL 4S11A 4YZFE 5E2VH 1PW3A 2YQ3A 4EI5C 4EUPG 3QCTL 2QHRL 4A7GA 1VFOA 4N2EA 4LP4A 3ELQA 4NRYA 3S5LA 3ZX1A 4NIKB 4TVPD 5J1AA 2DV6A 4DW2H 5L9DL 5D71H 4HIXL 4H1LH 1QBMH 5DO2C 4AW7A 1K85A 1CXLA 1IGTA 1QLFB 2JIXB 2XWCA 4YGVB 3RPIB 3VRIA 3HBQA 2NY3C 1DQDL 7TAAA 1NFDF 1PNCA 5AVVB 3E9TA 5EWIH 1O9VA 4EN2A 5I1JH 2NXYC 2VZVA 4KPHH 1EQWA 2OULB 1JNHB 5IEHA 4MBRA 2D2CC 3U0WH 4UV7L 4Y5YB 5DJDA 4U6XA 3AXIA 3MJGX 4J1UA 1AQDA 1TDQA 3MRBA 5GRXG 4GBXC 4OAWB 1X7TA 3LIZH 3KLDA 3MREB 2IG2H 3TZVD 3BT2L 2D7NA 4FFZA 2RB8A 4QWWC 1IZJA 1OW0C 1I8LC 2BLFA 3QDJB 5B3SB 2IC2A 1NKGA 2DW5A 4BKTC 5HDBB 1NCAH 2BOCA 4M7ZB 5KYWA 3PG2A 1N6UA 2Z7UA 2V3EA 4P9HH 3WFDL 3AREB 4JQIH 1RULL 4LLUB 3II2A 3EGDA 4WU5A 4Q89A 1U41A 2OCFD 3E6FB 1KGYE 3BOVA 2HJFA 3NIGB 1SEQL 4GO8A 1TMGI 4H40A 3K6IA 4TQEL 1LYQA 4NPYB 2AXFB 4O2EA 3H9HB 3NFPB 1RK0A 4KWUA 4ZXBD 3WIHH 4OW6A 4CW1B 1SBSL 3VWKB 1D9KD 4R2GC 1OPGH 1GZHA 2DWEB 2FIKA 2P5WB 3I74A 1FFPA 3HG2A 1AY1H 1PZDA 1G9MH 2OTWA 1YNLL 4GQZA 2XWJB 3MGAA 4IEFB 3MCLH 4FXKA 3VFTA 3DGGB 4LU5H 3ZK0A 4KX7A 2BS8A 4CC4C 1H0DA 3WHXB 5BS0E 3O81A 3OF6D 1G6RA 3HRZA 2NYYC 3T3MB 2AV1B 3MXVL 2WP3T 3VB9A 3WJMB 3DLQR 1LEGA 1SHWA 2QFRA 3WXVL 2QKSA 4H25A 4RESB 3MRJB 4JO1H 4ETYA 1TEYA 3H9YA 4NOFA 5DD6B 5MHSE 2CGZA 1NAMH 5TK4A 4Q6KA 3GQFA 3U0PB 4Q52A 4CSPA 5I23A 1JGLL 4MNHA 3VSVA 2OMXB 1OAUL 1ZE3C 3VXRA 1RSYA 2ERJC 1JIBA 1NLBL 4YQXL 1T3FB 3NDYE 4KHXL 5I1AA 4D9RD 4QR7A 1IAMA 2J72A 2P24A 2W81C 1TCRB 2AXJA 3B9KA 3F7YB 2PP7A 5JQ6H 4U1MA 1U3HB 3ZQXA 5A3ID 2DL9A 1S9YA 1XD0A 4Q2ZB 3ZL1A 2X53A 4R4ND 2O93L 3GM0A 3UCRA 3ULSA 2SEBB 3PGFH 3V5HA 3RWJA 3ZTDC 4H26A 5H37G 3D34A 5EFIB 1SJXA 3KDPB 3VG9B 4KX9A 2G3NA 4FFVC 2PLTA 3AS3A 4DEPB 1JPSH 4FQ1H 5FA3A 1SJHB 3PDOB 4P5TA 4F8QA 3DHMA 2DH2A 2W0PA 3PL6B 1A2YB 1DQQB 1Q0YH 3NESA 3WN5B 3DX8B 3F58H 3NFSH 4FNQA 1I9JH 3AB0C 4JL1A 1U8LA 1FNAA 3S4SA 4GEJA 3STLA 3MLSH 4LLVB 2NY0D 4PJGA 4K94C 4UAOB 5IB2A 5DEFB 2NW2A 3PWLB 4BE6A 3PCYA 1PTZA 5JOFB 2ZCKL 3ABLB 4ONGL 4TTDD 1CGSL 1FNEB 1T4KA 1TJMA 2I9LB 2MTPA 2UY7A 2EZ0D 3QQ3B 4XT1C 5CIPH 1T0OA 1DBML 2OMWB 4JRLA 1I1AB 2ZWLT 3K8KA 4HGWA 4N2HA 3QARA 4UTBA 3W9EB 4JY6A 3BSZL 3VFMA 1RUML 3OAZH 2ZOKB 3G9VA 1OSEA 2L7UA 1IGJA 4PJ9D 3MNWB 2D03H 2D7OA 2WKGA 4MWFA 2Y5QA 4NKOA 4X8GA 3Q5YA 4FA7B 3ARWA 4TQIA 2H9GB 1LDPH 3AS0A 3JSSA 1OCRB 1MZYA 5BJTB 4I1PA 5F1NB 2YUZA 1J1PL 3D2TA 5ENWA 3ASNB 5TQ0H 1DN0A 3QQNA 1MXDA 1FBIH 5EZLA 4X9FA 3ZSTA 1TXKA 3EJZD 3DDFA 4PY7B 3VW3H 3VQLA 3SDDD 5T5NF 2HG0A 3BJLA 1HCVA 3MKGA 4PIRF 4DN3H 2KMWA 1CFSA 1KCSH 4HJ1A 2BNRD 4MD5A 3QJVB 4M1DH 5EZOL 2X9XA 1IBFA 4B41A 3VA2C 1QUNB 4R0LB 4YH6A 4WV1A 4NAJA 1PD0A 4QI3A 5F7LB 4F8PA 3HAEG 5SWQB 4OCNC 2X0UA 4G6AD 4P07A 3NCCB 1RLBA 4RGNB 5KYUA 3KGRA 1R3HA 1LO2L 3VGHA 3PFUA 2BCKA 1KJVB 1X9QA 1DJWA 3P2BA 2Y7OA 2G60L 3NAAL 4X7CC 1JCVA 3ZU8A 4LVHB 3F3HA 4BH7B 2CBMA 5ADPH 5HY9B 4WFFD 4XVJL 4FEIA 2LU3A 2HT2C 1BXVA 2AAVA 1G6RL 1BM3L 3CDFA 3COOA 1KTCA 4HH8A 4P49A 5DR5H 3DO3A 1YNKH 2CDFA 2VXVH 4JFYA 2ZAIA 2QSTA 1IBZA 1UXWA 1QYGH 4EI6B 1FC1A 2WLLA 1SVZA 2A83A 5KN5A 3VDCA 1QWUA 1R1CA 5CSZB 1VPOL 1D5RA 4J3BA 4KI5D 2UXTA 5DUBB 2VQ1B 1SEBA 4J4PA 3OZ9H 5KSBA 1YLBB 4G9FB 5D7LB 3VGFA 3C75A 5C71A 2JB5L 4S2SB 1ZT4B 4PG2A 4E5XB 1JVKA 1HILB 1R5WA 5GS2D 1QPXA 2BC4A 2F68X 2GK0A 4LF3A 3QIBC 1BEXA 3DK2A 4NZTL 2ZP8A 3LNFA 5CJOH 1BXAA 1PQZA 2C5DC 2EINB 1S6NA 3OPUA 5I1KL 2IDFA 4NUMA 1X5IA 3IJ7A 2J20A 3ZHFA 4F92B 2ZCLH 2CSPA 4AIXA 3A4DA 3WIIH 4NDMB 3T1WA 2Z4QA 4CADB 2CO7A 4D9QE 5I15H 2K3TA 4IBWA 4B9FA 2OW6A 2WBKA 3QUGA 2A77L 4FX5A 1GCYA 1ZT7B 4B9IA 4JRFA 4V33A 1CLZH 4KXDA 3T8VA 1JYVA 3LH8A 3TT1H 1EXHA 1I1YB 1EJ8A 3FT0A 1RZGB 3B6SA 3VNYA 4IJ3B 4LLDB 4PJBB 5GS0C 2B3IA 1TJGL 3LZNA 1MDAA 3Q1SH 1M71B 2XY2A 1YYML 3NP3A 5FYJD 1KYFA 2VDQH 1JVOA 1P4LA 4L1DA 2CJUH 1CF8H 1T1YA 3C08L 5HVWA 4J3XA 4UTBL 5KSAB 2R1YA 1RZ8A 4ZXBA 4PB0H 3CFJB 4GMSH 5C2BL 4GNKB 2JE8A 3H54A 4OCYH 4X4YB 1LMIA 2WLJA 3KYKH 3CFKA 3IDYB 4UQ2A 4PR5A 5I71C 2WQWA 1DQIA 2PWGA 1JZFA 4MVBC 4NRXA 4ODTH 2M26A 3GM8A 3Q1EA 4XXWA 5IMKA 4YSSA 1W8OA 4JN2A 2GJ6D 3DRTA 3EGXA 4NX0A 3UBXA 5F7EL 3DV4B 3F83A 5IBTL 5FOJA 5HYQB 5FHAH 3SE4C 4JGJA 4NCC1 4F93B 5EU5B 2VB5A 1T7VA 3UTQA 3M8OL 1DWMA 2YK1H 1UHVA 1X5LA 1O6VA 3MGOA 1C08A 2WNGA 4M6NL 5TFSL 4YS4A 2XA3A 4JFZL 4OFKA 3C6SA 1Z9SB 4UOQA 2TSBA 4QJ4B 4JM4L 4G1MB 4ZOEA 2GY7B 1UWEL 3RVVD 2JKJA 1NWOA 4NKDA 2J7LA 2OMTB 4P59H 5IMOA 5ABZA 1UB6A 3TWYA 1G7IB 2GB2A 3M17B 1I3VA 1WFUA 1EEUA 4WNQB 2Q6WB 1TVHA 1KFGA 2HLAA 2K9FB 3V0JA 5F93C 1MRCH 3PWNA 1IE5A 5IEKA 4KRPD 5JO5B 1OAZH 3V5DB 3RVXD 4QHUB 4AZ8B 3LZRA 4KVCL 4IBZA 3U0TA 1JHLH 5F88A 2GT9A 3MJ8B 3E80A 2BDNL 3S3CB 2CJTA 3TBSA 3VG0L 32C2B 1S7UA 3LHAA 4IS6A 2BNUB 1LO4L 4R3SA 1N68A 3GUTA 4BDVA 4RZKA 4GQ9H 2LT9A 4JZOB 4GKLA 4BQ9A 2N1TE 1BAGA 4HBCL 4QRRA 2GEEA 4WCYH 2NY5C 2DYPD 4D94A 1ZA3A 4JZNA 1IGML 4GAYA 4GO6B 5DI8B 3KPSE 3Q6GH 1OCCB 3GMOB 3LZOA 4TVPL 5I1GH 5D4IA 1IC1A 4YE0A 5C0ND 1K6QH 2FX7H 1OSPH 4KGJA 5HYJD 1K5WA 1TQBB 2P46B 4K55A 1HC1A 3ZDZE 2B59B 5LN8A 1KZYA 3ZUNC 2EH7H 4MMYA 4OQTH 4TSAL 3RVTC 5GS1C 2DI8A 3SDAB 3OKNB 3KCWA 2XYCA 4Y9BA 3KWVA 5IVZB 3BVWA 4PJ9A 4JG9A 1TJHH 4RRPG 4P4RB 4ZMPA 4JO3H 2R69H 3CH1A 3NCBB 3BWSA 1FP5A 4QCIB 3MLUL 5JW4Q 1BLNA 4G1EB 2ZXEB 1RIUL 3OBAA 2XSKA 1R3LB 3MLXH 1J9SA 2FX9L 2VMDA 3FTWA 2W0KA 3RJQB 2VJ0A 5L7XH 5JLZA 3QFDA 5JHDA 5C6WH 2OFQA 5EDSA 3R4RA 4URKA 2AXHA 2ZXGA 5KS9E 4GW4A 4HU2A 3SDDA 2OK0H 3BCFA 3B2VL 2PPEA 4JY5H 2XRAH 2WLYA 2CRYA 1KJ3L 1R3JA 2WGNB 4UNUA 5HHOE 4XZUB 1AYRA 1NLDH 1MHCB 2C3XA 5EU3A 3I6LE 1ZPLA 4ZZFA 1JZHA 1GZQB 4JM2F 3APDA 2WXRA 3FO2A 2WLMA 4KNTA 2VR3A 2ZWSA 2ZSVA 3CN4A 4BQ8A 1YC8A 1K8IA 2LAGB 3K6FA 3P9MB 1BAFL 5CJXA 1H8NA 1AGCB 3CZGA 3V6ZB 4JJOA 4N2MA 4W81A 3EFOA 3MV11 4NI3A 3DHJA 3PQYE 5FA4B 2BCMA 4JFXA 3WJLC 1IKOP 3G6AA 3NJXA 3Q44A 4OCSL 2MH4A 5FW8A 2AQRA 4LLWB 1HWWA 3SJVA 1NCDH 2PCPB 1WITA 2BSRA 3GI8H 1KDJA 5C08D 2BHFA 4KJPD 3WN6A 5GXBB 2P7TA 4PWKA 3V6OA 5T1KD 3BZFB 1MN4A 3WHE1 4YOKA 4AT6A 2ALWA 2VLJB 3BAEH 5CEYA 5BOJA 1E65A 3ZDZF 5AW5B 1LO3H 1F3DJ 1HOCB 5DFVD 2OQJB 1F6LL 1EFQA 4TNGA 5IM7B 1ZXKA 1EJFA 3GSOA 1TZ8A 3TBWA 4I9WD 4XPAH 2B2XL 1ZLDA 2ZWYA 4QRFA 3DVGB 3JWOC 3BWUC 4LLQA 2ZYHA 4MX7B 4ZUVA 4FI8A 3VXSD 1FLRH 2ARJB 5LCVH 3KNBB 2AXGB 1RVFH 3O2DH 1MFDH 3TBYA 1U8QB 2ID5A 4CMHB 1YJDC 2OXHA 4YO0B 2PPDA 1U8KB 1HI6A 2FT7A 4OZ4B 1I3GH 4W9GC 1FYTB 3MRGB 1NINA 4KMTH 1MFUA 3LIUA 1ACXA 3GFUA 5LJYH 4O2FB 3VFRA 1RP9A 3L5XL 5DHYA 3MCYA 4ODUA 1P84K 4C56E 4X7TA 3BP6B 1X4ZA 2HJKA 4M43L 4XNAA 3RDTA 4ANKA 4POUB 4UOJA 1VFBB 4OJYA 2ZICA 4N2DA 4OSUL 1DP0A 3T71A 4KH9A 4U3HA 3D39D 3HBGA 2IBZX 5I1HH 2UZXA 2H3NB 2DQHL 1IC4H 3HMWL 2FD6L 5LBSA 3U7YH 2C1PB 3CLWA 1FVEB 5D2NB 2MKWA 1MQKL 4YBQD 4PJXB 4PLKD 3F2LA 3RZCD 2C4FT 2FLBT 5CGTA 3HCVA 2GSIB 3INOA 5EEZA 4UIMA 2WLKA 5D1ZD 5A2IH 1ZGLB 1KTLA 3MUGB 3I75A 1EMTH 2F19H 1IC5L 5F8QC 3AGWA 4P4KA 4J3TA 1NJ9B 3MC0A 5IVXE 5LGHH 5FBZB 3AITA 5IFAH 1NKOA 5I9QC 4LPXA 1YEGL 2H6OA 1RCYA 3QO1B 4LVEA 3CFDB 3ZDXB 1R19A 5CMAA 3UDWC 4Q97A 1J11A 4OKDA 3AQXA 4PRAA 2DKUA 1EX0A 3DRQB 1U8IB 2DBLH 1KCWA 3H55A 3H7BA 2DQCH 2X10A 3V4UL 1YMMD 5D55A 3EJQA 1OQOA 1FNSL 4LIQL 5ICZA 4NO0B 5EDXA 4NKIL 4XB7A 1C7TA 3DURB 3LRGA 3QDMA 3QXDB 1DQVA 1G0YR 4IBVA 2IAMD 4YHKH 1FNGB 2K0RA 3VD2A 4XPHL 4GMTL 1JS4A 3X14B 4ZW3A 4Z7AA 2X3AA 1I1RA 2AERT 2J8UF 2QZ5A 3BDXA 3BP4A 3JVGA 1U58B 4Z7VE 3QEUB 1TZGL 2J71A 3L4TA 2FBJL 1AZVA 1MXGA 1RU9L 3O3BB 2R0WH 4ABQA 4M4RB 3U4AA 2VMJA 5E1IA 2EIZB 4Y5XA 3BWUF 2ODHA 5DURB 5FHBL 3L3HB 3DGCR 1Q9OA 5I0YA 3HS0B 1H3TA 1EEZA 3MRCA 1HEHC 3DVIA 3D3VB 2V7NA 1YSOA 2ORBH 3S3DB 4HH9B 3ULVH 4XO5A 4G6KL 3IGAB 2IH8A 3JWNH 1IKFL 1NGQL 4LSTH 3FSWA 2YZ1A 2FL5A 4NQCE 1A21A 1DVTA 5KVEL 1CSEI 4JDVA 1NUNB 2OR7A 2OR9H 4FG2A 1WG3A 2YXVA 1P6FA 2XZAH 1MFNA 1IFRA 5LNDA 3U83A 3ETBJ 1OE2A 3H2QA 1JV5A 4MRCA 3IBEA 3QUXB 1NCUA 2WTRA 4WI9A 1OP9A 2JCCE 1AJ7H 2OL3B 2XICA 1E27B 5IQNA 1GCFA 3WY2A 3K2IA 3LXUX 5AWNL 1ILSA 4PRID 5L2KE 1IQDB 5IVXF 3UEQA 2ZUQB 2VDMB 5DWUL 1TINA 1RFDH 4WJKB 2APBA 1ZHLB 1JFQH 3CSGA 3MLVH 1QRNB 3O4LD 4U7SA 3VA6A 4F7EA 4Z7NB 4MQSB 1ZHKA 4NNXA 5B7EA 3O6LL 4F33A 2YXMA 2H5UA 1IARB 4K3HA 2BP0A 2LVEA 2BRRL 4XMPH 3T4AB 4X8XA 4CGUB 1E8WA 4QRSB 5CLWA 1AHMA 1V7NH 4IOSD 4YBLC 3C5XA 1KIQB 3SO5A 3WNNA 4NWUL 3WKNA 4JDEB 1M1SA 3L8QA 1PX3A 1T1XB 4PJ7A 1DSFL 3MNDA 5IG7A 4NUJA 2FUQA 4ILDA 4Z0BL 5I2IB 4PJEE 4JFPB 1TO5A 3CVHB 3KD4A 5EC1B 5FYKU 3V9EA 1KPRB 3LIZA 3DJSA 4OF0A 1J9TA 1JZIA 1MVUB 4ELMB 5DO8A 2BNQA 3O3EA 3PAYA 1ZHBA 2QELA 1T6BX 5ICXA 3BC9A 2B5IB 3AXLA 1N64L 3IF1B 4L4TB 3RKDC 1ZS2A 2JJTA 3N43F 3IJSA 1CJYA 4RA0C 1ACYH 4JQIA 3RA7H 1UA3A 3NZHL 3OAUL 5E08H 1CGUA 2VDKH 4XPFH 2Y2YA 4APQC 4XI5D 1QSFD 4BFFA 3OMIB 5CN3A 4M6AA 5E1AA 4DGUA 1J8SA 4S1RH 4R7NB 3IS1X 3MUUA 5FYJL 3C6LC 3WTSA 4XMKL 1R46A 1SM3H 4JVPA 3BD5A 3T0BA 2DQEL 5BQ7B 5J11C 4WJ5B 5IP4A 3WENA 2JCCF 5TF1L 4AC4A 3H53A 4FERA 1AVAA 1RK1A 2HLFC 5C0CE 2X1WL 4RQQB 4TKWA 3FRPA 2V2TB 1ZK5A 1U91A 5DZOA 2R1XA 3FTGB 3NH7H 5TGBA 5TDPA 2CLZA 2X6UA 3RU8H 3PP4L 2HRLA 3FU5A 1AANA 2PW1B 5ELIA 3VI3E 3P30H 1X5XA 4O2CA 1JZ3A 1HU8A 4UNVA 4I2XA 5L6YH 4Y4KA 1CR9H 3UZVB 5HYFA 3T0AA 2F53A 3RIFF 2CHZA 2PTTB 1MCSA 2WKOA 1YN7A 3WJJC 1NA8A 4QF1A 4YR6B 5JTWA 1GGUA 5AYUH 4D9LH 1E50A 1OGAD 3CDZB 3KDMA 1JMXA 1G0XA 1YEDA 2FO4B 3J27A 4DWHA 1EXUA 5ITFB 3MRQB 2VM3A 4PJEF 3VXMB 1KTJA 4U2YA 5GISL 4HFUL 2X70B 4UBDD 2AS5M 3V9FA 6CGTA 2YSTA 2HTLC 1J5OL 1ECYA 5BVJB 3G5YA 3KVQA 1TEFA 3BWAB 3FFCE 3NJNA 5C0AA 3C60B 4OLVL 1B0IA 1GMEA 2AEIT 4IGBA 5JIQA 2ZKWA 3CPLB 3OLEA 2O5YL 4JKLA 1TZAA 3QFJE 1Q72L 1ZEAH 3GNMH 2DN7A 5JQIB 4FQCL 4U1IB 1FUNA 3SDXA 3A67H 3QJTB 4JLRA 4YDVA 5LNEA 3IN0A 1UXLA 1GC1H 1WFIA 1ZGLM 3D39A 3HE6C 4YEFA 5C0EB 3MROA 3CZFB 4UT7H 4NT6B 5E2VL 1YQVH 3EGSA 1FG2B 3ZMRA 3BSGA 3OGOE 5D5ME 3G6JB 4ACPA 3RE0A 4NBYB 4CU7A 3GRGA 5EEWA 4P23B 1VCBC 4YL4A 2EDEA 4WSGA 4DW2L 2OMZA 4KNUA 4KROC 1Z9LA 1QBML 1A4CA 5D1ZA 2J12B 4HOXA 3NCWA 5EWIL 1VAHA 4AJWA 4Z7QE 1A5FH 1WHOA 3L4XA 3SBWC 5I1JL 4KPHL 4K5MA 2NUPA 3ZKXC 2HRPH 2FEDC 4BCZA 4BK8A 4DESA 3GIZH 4MLIA 2HFGH 3UYRH 1JSYA 3BX7C 3MRHB 1QA9A 4M3JA 5C09D 1I7ZB 4J3OH 1CD0A 3EG9A 4NHCH 2JIXA 5FECA 4QRUA 2XA8H 3LIZL 3JTSB 2IG2L 3OHMB 4HWBA 3QWNA 4UCFA 2DLHA 2D3LA 1NC4D 2ATPB 1XBRA 2IAMA 4OLXH 5GGQH 5J3HC 4JANB 4AGLA 2Y1VA 1NDGB 4Z9KB 5C0JB 4HF5H 1NCAL 4L8SC 4OI8A 3AY2A 4F58H 4P9HL 1NTDA 3T9WA 4JQIL 4LBEB 4CJ0A 4GQPH 5DMIH 1LO0H 3FQNB 4GIOA 4JY4B 4TL5A 3SPCA 3B2DC 2XTJD 3BGMA 3FPYA 1UT2A 3JUZA 1ASPA 1DCLA 1I7TB 3EDKA 3RL1B 3O6MH 4B6ZA 1CDYA 2OA9A 3RFZC 3L1GA 4RMQA 3BPCB 3QI9C 3T4YB 3WIHL 3OJDB 1MKFA 2XN1A 1Y3CI 2J4WH 1CN4A 1OPGL 1ZLUH 4AJ0A 1FNFA 1O7DE 3ILQC 1AY1L 1W72B 1G9ML 1NIBA 4NJAH 3O4OB 1BF2A 3MCLL 3ZYOA 3L1EA 4LU5L 2Q76B 5D5MF 4WSJA 1FVDB 5CLZA 2MHAA 3FAXA 4MSWB 4JS7A 4D0CA 3AAZB 1IC0A 3H9HA 4XHJC 3VX0A 5I66B 4PEEA 4YHNB 1NEZB 1J1XH 4NEHB 5EO1B 5EO9A 2VMFA 1AS8A 1TKWB 2X89D 1G7LA 4JO1L 3LQZA 3VWKA 4JNXA 3IJ8A 1OE1A 1WBYA 1NAML 1N59B 2K7PA 4N86A 4ZFOB 1PKOA 1SXNA 1FSKB 3VTAA 1G84A 1GJWA 3CGTA 4PRIA 4ZO9A 3S5LG 2IXQB 1PF3A 3MZGB 1Y0LA 2CCVA 3DGGA 3NPSC 3WHXA 4IHOB 2WYTA 1O7SA 1GPOL 3ECQA 4WEEA 2AV1A 3IXTA 3EJYD 4LDOB 3WJMA 5JQ6L 4A6YB 3OTTA 4EDWH 5E4IA 1JPEA 1KCBA 1Q0XH 1RZ7H 4N2NA 4QMEA 3DTDA 2EILB 2KDGA 4LPTA 4NGHH 4CC1A 2NX5E 1KIRB 3DK0A 4LZKA 3PHQA 2ZOTA 2LV4A 3I3EA 4PJFA 1NGWA 3PGFL 4OZHB 3D09A 4P3CH 4GRWE 2YPLE 4YXKH 2BSTA 5DA4A 1T3FA 2PMZA 5D2LE 2ED7A 2ZYSA 3CSTA 3FU7A 4MJ6A 1JPSL 5CJBA 4FQ1L 3MV8E 3RUGB 1JMZA 1B0GA 2NY2D 1AS6A 4HDIA 3GSVB 4FJYA 4Q2ZA 2D2OA 5D7JB 3GLEA 3CDGA 3QT2A 1Q0YL 2F74B 1KGUA 1RPUA 3F58L 5GRVK 3NFSL 1I9JL 4N5UA 5IHUH 5AEAA 3O41B 3MLSL 3RGVA 4XH2A 3CHSA 4H5SB 4ZSOB 2WBJB 1MCIA 3ATDA 2P42B 3N40P 2V9TA 5I8CA 2XKSA 3PDOA 4AYMC 1CDGA 5FF6A 1CVSC 1QSFA 3PL6A 5FR3A 3S9DB 1A6ZB 4KXCA 2Y6TE 1BXUA 3L3IA 1BGXH 3WN5A 5GSRA 2MCPH 3HR6A 4PRPA 2PO6B 3SY6A 1JXJA 4J6RH 2J6EA 3MRLB 3KPPB 5DEFA 3WFBH 3PWLA 5CJ5A 3ARBD 4IBQA 3IB4A 3CFEB 3V7AG 2D03L 3QDGE 4GP4B 4ICWA 2WV3A 2OMVA 3T3PE 3ZE0B 1TQSA 5BZWB 5AALA 1LDPL 4FYQA 4YFEA 3BKCH 2YPVH 3BHBB 3QQ3A 3VFNA 3GJEB 2OMWA 3EXLA 2X2UA 4WI0A 3EO0A 3LV3B 3KXFD 1ES0A 2BHUA 4JO4H 4KFMA 5CD5C 1I8KA 3BKYH 5TQ0L 4LSSH 4JRXD 1FBIL 2ZOKA 4BD4A 3ARDD 3MX0B 3VW3L 2YQBA 1PYWA 2ESVA 2ITCB 4TRPH 4GRWF 2H9GA 5HJ3B 5SX4H 1OP3K 3D05A 3VQMA 4HLZG 4DN3L 1KCSL 2Z9TA 2HPTA 4PJAA 5D2LF 4M1DL 5F1NA 1TTBA 4I85A 3QJUB 4AIOA 4P5KA 4W9KC 4N2FA 3BW9B 2QVIA 2JJVA 2KUFA 4Z7UA 4IRSC 1EV2E 5IQLA 4FQXD 5LLIC 1E6JH 4CRPA 3VXUD 2DM2A 1NGPH 5DK0A 4JKPH 4WW2C 1TSRA 5ADPL 3ZDYB 1GZPB 2HH0H 1DBAH 5T5FA 3MV9B 2UXFA 4GRLD 1VZGA 1V3LA 5KJ7E 2XWTA 5HVGB 3ASWA 5LO7A 5J6SA 4YWGH 1QUNA 4R0LA 1I7RB 3DOSB 3GINA 5F9WB 4LPVA 1MJJA 3S4SG 5DR5L 3TEXA 1YNKL 2VXVL 3CVDA 3S0PA 3UMNA 5I5MA 1T0NB 2FWSA 1QR1A 4KY2A 1QYGL 2IANE 3UAFA 5GHWH 2YN3A 4X7EC 3FCTB 4EIZC 4NNYA 4TF4A 4K5NA 1U8PB 2EXYD 1F4AA 4M93C 3WFZA 4QHKJ 3FB6B 4R8WH 5IROA 3OZ9L 2E27L 3V4PH 3X12B 4BFGA 4DGIL 5G4NA 2EYSA 5LKNA 1BMWA 3G5VA 4A7QA 1EWHA 5E1QA 3T3PF 3MCG1 4HG4K 3PJSA 2BVUA 3VVVA 1WT5A 1UWFA 3HE7D 1PDKB 3OL2A 4YLCA 2AK4E 4JFEB 1H6UA 2L4OA 4BJLA 4URTB 5HDLA 2WUBH 4DP9X 1URZA 5CJOL 5CSZA 2K45A 1A1MB 4FMVA 1IEAA 4PW9A 3Q2CA 2VQ1A 5GGSA 1FNHA 4G9FA 4L5FH 5IB5B 3TZVC 4KJQC 3AS1A 4ZUSA 3MA7B 1IEBA 4UZGA 3O2VH 4FXGC 2ZCLL 4AQEB 1XGTA 3D52A 1ETJA 2H32B 4OF3A 1T04B 3WIIL 1BVLB 1DSYA 4N3UA 3VYPA 4YSQA 4B9GA 5DSCB 5I15L 2WGXA 3NSCA 3MBEB 1P0SE 1T20B 1X5GA 4YC2C 2IPKB 5ID1B 3Q05A 1CLZL 4CVZB 3BH9A 3TT1L 4Y7MA 4UIKH 2E3VA 4X2UA 2XTSA 1MHEB 3CFCH 4GIPD 4FTVD 3VTMA 5KVFE 4AM0B 2O6CA 1VHPA 1Y6MR 3Q1SL 4NDMA 4KOCA 4PWJA 1D9KC 4B97A 1BQLH 2VDQL 1A1OB 3OJVC 1KACB 3DOHA 2ENSA 2CJUL 1ZT1A 1CF8L 2DJSA 2I26N 3ZDWA 3K6NA 4WW2F 3UTZA 4PB0L 2PXYB 1RZKH 4GMSL 2R7EB 1WICA 3HUJE 5E8OB 2FNWA 1CGYA 3V10A 3GBNH 3GHPA 5IIEA 4OCYL 2WQVA 2CPCA 3KYKL 2CH8A 4PP2B 5FPIA 4DHLA 2VRQA 4ODTL 4RIRA 2CI2I 1XIWB 5DRWB 1WHPA 3WEAA 4E9QA 3B7UX 2OAAA 4YDIH 3FSOA 2VISB 5KSAA 1HYRC 3MNMA 1XGRB 5LDUA 1D5MB 2G2NA 3OKEB 5FHAL 4QNPF 3ZHKA 1Z0NA 5GZNC 2JQZA 3GO1H 4WFED 4NN5B 1JI1A 5A3IC 3WXWH 4X98A 1HDMA 4XN1A 2YK1L 2NSMA 4RLDA 3AVEA 1A6AB 4W9IC 2A73A 4PAZA 1P7QD 2X41A 4LCYA 4H4NA 3OXSB 4D9RE 1BD2B 4NHUB 2CIIB 4OF7A 4YXHH 5BW7C 1YAIA 4WKZB 1BZEA 4MJ2A 3IJHA 5LCVA 4P59L 5EMYA 1O5DT 1WF5A 4K5PA 1SXBA 2EC9T 3BEWA 5F7AA 3KJ4B 1PD1A 4NC2B 4AENB 2QADD 3CWGA 4CMMB 1JYNA 3LS4H 1MRCL 1S9XB 4FQIH 1DR9A 3RAJH 2HJLA 1Z9SA 4U1KA 3W1ZA 1X7QA 1THAA 4G1MA 3BZEB 2NY0C 1JHLL 5DUPL 2HX9A 2YAMA 5DCCA 4E0RA 1PFOA 4LNRB 2I32A 4J7RA 4TTDC 2RR3A 5DVPA 2YGOA 3EBHA 1XXFC 3THMH 1IU1A 3ZYIA 4PRHB 2XHNA 4GQ9L 2EZ0C 1OVZA 3WKMH 1LP9A 1U6AH 3UTSE 2ICWJ 2WLIB 4WCYL 2F54B 1I8MB 5JO5A 3HUJF 3K7UA 1CFQB 2AJVH 4KXBA 4QHUA 4XNQA 3Q6GL 5I1GL 2VDLH 3MJ8A 2NY4C 4KO7A 4UQEA 1K6QL 2FX7L 2EIMB 2VLLB 2BNUA 4PRBB 4M5SA 3WTVA 2IAAC 4GXVL 3R7QA 3MVSA 1XGPB 4FG6C 3TO4B 2EH7L 5IHZB 4OQTL 4DP5X 5L8JB 1R0AH 1SHXA 1AZNA 2NQCA 5JW3H 4HOWA 3SYAA 1AR1D 4MZRA 5IW1B 2EIKB 1TJHL 4P3WA 5DI8A 3FZUC 1WRFA 3NGBB 4NB7A 2P5EB 4NIYE 5CNHA 3UBXG 4J3OD 4JO3L 2R69L 3EOBB 1CDCA 1Y7VA 4P2QB 3TVMB 1HZKA 3P2TA 3TA4D 4PSPA 1NOAA 4MXWH 1UD5A 2ZWKA 5A7BA 3BKML 2FJGA 4LSQH 2B59A 2MFNA 1K4CB 4GKOA 3W9DA 4EKJA 5F3BB 1MUJB 2GYSA 3BYTA 3MLXL 1OARH 2XKUA 1KG0B 3U30B 5L7XL 3EH2A 3L9EA 1E4WH 3FU0A 4KTEH 3SDAA 4LP8A 1WAAA 3BPNC 3ARDA 2VLKD 2BVEA 2OK0L 1BWMA 4P4RA 4G6AC 4JY5L 2KPWA 3D08A 1NLDL 5AL0A 5I6XC 4ZX6A 3M6DA 1BLIA 3LH9A 5A40E 1KCUH 3OG4B 3TIEA 2W65B 2ICEC 1BQHA 1R3LA 4XVSH 2XIBA 5IBUG 1ZVYA 2NPLX 3GJFB 4WI4A 4E9YA 1IGYB 1KGCE 3BVDB 4NZDA 3CZSA 1ZVHA 3LEXA 3IPBA 5GGTH 3RY4A 4EN3B 1KB5B 3U25A 1HXKA 1Y18A 4E9SA 2HVKB 3AADB 5D7KE 5KVEE 5IFJA 1XH1A 4GRLA 4XZUA 4WFFE 1U8CA 1M7IB 1RZQA 2WKLA 1NCDL 2WY3B 2CA3A 1GZQA 1WD8A 5EBLA 2BVQB 3GI8L 1G4MA 1ED3B 4L1BA 2O26U 3D87B 4H0IA 3V6BR 1TM4I 2GTWA 5C8JB 3KLLA 4R97B 4HPYH 1AP2B 3VMPA 2E6QA 3L2MA 5EU6D 1WBXB 3IGFA 1LO3L 2CLRB 4WHYH 3QHFH 3ARZA 5D93B 1MFVA 3OHXA 3QUYD 4AGNA 4DK3A 1CTOA 2ZWNA 4XXCA 3KH4A 1S78D 4XPAL 1OB1B 4RSYA 3T65B 1HZLA 4P2OC 3ZT5A 1KPUB 3X1EA 2JLLA 4GSDH 4UDTA 3BZFA 1FLRL 3NJGA 2UZYB 5LCVL 3PY9A 1RVFL 3O2DL 1MFDL 1NCBH 3RWEB 4LRIA 2VLJA 5A16B 2NXZC 4ZUWB 3IPEA 1HOCA 2WQXA 5KYXB 2OQJA 5IM7A 5HI5D 1SLXA 4KK9D 1I3GL 2OI9C 1QFOA 4C83B 4KMTL 2RIKA 1NCGA 2X4UA 4MZIA 3GSRA 4PJCB 4KKZA 3GYRA 3T6VA 5ICUA 3SCMD 2E47A 4PI2A 2WIMA 4LPCA 2YGQA 1MDTA 5FV2A 2AXGA 3LQAH 4G43B 4GS7C 3SKNB 5A6LA 1MY5A 1U8QA 3T8XB 3GLZA 4JFQA 5AKVA 2ZE0A 3TO2B 1IC4L 3KWUA 4YZWA 3U7YL 5KVDH 1XGQA 3GSXB 2QR0A 3BD4A 3LH2L 1J1OH 4J3UA 5LAPA 1FYTA 3FTXA 2K1MA 2MMXA 3MRGA 1CD8A 3JTTA 4KO9A 5PAZA 3KM1A 1UM4H 3SO3C 3O0LA 2EE3A 4OTXH 3FH5A 3KYOA 1EAOA 2CKNA 2VR5A 3DC0A 3P4LA 1T0MB 3LXBA 4G8GD 4I9XA 2X2IA 3WEBA 2X42A 1ZKAA 2NDFA 4ZFFA 4M62H 3W2DH 5FYJE 3QUZB 1EMTL 2F19L 1SYSA 3TNMA 5AENA 4JFDA 4WGKA 3ISWA 5LGHL 1H5BB 4W4OC 2V5YA 1XH0A 5IFAL 1WCBA 4PJXA 4X9IA 3OMAB 3IDMB 3MFGB 1U2YA 1FL3A 4QGYA 4XXDB 4ZOCA 5B7FA 1JI2A 1VADB 2HPOA 1NFDB 2PN5A 1A9BB 4OIBA 4RCAA 5EZJA 2IALA 3WEXB 3DTXA 5B3JE 2DBLL 2KZ1B 4ZK8A 2DQCL 2JI3A 4KI5F 5A6IA 1DE4A 2DMCA 5F6HJ 1EO7A 1CT8B 2GJ6E 5E99H 3ZKSD 5C9JB 5CKGA 2VLME 3PHAA 4YHKL 3DOIA 1MJUH 1S9VB 4Z3GA 5IOPB 3NRFA 1T7WA 3OQ3B 1BVNP 1KB9J 4AQ1C 3RVVC 2R0WL 4HWNA 4JO5A 4HKBA 2VLRD 1TQVA 1O7VA 1HS6A 4HUVB 4Q14A 2C9QA 1VACB 2J57A 2NTSP 1HXYB 4ADGA 5I1DA 2PUQT 4M00A 3QZBA 5AVWB 3QXDA 1LO5B 4U1JB 1BF5A 3OSVA 4CVWA 3GXTA 1QSED 1U3JA 2W9DH 1OAQH 2VWEC 4W9FC 4WWKC 2FWOA 1FNGA 2TRYA 2WZ6A 2ORBL 3U6XA 5JHMA 3X14A 5BOPA 3ULVL 1UM6H 2AK1H 4KRPC 1HNGA 2VXQH 1UURA 3NRQA 3P73B 3RVXC 4LSTL 3TXAA 1JZEA 5EU4B 3ISYA 4JQXA 3EDFA 1EAQA 1W0YT 4U3SB 2IDCA 1YPZA 4RH4A 3K74B 2L3BA 3KS0H 3O3UN 3MCKB 4PGBA 2OR9L 2VWEE 4HAGA 5FKPB 3IE4A 2XZAL 5C97A 4ZW6A 5C3LD 4MYWB 1ZLVK 3HS0A 5ACMA 2IQAA 4FJ6A 4X6EA 2CNZA 2IIJA 3D3VA 2R4SH 2QMKA 4DSYA 2DWXA 1NPJA 1CG9B 1D3CA 2R1WA 4K5LA 4IKNA 1AJ7L 3U9WA 5B38A 1KYOJ 1MELA 5JOPD 3HBPA 5ICYB 4W70A 4L4VD 5C0NC 2WIIA 4O5LH 3L1FA 1RFDL 4I18C 2PP9A 5CF3A 3L95A 2WM0A 2V9QA 1OWRM 1JFQL 2DQ6A 3MLVL 5DLLA 4APXA 1OEZW 1UADC 3EYSH 5B3JF 3QUXA 4LLMB 4Y1AB 3TN0A 1FIGH 3TJEH 1V7NL 5HYIA 3FMGH 4V11A 1E27A 3FULA 4BA8A 2QLYA 1A9EA 5CLXA 1G7PA 4NUQA 5F21B 1IQDA 2AJZA 4EO5A 4G42A 4OCWH 3P0VH 4HYTB 1TPXC 1R5VB 2NXYB 3FS9A 4WHTA 4Y5VB 3ESNA 2NCMA 1TSHA 4B3EA 3I85A 1I75A 3NCFB 1SBBA 4PLJD 2DI7A 3SPHA 3S8FB 3DX2A 3T4AA 1PZUB 3MZTA 3UPCA 2XN9E 4P9HC 4E41B 1OB0A 3EYFB 3FT3B 8CGTA 3A4FA 2V2XA 4NQDE 3U46B 4GBXB 1X9LA 1QWNA 3MUY1 1KIQA 4AYGA 2FJUB 1UCTA 2FX8H 4JDEA 2VITA 4EIGB 5GJTL 3V0AC 4PW3A 5EF2A 5DQ9B 2P9RA 2HG5B 3I6KB 3RA7L 1ACYL 4JFPA 5E08L 1JZ4A 3CVHA 1I3RB 2VDKL 4XPFL 5EC1A 3PAZA 4PWGA 5FKAB 5ISZD 3ERXA 3LYRA 3FOLB 5EF3A 1G9MC 1Q94A 2ZAGA 1EJOL 4M61B 4ZD3H 5KVGL 5MEQB 3IFOA 1M2OA 2WVVB 1SM3L 3AY4C 4H8WH 3KPNB 4LCCC 4BZYA 1QATA 1M6OB 3CVIH 2G2PA 4DGWC 3IF1A 1NBQA 2DKSA 3EBGA 4KJPC 4KKLD 2EIJB 1ZOXA 4HS3A 1F3JB 1EANA 4FZ8H 4LMQI 3V9CA 3CFBA 4BH8A 5I75B 3Q2NA 1E4KC 3WNLA 3S6CA 2J25A 3H2PA 3NH7L 3IAQA 1BXXA 1V27A 2AZAA 3ZE1E 1CLOH 2QHLA 4WW1B 2RTTA 5DFVC 4A2EA 5IV2B 5IHHA 3D18B 4HK3N 3GMLA 3P30L 4HUWB 5C08E 1QSZA 5L6YL 1KXQE 1CR9L 1IM9D 4NN7C 3Q9PA 1YMHA 1P7HL 1RZJH 4EOWH 3W37A 5BQ7A 3SYPA 5E9DB 2K4AA 3DX7B 4WJ5A 3REVB 4U1GC 4OF6A 3EYOB 3LDBB 5AYUL 3IM1A 4MB1A 4A55A 1L3NA 4UV4L 3QUYA 4D9LL 1Y6KR 4MCYA 3HB3B 4RQQA 5EBWB 1CXEA 3L3GA 4L3AA 1J7VR 4BCXA 1YY9D 1QEWB 1E3ZA 3RWFB 3EH4B 5DMKA 1FRGH 2OSXA 4JFUA 5ABDE 3HAEB 2G2RB 4F8NA 2ZG3A 1XHHA 3VXSE 2Z91B 1E5UI 2O30A 3LRKA 5FCUH 3U36A 1OGTB 2F18A 4YR6A 1AKJA 4N1EA 4WSKA 2R2CA 5D1QB 3T2LA 1MY7A 3CDZA 4AH2A 3S37X 1T66D 1B3IA 2R0LH 2Y7QB 2J2ZB 3O9WC 3NSDA 4GSRA 4HX1B 4HJ0D 1ZEAL 2K9UA 3JUYA 3MRQA 5ITFA 1BG9A 2DYSB 2JKSA 4MJIE 1ZSHA 4YBQC 2X70A 5D96B 3FO9B 3A67L 4IBLT 1S3KH 4PLKC 4TPRH 1L9QA 2MQCA 3RZCC 1BCIA 2PYED 4JAMA 3UO8B 5I1IH 2RA1A 2A9MH 1GC1L 2K7QA 1ZTXE 5DUJA 4LK4A 4G70B 3BWAA 2Q9OA 1NC2B 5DDHB 4A7VA 4UT7L 1X7SA 3C60A 1YQVL 2I07B 1YVLA 2EE6A 4WI6A 5D7IE 1ET7A 3F7VA 3BUYB 2YFOA 3CPLA 4FEMA 2V5RA 1CI3M 4NSKA 1UC6A 3FT2A 1VA9A 2P52A 3O6KH 4GKSB 1KBVA 1Z9MA 3ILPB 5D1XD 4IMKA 1WTGT 1D7FA 2EYRB 2QGBA 1QNZH 2XIDA 3B2UD 2JKLA 1U0QA 3L17A 1DBBH 4P2RA 5DEZA 3MRDA 3CZFA 3OR7B 1A5FL 3ES6B 1B9ZA 3N50A 4PTUA 3IT8D 2HRPL 3G6JA 1CCZA 2BOBA 3U7WH 3FRPG 3GIZL 3DXAD 3P77B 2HFGL 3A3YB 3UYRL 5JPMC 2A74C 3EJCA 3ZTJG 3M1BB 3V8OA 5CR1A 1UD2A 1N5AB 4X6CB 1TZIB 3BAYA 5E95B 3HG0A 5DFWH 3VMOA 4NHCL 2YPVA 2ZNXA 3GIVA 1BECA 2XA8L 1S7WB 3CN1A 1KGWA 2HX7A 4KX8A 4Q4IA 3GKWH 1QWHA 1U8HB 2G5BA 1MIMH 1Y1UA 5GGQL 4OLXL 5I17B 2EDBA 3C8DA 4X6DE 4F58L 3MMEA 3UGXA 5J57B 3IGLA 3W0WB 5DMIL 1LO0L 3CFMA 2IFGA 1F42A 4MQTB 1P5VB 3ARFD 1AHKA 3JTSA 5EOQH 1R24B 4YSRA 4OUUB 3QNXA 3O6ML 4QGTA 5JHLA 4R26H 3JVFC 4BKSC 2OMYB 1SOKA 1GA2A 2EEXA 4JANA 4NXSA 5JIDA 3AUVA 5B8CB 3DVNA 5EIIA 1A47A 2H0PA 2J4WL 5B1JC 4B9CA 1BVOA 2Z7YA 5AAMA 4BRVA 3FQNA 3HZYB 4ANXA 1VIWA 5D7IF 4JY4A 2X40A 3QQ4A 3UXFA 3BP7B 5ID1A 2O1AA 4YHYB 1I7TA 3DX4A 5CBAA 2V6HA 5K1JA 5SWZB 2XXGA 5F0MB 2EYTB 2HN7A 2JELH 4JPVH 3BSHA 1Q4NX 3BPCA 3QA3B 4UU9B 3T4YA 1EA9C 3OJDA 1J1XL 2JMRA 5HTSA 2CO4A 4NKMB 2AVGA 5EIVA 4H0GA 5DHVH 4G2AA 1UQSB 4JPQA 5E6RB 1DQMH 4OZIA 3HC2A 3MRFB 2Q76A 4XN7A 3V4PA 4CSZA 4O02H 1FVDA 2PWFA 3V5KB 4L8BB 1XR8A 4MSWA 1NCIA 2J5WA 4MJ5A 5CN1A 1Y48I 1NEZA 1Q0XL 1RZ7L 4IRJA 3R0NA 5JR1H 3OAYH 4NGHL 4ZYKB 3L45A 4L37A 1RLWA 5H35B 4ZFOA 5SV4A 4JW3A 4M8UA 3QIBB 3V52H 4P3CL 2DQMA 2IXQA 2V2WB 4UOW0 1IUZA 4NC1C 4B7LA 4IHOA 1ONQA 2CGYA 4X6DF 4XMZA 1JAEA 1MFMA 3RILA 5JW4M 2GIYA 3F7RA 3HMXA 3SKOB 2QV4A 3TYFB 2QEJA 3LRLA 1B0WA 4WEMB 2OR8A 4NC1E 4BSVA 3EH5B 4L0YA 1V10A 2BPBA 3FU3A 2ZONA 4XI5C 5IHUL 1FZJA 3SOBH 1KB3A 3C5ZC 3EO1B 3PLYA 1XL4A 1Q9LB 1EK3A 4ANVA 3OC8A 2ZUTA 3SEPA 3LRSA 3OKLB 2H6UA 5MP6H 1BFOB 3KZ8A 3MJ7A 3GSVA 5HSFA 4JG5A 5ISZA 5FOBB 1BGXL 1FLTX 3EDJA 5T33H 5K9QI 2MCPL 1J8HA 4XWGH 2R2EB 4J6RL 4LKXB 4U1SB 4BK4A 1XB6A 4JZJB 1AGEA 3O41A 5EU7E 1JWSA 1Z3GH 4PU2A 3Q8FA 3WFBL 4H5SA 3OAWA 3LNEA 2CM6A 1WIOA 2GFBB 1SMDA 2GUOA 4KBPA 4N0RA 1GW6A 1GTNA 5E2TH 5FGCB 2JI2A 1PKQE 4F7TB 3A4AA 2SODB 2GJZB 2OTUB 7PCYA 1PZSA 1VFAB 1A6ZA 2YPVL 3BKCL 4QKTA 4XNYH 1CB4A 5SX4I 1LK2B 1TG8A 1XCQB 2ZF9A 4JO4L 4LSSL 1CFTB 1WISA 4ZQKA 5D9SA 3EOAB 4YHZH 3QWRD 4FN0A 4TUUA 3UG5A 1AO7B 4OZGA 1L6XA 4PJFF 1KIPB 4TRPL 1QBLL 3RI5F 5BZWA 3RWHB 1SN2A 1Y1DA 4UM8B 3X3GH 4NUPA 3V7MA 5DZAA 3GJEA 2W94A 3OZKA 1C12B 4ZMAT 4MDIA 3DJZA 5DJ8A 3IDXH 4RVBA 3SBRA 5I73B 3LV3A 4PP1D 2CE6A 3VWJD 2VC2B 5CILH 4HLJA 2XV2A 1E6JL 3C8KB 1ID5I 4JM2B 4ONHB 1NGPL 1KY7A 3MX0A 3QDJD 4JKPL 4PV8B 4GUOA 3WMPA 4PCTA 4RZCB 4LVNB 2HH0L 1DBAL 2VZUA 3NDZE 2DMHA 3ARED 1TFPA 4N2LA 4EQ3A 3RQ3A 4Q8BA 4WIQA 4DQAA 4MAYD 3CLEH 4N0UE 2O6PA 3EZ8A 4YWGL 3P3UA 4GT7A 3TA3D 3BW9A 1KTDB 2GY5A 1TYEB 1UASA 2AGJH 2PYEA 4ISVB 5GHWL 1OCWL 1SXZA 1TTCA 1KCRL 2DIJA 3A6CH 1FFOA 2VOTA 1N7MH 1CBVH 4OFYD 1C1EH 1O9ZA 4R8WL 2GIMA 3V4PL 1VERA 3WS6A 4N6QA 3AFLA 3IE9A 4KDVA 5HDWA 4CVXA 3ZDZB 4FCAA 4F3FB 5AW7B 1I7RA 3DOSA 1T80A 2DQJH 3IMBA 1KIUB 3LPOA 4BBWA 2GITB 1T0NA 2A0LD 4AYDC 3US1A 4TL4A 3H9SA 5G5DB 1P4BH 3FCTA 4FYTA 5CU5A 1IAIH 2WUBL 1TQWA 4LSRH 3GWJA 5K5YA 2NCEA 3VD5A 4YFDB 3M46A 3S5ZA 2KKQA 1SN5A 1GS6X 4PGEB 3X12A 4L5FL 2YSSA 1H6FA 2WOYA 4GG6E 3DXAA 5GS1B 3O2VL 2YXWA 3IXAB 1C9SA 2K70A 1M9WA 2ARWA 4I5BB 4OJCA 4JGNA 1T89C 4XBPB 1NBZB 4GKNA 2ZOLA 1I4FA 1U3HD 3S5YA 1PDKA 3L3JB 4L9LC 1MZZA 3WV0A 5HJGA 2FO1A 3GDBA 2W9EH 3J07A 2XTJC 4MMZC 3MV7D 2NTFB 1PG7W 4XBGA 2MQ0A 4TMPA 3CFCL 4I0KA 4MJHA 3R1GH 4HKXB 1MWAB 4JG0H 1TVDA 3KGTA 2FECI 3T0WA 1JV2A 3HHRB 5DEJA 1T04A 3QZNA 1BVLA 4QHMB 3EFDH 5C2UB 3ZT6A 3RDYA 3C9NA 4ODSH 1NCTA 3ARFA 2XI9A 2XTJE 4Y4HC 1BQLL 1J05A 3PIQB 2BZDA 4Z5RA 5A2LH 4EMZA 2H0EA 3D69B 4KK8D 5CR8A 4ZJ9A 1XGUB 2C9XA 4JRYA 5CEXB 1JCKA 3J8F7 4OGYH 4CVZA 2E75C 3NJMA 4ABWA 1F4WH 2FECL 2P48B 4NFDA 3IWVA 3U6XS 4HUMB 3R18A 1RZKL 25C8H 4N0YH 3PWJA 5AW9B 3PDGA 1LE9B 5CSGA 4F8TA 1UKTA 3GBNL 5C86A 1GMIA 1IAIM 2XZCH 4BFRA 4TULH 2FATH 1WFTA 5DK2B 4YDLC 3IVKB 1A1OA 3B2PA 2Z31D 3NK3A 1Z3RA 2IQ9H 1KOAA 2FZ3A 4PJ5E 2FYVA 3UTPE 1KMGA 1IIKA 1ZLVH 1I1AD 3LZPA 3MLRH 2G4EA 4N3TA 1AXSB 1GGIH 2GW5A 3EJYC 5E8OA 4PJHF 3GO1L 2WZ0A 2LOEA 3FW6A 3WXWL 4WO4D 5DJXB 4PLOB 4UANA 4LCWE 3GBLA 4PBWD 4P46A 2BFGA 2J8UB 4GG6F 3FQXB 5DRWA 4X5WA 3T0ED 2BMKA 2GAZB 1ZVNA 5GJSL 4QRPD 3LRMA 1ID2A 1XGRA 3O3DB 4NO2A 3OKEA 3L2LA 4NQEE 2E46A 4RX4A 4FLOA 4O00A 1NBYA 2NY2C 4XPGH 1S5HB 4UQ3A 2CWRA 4I0PD 1E28B 3LS4L 4HCFA 1G7JA 1FO0B 4NCC2 4NO5A 4FQIL 3RAJL 2CIIA 4PY8I 3N04A 4FOMA 4MRBA 5F0LB 3T6ZA 1VGKB 4WKZA 5JXAH 5MEOA 2PPAA 5CEZE 4KUCD 3AG2B 5MENE 3TT3H 4HV8B 4F7MB 1HKFA 1S4IA 2ZUYA 4AWJC 1P5UC 2FHBA 5AW3B 4KO6A 3THML 4AENA 2Q2LA 4QOKD 4K73A 3WKML 4CU8A 1S9XA 3F12A 3NACH 3EYQD 3POHA 4NCDA 5FX3A 3V0HA 2AJVL 5JUEH 2FT6A 3SPVA 2XOTA 3RTQD 5IVXB 3ECBA 2VDLL 2ROYA 1HCYA 2ZKMX 1K8DB 3ARBC 5DJYA 2V17H 3CC1A 1TOXA 3DHUA 3IRCA 4GO9A 5CJ8A 1XL6A 2BZCA 1XMEB 5AVTB 1MJ8H 4HIHA 1R0AL 5JW4N 2OL3H 1HHJA 1T22A 3CVCA 1WFJA 4GI6A 4RFOH 2R2BB 1CFQA 2ZKHH 4WK2B 3D9AH 4Y2DA 1NOLA 3GMNB 5CP3H 5D7LD 3S98A 3TIDA 1UEMA 3PNWA 3TYGH 3MFFB 4L29B 1KTKE 1MAMH 4MXWL 4PRBA 3GI9H 3E38A 2GI7A 4LSQL 4DCQB 4N1HB 5IWLC 3N91A 2DQIH 2NY3D 1OARL 2Y9RT 5DA0B 3FCUB 2Z35A 3KXFE 1J48A 5CINH 2MPAH 3GZKA 4OLYH 1E4WL 4JRXE 4KTEL 4BRJA 2EVHA 3MRIB 2GBUA 2V8MA 2NMSA 5IW1A 1QVOA 4KQ0A 3QWRA 1II4E 1SLVA 2ZSWB 2E0PA 2DD8H 3EOBA 3JWNC 1ZLSH 3TVMA 5I1CL 4FQXC 1CURA 4MD0A 3WDJA 1EGJH 1MVYA 1D5ZA 2JJSC 5DS2A 1ZANL 3WDIA 1KCUL 1WZMA 1K4CA 3AT9A 4PV1C 4J8RA 4MZ3A 4XVSL 1RJLA 2W9LA 4V1DA 1KG0A 1T2JA 3VWJA 1SQMA 3JWNE 4NM4H 2BJMH 3B3IB 3VXUE 5GGTL 4ATWA 4QRTB 3MR9A 1NGXA 2EDJA 4D8PB 1FFQA 3EYVA 1JZJA 4GG8A 2JCCB 3QJZA 2NNCA 2PW2A 4HIIB 2EDFA 2VMEA 4X5XA 1F86A 4P99A 4XNZC 3NFNB 3B8SA 2E56A 1RV6X 4HPYL 3FN3A 5BS0D 3B5GA 4UDUA 1SOSA 5D6DA 4EN3A 1KSRA 1KB5A 4R2GD 3QHFL 2HVKA 5AAWA 4HJGB 4K15A 1H19A 4OFYA 4Y8DC 3C5JB 3TH2T 3HE7C 2XPYA 4S1DD 2PCXA 3GMRB 2BVQA 5MHSD 5C0IA 1PAZA 4G8FA 2RQ8A 4MNQD 1I8IA 4JE0A 1CPUA 4GSDL 4Z7OE 2BH0A 4M4PA 4OD3H 5JORB 1NCBL 4XB3A 3T0VA 5A2AA 4OGAC 4AIEA 1WBXA 4W6WB 1INQA 4KMLB 1A6UH 4YBLB 5AVQB 3WOVA 2UWEE 3K6DA 3HPJB 2IOOA 2PKDA 3KL5A 2WXMA 2D31A 3T65A 1GYAA 5C07E 3PREA 5F0JB 1KPUA 3GXMA 5IHLB 1QR4A 1KDIA 3GJFK 2E9BA 5HGAA 4F7PB 2ZYIA 1IC7H