3PY9A

X-ray structural studies of the entire extra-cellular region of the ser/thr kinase prkc from staphylococcus aureus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
285
structure length
280
Chain Sequence
ETPDVIGKSVKEAEQIFNKNNLKLGKISRSYSDKYPENEIIKTTPNTGERVERGDSVDVVISKGPEKVKMPNVIGLPKEEALQKLKSLGLKDVTIEKVYNNQAPKGYIANQSVTATEIAIHDSNIKLYESLGIKQVYVEDFEHKSFSKAKKALEEKGFKVESKEEYSDDIDEGDVISQSPKGKSVDEGSTISFVVSKGKKSVKTTTESVDVPYTGKNDKSQKVKVYIKDKDNDGSTEKGSFDITSDQRIDIPLRIEKGKTASYIVKVDGKTVAEKEVSYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein kinase
publication title X-ray structural studies of the entire extracellular region of the serine/threonine kinase PrkC from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mu50
total genus 58
structure length 280
sequence length 285
ec nomenclature
pdb deposition date 2010-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03793 PASTA PASTA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2560 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3py9A04
3.30.10.20 Alpha Beta 2-Layer Sandwich Trypsin Inhibitor V; Chain A Trypsin Inhibitor V; Chain A 3py9A02
3.30.10.20 Alpha Beta 2-Layer Sandwich Trypsin Inhibitor V; Chain A Trypsin Inhibitor V; Chain A 3py9A01
3.30.10.20 Alpha Beta 2-Layer Sandwich Trypsin Inhibitor V; Chain A Trypsin Inhibitor V; Chain A 3py9A03
3OUVA 5E10A 2KUDA 5E0ZA 2MGVA 2KUIA 3M9GA 2KUFA 2KUEA 3PY9A 5E0YA
chains in the Genus database with same CATH superfamily
2EIEA 3KJ6L 2YPVH 1VIWA 3OX8B 1HSAB 3LEVL 5FGBA 5EZIH 1ASOA 2CRZA 2OXGB 1A7NH 3AAZB 3UBHA 5BMFL 1CR9H 5E08H 1YMME 2LFGA 4YEEA 1SLXA 5D1QB 3U36B 2F53A 3EO9L 4PRID 5MERA 1JPFB 2OV0A 4Z78A 3L9EA 1Y6MR 4WI2A 1J9CT 3U9PH 1JPTL 4N0FA 4HW6A 3TFKC 3RTQA 1PZAA 3UROR 2AXJA 3FFOA 4AC2A 2L8AA 3CXHK 5LGHH 3ZQ9A 2I5YL 1IBGL 4HU8A 4AYSA 3DVNA 3TV3H 1TVDA 1OGTB 2XWJB 3AMLA 3FH8A 3HG1E 4L2YA 3WE6B 3ZIMA 1EQWA 1MJUL 3IU4H 1ZIBA 3PWJB 3QC5X 5D1XD 3O6LL 2YD1A 5JPMA 4G59C 5EO9B 4UDTA 5JDSB 4XN4A 4ZS6C 3CDCA 3VFVB 1S7WB 3WIIH 3FOLB 5T1LD 2IV9A 5KSAA 1VKXA 1ITBB 2P8PA 2ESVD 3KR3L 3OKMA 4YHYB 3PWVA 5JDJA 2Y24A 3DIDA 2OP4L 3CNKA 3QJSB 4JW3A 2Q8AH 1IC7H 2BP0A 4P23C 5D4JA 3WFHA 3PDDA 3DGGB 3QUZC 2WB7A 3CFMA 1CL7H 1QFWI 1HZHH 2N1KA 1SXNA 3FW6A 1W0WA 4UMGA 1H6EA 2IAMC 1CGTA 5I6XC 1M6OB 3CUPA 5JHDA 1TO2I 3P0VH 2AAVA 4YSDA 1UWEH 1F4YL 2COQA 3RB7A 3S35X 4Z5RB 1XBDA 2FIRT 1E67A 3GSNA 2XTLA 4KNUA 5J6HA 4N3TA 2GAZB 5K9QI 2X4RB 5B39A 2FJFA 3MJ8B 4YO0A 3DMMC 4EZJA 2DQCL 4N2IA 5I1HL 5IHLB 3HBQA 2BZ7A 3V0IA 3TVMD 4ZQTA 1W72B 5C3IA 3TF7C 4CDGC 5I1DA 1T7VA 3KPPA 3TN0C 4LQFH 3CSPA 2GB2A 3H2QA 1BVLA 5HHQA 4KUCD 3TBCA 5FOBA 4ZFZB 3UTTD 1IAIL 3HG0A 1K8DB 3F05A 3TT3L 4Y1AE 3LRKA 1ED3B 2XACC 1YEIH 4LHQB 3QIWA 4AM0Q 4MD5B 4YR6B 3GSXB 3U6RA 3QJOA 4GQRA 1CD1A 1B4JH 1MFDH 5DA0B 2XUWA 2X2HA 2ICWA 2OW6A 1DBBH 3CPUA 4PJEB 4QY8A 2F8XC 5J3HD 3G5XA 3P9LB 4JHAH 5L8LB 3TBYA 5KSVA 1TQBC 2OS7A 1P6AB 1ZLVH 5T3ZH 3AJ7A 3G5YB 4XHJD 1XF4B 2EDNA 1YQVH 1MREH 3ZL1A 5LAXA 1NWOA 2QQLH 5BS0D 5CEYA 4DGYL 4TSAH 4YZFF 2NCEA 3MLXL 4R5XA 5E2VH 1QSED 3NJJA 3S34H 4QRRE 5KG9A 3QRBA 5D7LD 4FKEA 4ONFL 4TVPH 1EFQA 4HS8L 4UMSA 5CIPB 4U1NB 5BQDA 4F8LA 3QWOB 4LDEB 5C08A 4ZX5A 4OLXL 1QATA 4P5TC 3CTTA 4TVSa 5HI3C 3LQAC 4IBUA 2WQUA 3M17A 3ELQA 3VXPB 2DMGA 4E9LA 1LMKA 4FHKA 1TLKA 5M94B 5DK2B 3F04A 3MU3A 1E4WH 1KIUB 2ZYHA 2F5BH 5CEZD 5HHOD 4I48B 3FUNA 1TMCB 3RPIA 3L3DB 1ZTXL 1LNUA 2YBGA 5AYQA 2Y5TB 1BDYA 2HVBA 4PJ7B 4UTAL 4PSPA 2J5LC 2NY7L 3ARPA 3U83A 2X1WL 3DX3A 4XI5C 4TLUA 1UZGA 1KCRH 4U1LB 2DYPB 4HFUL 1S3RA 2WP3T 2Y6TE 3GIVA 1HQ4B 4KV5F 1IBZA 3W39A 3MRQB 7CGTA 4O2CA 2VW7A 3M1BA 4JHZA 4ZJ9A 5IMLA 1ET8A 2BDNL 1KNOA 4OZHB 3RDJA 4HIPA 3L08A 4IBQA 3JTTB 4X6DB 4XNYL 4XCFL 3W2DL 5I9QC 1LE5B 2ADJB 3WY1A 4EBQH 1UD3A 3C2AH 3KPLB 3WTXA 4TQEL 1QFPA 2FQGA 4YXHL 4P9HC 5GZNC 4LPUA 3QQ9C 3MX0A 4W9CC 3TPUA 1U3HD 3K6DA 2JB6A 4GG8B 5FYKE 4Y4KD 3NSDA 1VENA 2WBJD 3ZE1E 5AW4B 3MR9A 1BGXL 2ZSVB 1H3UA 1JZHA 1MCQA 3VMNA 3UBXA 4AYGA 3T8XB 1BSIA 4KVCH 1MCOH 4DGVL 5FO8B 1H3WM 3X13A 3NZSA 3U4KA 1H5BB 4ERSL 3QQ4B 4HHAB 5HYJB 1KXHA 2V9RA 3E6FB 3VWJD 4RWYL 3BVVA 4YDJB 1QNZH 2G3MA 3HBZA 3GZOA 3IMSA 5HGHA 5F6IC 1SBBA 3DX9B 4PJGA 2OM5A 2X5PA 3DSNA 4L1SA 3K71B 1L4IA 3G5VB 3K7UA 3JWDC 4MS8C 5DUBB 2YAQA 3KPMA 1H3VA 4JPKL 4QCIB 2B15A 1AR1D 5BUPA 2VXQA 3FN0L 1A1MA 1XD0A 35C8H 4HCFA 3TT1L 5IB4B 4N20A 1B3JA 3L1OL 5L6YH 1NIFA 1SJHB 2KYIA 3UEQA 1WP6A 1CDUA 2A99A 3B6SB 3O0LA 1WTLA 5EU5A 2P52A 3V5DA 1R0AL 4TSBL 5ESAA 2QVIA 5DD5L 1AHWB 1T03L 4N8CL 3GRWH 4WFEE 5ISZA 2EO7A 2F19H 1BVKA 4NT6A 4FRWA 2EH7L 4YX2L 3W81A 3OKLB 2DM3A 2YMTA 5IFHL 1F86A 3ARBA 1VGKA 3ZE1F 3MRNB 4R4BA 3WY3A 4C55A 4NC2B 5IIEB 32C2B 3UJIH 3H55A 1G7QB 4F37F 2WBWB 3V4VB 3QWQB 2V9TA 3QZWB 3LQAH 3OHXC 5DVOA 5GGSY 1OSZA 4OIAA 1HYSD 2KQNA 4XPFH 1ML0A 4YSCA 4BUQA 3BWZA 3EH3B 1Z9SB 1E65A 3GDBA 4YN3A 1ZT1B 2MQ3A 4TKWA 5CJXA 1DFBL 4U1KB 3RWHB 3EGDB 4RA3A 1L9RA 3NJMA 2DM2A 3CDZB 4M43L 3AS0A 3MA9H 3IXAA 3K2UL 3GBLA 2WUBH 1NGYA 3S4SA 4ZUVB 1G5AA 1T21A 2D7OA 2E6JA 4OLZL 3CFCH 4WI5A 4DT2A 2G5BB 2NY4B 3RA7H 1IT9H 3N1MC 2XXFA 3BSHA 4JKKA 1EBPA 3II1A 1FG9C 5D4HA 2DQEH 5EEZA 1CIUA 4Q9QL 1D5RA 3D39E 4P9HH 1RLWA 2KLSA 3MV11 4ANUA 1R5VB 2RQ8A 2FWUA 4LVNB 4D9LH 5J4MA 3MOAL 4R97C 1SOQA 5TPWH 3G08A 5F7YC 1PU0A 5CCGE 4MB1A 1Z1WA 1TCMA 3GSRA 5GS1C 4XBEL 2YK1H 2ZOKB 4PW3A 3V0GA 5DC4B 2O6EA 2JQMA 2Q1EA 3BP4A 3IJ8A 4E41B 3RNKB 2IOIA 2OL3H 1FIEA 1LD9B 3GS0A 3V6OC 3TL5A 1G7MB 3UBGA 2E7BA 4OT1L 4XN1A 2JLLA 5KVGL 3UAJC 2JXMB 5HYSA 2EDQA 2TECI 3JWDH 2KDYA 3ZKNC 4PY7B 2XZCL 3QEGL 4LDCA 5DD1H 3RZCB 2GJ6B 3FFCB 4UTBH 4XPTH 1JNNH 1J8SA 4P59H 5KTEL 2RBLA 3MV9B 1GGBL 4KHTH 2A6DB 2UVEA 2YUVA 1IFHH 2HT2D 1MG3C 4MB4A 2DBJA 4HBCL 2YSSA 4HT1H 3TESA 1XSOA 3IDXL 1URIA 4MNQA 1RZ7H 4AT6B 2AJXL 1TU2A 3TO4C 1XF5B 4MXWH 5GJSH 2APXA 4X50A 5B1AB 4JQIH 3MV8B 3D85B 3MGOA 2G4EA 3V4PA 4LLQA 1N12A 1RIUH 2W81C 2ITDB 1EHLH 3EYOB 5I1JL 1GJWA 3VXTB 4XMLH 2EYRA 4R90L 4RX4D 3T2QA 1USZA 3GUFA 4NNPH 1EUTA 1X7QB 1AE6H 2VMCA 3B83A 4M6ML 1HCZA 4WUUB 1GW6A 4DKEL 2ED6A 2OMZB 1I1AB 2VUKA 4I1PA 2H3XC 5KSUA 1TJXA 4OLVH 3FB8B 4D7BA 2TAAA 1U95A 2RACA 3Q13A 3IFLH 5IHZA 4ZT1A 1A66A 4HK0A 4XC1L 2DKSA 4PJEE 3SGEH 3CFKB 4NCC1 5DS1A 2NRDA 1GAFH 2W9EL 4HIXH 4X83A 3ET9F 5FO9A 3ZZLA 5DJYA 1ZXKA 2OQJB 2NXZD 2A9DA 3ULUE 2D2OA 5C09A 2AGJL 1HHKB 2X4PB 3ARRA 4UANA 3SCMA 1WA0X 3U6XS 1X9LA 2OSWA 4CRPA 3CHRA 1AVAA 1CFTB 3VD0A 4NQTA 4PLJC 4BV1A 1OZUA 2UXVA 1I7RA 4FABH 5FEBA 1XSKA 3WAKA 2GC7C 3CFIC 3JT2A 3BGFC 5E6IA 1AGCB 2R39A 1TTGA 4XPHL 3B3IB 5EORH 2YGQA 1D9KB 5CCHE 3VFUB 1EJ8A 1WGVA 2QEJA 4YC2C 2GSIB 4M8QA 2YRZA 5TDPA 1XCQB 5J11C 5DHVB 2XQBL 5FGBC 3KHOA 4X98B 4MJ5B 3IWUA 5FYJH 2B3IA 1JWUB 2CK2A 4EI5C 2C8NA 1CD9B 1IC1A 4ES9A 4H2CA 4A7SA 5JNYA 4Z23A 1RMFH 1XTLA 2WINA 5IUCA 4CVXB 3SGDH 1F97A 3I9IA 1NIAA 4DN3H 3RTQC 4DK5A 4U6VH 1OB1A 4C47A 2YRBA 1NLBL 1OM3L 3RWDA 1FLTX 1WITA 3J7HA 2HMID 3P30L 4PJEF 3PV7A 4PJHE 3LB6C 5FR3A 2VN4A 2OSLB 3A21A 2BHZA 1UXSB 2QHLA 2RH0A 3ILPA 4OZHE 4A2EA 3QHFL 4NNXA 5J1AB 1T2XA 1SEBA 1G1YA 3O41B 4EOWL 4C56E 4IHOA 4NM8H 4DO6A 4L4VD 5JW4Q 3ZDXB 2E59A 4YHOH 2F7RA 3KLLA 5KSAC 3KLDA 1EGJA 2HKHL 2ZUYA 3NA9L 5T5FH 5K5YA 1KLGA 4GIOA 2F1AA 5A6IA 3G5WA 3QXDA 3VQLA 1ORSB 2PCPB 1MCJA 3ARVA 2IPUG 2PABA 4OFPA 3NJGA 3GS7A 1NANH 4P5RA 1J8RA 3ARFB 4XR8C 4Z95L 2EUWA 4GFTB 4B7LA 1IBBA 3O0RL 3OKKB 4LEXL 4JKPH 5KUMA 3VVWA 1A4KB 3ZO0A 4FG6D 3RVXD 4TLSA 3BN3B 3MNZB 4PJ7F 1FUNA 2DQDH 1F6FB 1LTXA 3EHBC 2PCFA 1IBYA 3HE7A 3MBED 4FJZA 4W93A 2V7HA 2BPBA 3MUGA 1MFBL 1K72A 3CFEA 4N0RA 4D3CL 3AWGA 4WI6A 5KVFE 1KFGA 2YD2A 5DT1H 1U4EA 3A4EA 4A7TA 2ZICA 4OFDA 4OZHF 5B8CB 1PCSA 3WIAA 2XRAH 4X6DF 3B7RL 5F7MC 4JZJC 4FZ8L 3W0WA 1JGEB 4KAQL 4HS6B 2YUWA 3HUJA 3VXNB 4YDKH 5CP3H 1UEYA 1E6OH 2YEZA 3F84A 5ILTH 4G6AC 3VACA 1F3JA 5E5RB 1HWHB 3FK3A 4LSPH 4R7NA 2P45B 3INOA 4OM1H 5GGSB 2VDKL 2X09A 3CHQA 3ARDB 3DHMA 4B0MB 2RAMA 4MA7L 4UZGA 2XI9A 2V2WB 1TSRA 2FX7L 3F12B 3I74A 2ZX7A 2AERT 1XH1A 2WP3O 2WCGA 4OFQA 3LKNA 1W9XA 1PNDA 5FYLL 2QQQA 3GMLB 1OE2A 2CDEA 3OM3B 4S1SH 4NB7A 4IIQA 3FRUA 4LLMB 2WD0A 2Q7YB 1D7FA 3U7WL 2AKRB 1ILUA 4HEPG 2MWCA 1DSWA 3PHOB 1ADWA 4A7GF 9PCYA 4JFEE 4XX1E 2PWDA 3IB4A 4L1TA 4LMQE 1G84A 1IE5A 4LKCA 3PWPD 2VO5A 3DURB 3KVDD 1ETZB 4OZ4A 4RGND 4HWBA 5DQJA 3LZQA 1HTYA 1FLRL 2OMBA 4BE6A 1EHAA 2X53A 2V6HA 3FONA 2Q86B 4KKBC 1UGKA 4HLZH 3VSTA 2IDQA 3MLSH 5HGGS 2GITA 3C2SA 1HJCA 1G1CA 1VBWA 3FU7B 3I6KB 4KRPD 2X12A 3B5GA 2GTZA 1JNLL 3MREA 5C0FB 3DVGB 3NAAH 5ESVB 5KSBE 1JYWA 5IUSA 3BAIA 4DP8X 1HH9B 2ZG2A 1G7HB 4GMSL 1AGEB 1BXXA 1NGZA 3RKPA 4E9VA 1ONQA 3LSOB 5KYUB 2JSFA 4FFVC 4OUOA 3QJXA 4AMXA 4BFRA 4S1DC 4XNQA 5IGXH 1U8HA 4J8RA 1P9MC 3ZHLA 4YL9A 3GSNH 5DQ9B 4RRPG 4NENA 3GSUB 3AY4C 3KDPB 4ZFOA 1RSYA 3QXAA 1J0ZA 1SY6H 1RUPH 3BWAB 1G7LA 2LAAA 4OZIB 2L3BA 4LCIH 3MRGB 1MUJB 3D0VA 2GJ6E 3FFCE 1RY7B 1X7TA 2OW7A 2ZD0A 3NA4A 4U4BA 1ES0A 5DA4A 5EN2B 4CU7A 1DO5A 4R84A 4Y4HA 1EZVY 1FG2A 1XGYH 3OKDA 4ZAKA 2F58H 3ZZSA 1LYQA 3ECBB 4PJ8A 4X0KA 1MJ8H 1X4ZA 4ODUA 2PP7A 3FRPG 4FFZL 4RZCB 4LEOA 1TPXC 3OUVA 1EDQA 1XR8B 4AV4A 4Q8BA 2GT9B 4E9SA 3APMA 5D4QA 4FDWA 2XNAA 4OI8A 2NNRA 4IOSA 4KMLB 3MV8E 3T0EC 1JG9A 3RQ3A 4B7IA 3US0A 2CIIB 3QC6X 1MZZA 3SDXB 1K2DB 3ZTNL 1UACH 4EIGB 2J2ZA 1RK0A 2JVUA 3RL2A 3D9AH 4G8EA 4UZUA 2JJSA 3B8YA 1TQCC 1T3FA 3H6AA 1E8ZA 4ESKA 3KVPA 1MSPA 1UM5L 8PAZA 4PJ9D 1H3PL 4Q97A 5D93C 3VD1A 4HLZG 1MCFA 5JOFA 6FABH 2GSMB 1QSFA 4WUUE 4PRNB 1BBJB 4XP5L 5IHHA 4Y16B 2VWEE 4TM9A 5INCA 1UASA 1PDKB 2R0KL 1BVZA 1L0YA 2WMPB 2VQ1B 3DTDA 4JMNA 4FAAB 2XY2A 1WT5A 2D0HA 4QHUB 4NM4L 2JQZA 5F3FA 4HHGA 5BCAA 3WBDA 1H19A 2WVVB 5JXED 1KT2A 1SF3A 3T04D 3BEWA 4ZOBA 3DX1A 4JRYE 3F58L 2O5YL 3QJUB 3VGBA 2AJ3A 3HB3D 3GMQB 2FATH 2CA3A 1X5MA 2R27A 4Q89A 1KTBA 5D70H 3JZ7A 3I6LE 5DFVD 4KWUA 4BH7A 3LZFL 4B2AB 4GT0A 1EZVX 1YY9C 1X4YA 2XG4A 3OR6A 1GIGL 3DSFH 4OIIH 3IPBA 2CXGA 3AW5A 2VDRH 2AZUA 4BFFA 1MW1A 5DUPH 1JF6A 4HC1L 1BREA 4AV0A 3F83A 3PJLA 2W60A 2ITFA 3DX7A 3N6YA 1KGXA 3FQUB 1C5BL 1PD1A 1JXGA 3GD1C 2ZKMX 8FABA 3RVWD 3HOGA 4RMBA 1LO0L 3C8DA 3LKQA 1A6UL 1KLFB 4L3CB 2WXOA 3OB8A 5BO1L 3WLBA 4PJFB 3FO2A 3S8FB 4WWPA 4HKBA 4UDUB 1J8HE 4NKQB 1TJGH 5IT2L 1LMIA 4FQ1L 1MLCA 5DJZA 4LBEB 3H3PH 5IHUL 3CHSA 3BUIA 4NUJA 3LPPA 1DJHA 2FTAA 3W9EB 1DSYA 3D0LA 5I66A 2VISA 4OAWA 2WAQA 3F7KA 3D39A 3EOBB 2R29A 3MCLH 4WHDA 1OAKL 3MLYH 2XG5B 4UV4H 4Y5XB 2VITA 4YFDB 2HVKB 2HJFB 1C08B 1PCXA 4MWFB 1CTOA 2B08A 4K3EH 2PPAA 2R2EA 1KXVC 3V0EA 4N22A 4HLEA 3V8OA 1II4E 1F4WL 1Z5LB 4M4RB 5JIIA 1WHPA 4XBMA 3VQMA 2KLTA 3C9NB 5T3ZD 1DJXA 3OAYK 1KIPB 4KTEL 1TZHB 3GINA 4B9KC 5LVEA 3IDJA 3NVQA 3WIFB 1TJHL 4X80L 4ONHA 2F61A 3ZYIA 2ZWKA 1SBNI 1NMBL 4H1LB 3L4YA 3O4LB 3VD9A 4FFWC 2FECI 2JIXD 4D9QE 3C8KA 3FCTA 1KG0A 4G7QB 4MCYB 3UTZA 3DK2A 1QWUA 5FM5M 2WLLA 4R83A 2I9TB 4RGMC 4PR5B 3ME0B 4TVPD 2WWKT 4BCXA 2PYEE 3AU1B 3HW7A 3TFKD 4MRBA 3ATDA 1S3KL 3EZ8A 5EIIA 2FX9L 3C5ZB 8CGTA 4TNEA 4EUPB 3T4YA 2Y7MA 3NOIA 1IRAY 4LHJB 4AM0A 1S9VB 4ORGA 1AFVH 3EJTA 4KTDL 4QMEA 4I9WD 1Q9KA 3U9UA 4HMCA 1AGBA 2VDKB 4HXAL 2CR3A 4LNVA 3BP7B 2G9HA 1SHXA 1MCPL 3IDUA 5D71H 4ZS6D 5GGVH 4Y2NA 1WA2X 4GI6A 2IOOA 3H2WA 4TL4A 3BKCL 2KBGA 4YHZH 5HJBA 4PV8A 4GKZA 2J88H 3MNVA 1HWGB 2YPKA 4LK4A 1CBJA 2WOYA 2PYFA 1F02I 3V5HA 3ZDXF 4CADB 2LHAA 5J1SC 1VF5C 1C8PA 1P4IL 3AS1A 4P23D 3VFTA 3UBXG 1COAI 3QUZD 5FKPA 4H25B 5AW8B 1HHGA 4NJ9L 3HG3A 4V1DD 3GBMH 3D25B 2VRKA 4OKVB 1JPEA 4PJ5B 3FS9A 3SCMC 1M56B 1OAXL 2NY0B 5C0BB 1FJ1A 5H2BB 3MRFA 3JUYA 1DP0A 3V0VB 4GUQA 4MBOA 5DHXB 5DD0L 5TE7L 1H8NA 2GI7A 5L2JB 2X28A 5H37H 3EFOA 1YY8A 3O3UN 5CLYA 3N1QC 1YZZA 3B2DC 2ERJC 3TN0D 5E6IC 1I1YA 3EF7A 4WTWA 4JM0A 5E7FA 3U4BH 2YMXH 4AJ0A 2ZKWA 2GABA 1ZLUK 3AGWA 1I82A 3JWNE 1ZS8A 2FJUB 1QNIA 5A2AA 3RI5F 3X3FH 4L8SC 1ZTMA 4NZUL 2QVKA 4BH8B 4TMPA 3VTTA 1LDPH 2P5WB 4AVIA 5IB5B 1K4CA 3B43A 1F56A 5FLUA 5HHMD 5IB1B 3BP6A 4KKLC 1NOAA 5E8DH 1CI5A 3MRLB 5E94B 1WEJL 5C9JB 1T5XB 1NC4B 1B90A 1JRHI 5TD4A 4UAOB 5ELIA 5D96C 2YN3A 2QADD 1D3CA 4NO2B 5E6SB 4P3DA 4U6YB 3TWYA 2RR3A 3UZEA 3VXRD 4ZI8A 1J8KA 4PTUB 2WAHA 3IAGC 2NY3B 2QPEB 2PPDA 4GIPD 3OAWA 1HCVA 1I1FB 3GI9H 3K3QA 4UNTA 4YXKH 5HPMB 2A9NH 2J8UA 4ZMLA 2ZIDA 2WM0A 1A14L 1I1CA 4WEEA 4MD0A 3ZL4H 3U1PA 1OB0A 1OSPH 1HT6A 4HJIA 4OD2B 4L1LA 3QZPA 4PJHA 2RD0A 5E9AA 4JFZH 4P5TD 4NP9A 1AG6A 1GSKA 4WWKA 5HI3D 3V4PH 5ITBL 4H5SB 1Z5HA 2EICA 1WK0A 3BX7C 2A83A 3K81A 4PIBA 1YEKH 3CG8A 5GIRA 4OZIE 4HUMB 4LCWB 1XWVA 1AQKH 1NBZB 4XNMA 3KPOA 4Y1TA 2DQUL 4ZFQA 2BY1A 4U33A 1TM1I 1TLMA 3D12B 1XF2A 5DLML 3LN9A 1IBFA 4G43B 4F9LA 4M03A 4XVOA 4HGWA 5IJKC 2EIDA 4H8WC 3M86A 4HAGA 4UQ2B 2IIJA 1Z5YD 4XI5D 4ELKA 3THMH 1U8IA 1GOHA 5H37G 4P4RA 1ZANH 4WY7H 2BH0A 2E6PA 2IG2L 3I75A 3MJ9L 4NQUA 1O6SA 4G6JL 1MNNA 1FGVH 3LKPA 4HJGB 4G9DB 3HZYB 4GW5B 4JK0D 5G5DB 2BSTA 3C09B 3F7PC 4XWOC 4WV1C 4FA8A 5FW7A 4KXBA 4YIQA 2G9KA 1S46A 5HYFA 1X5FA 1SXAA 3VI4B 3V9FA 1KFAH 1QLRB 4FYSA 5GZND 1HE8A 3OAZK 4P57A 3QQ9D 3CHXA 4UQBA 3NSXA 4Z7WB 3SDCD 4YSPA 5I1AB 1ZHNA 2Q76A 5DVNA 2Q2LA 5HYSG 2CPUA 1IEAA 5D5MB 3IBOA 1AYRA 3HMXA 1TTBA 3SJVD 3WMQA 5IEKB 2RFXB 5C0JB 4IEFA 3B7YA 4OZIF 1MHCB 3NACH 4DN4H 1O6TA 4LARL 1WFMA 2EH8L 3KPRD 2UZYB 5EFIA 4NZRL 3LS4L 1NJ9A 1INQB 3SE3A 4I1NB 4K5OA 3QUXB 4Y9CA 5DTFB 1IGTB 1KB5A 3DWTA 3SBQA 4MS8D 4PTTA 3AG3B 2KQMA 3ECQA 3D18A 5BRPA 1IL1A 5F7DB 4ZUSB 4IIQC 3OJ2C 5A2LH 2GBAA 3V5KB 3QA3B 5E1AB 3MO1A 3S98A 1OLLA 4CJ1A 1XXDC 1E28A 4YHNA 4O2EB 1XB6A 2GPZA 3TIEA 4KI5F 4PHXA 4JCWA 3QR0A 5MHSE 3KL5A 5IM7B 4HPYL 1LEGB 2J1WA 4WGVB 4A7QA 1B3IA 4UV7H 4GKLA 3SDXF 4JFYA 1DYZA 4WHCA 4F8TA 5F93C 1FVEB 2FIKB 3NIFB 2YSTA 3MPCA 4FQQB 5I0YA 4WDIB 2MHAB 2XJKA 3TCLA 3VWKB 2D7TL 5CEZL 5CR8A 4YZWA 4XCYA 2B9AA 3AB0B 1ZPUA 2JKRM 3GNMH 4DP1X 3Q01A 2P3YA 4H88H 5LG6A 3O6FB 1PFCA 1VDGA 4HJJL 3K8MA 4EPSA 1IBHA 4F7TA 2CUAA 5TH2A 1A1NA 4XP6H 3FCUB 1RZFL 4LVHB 5AENA 3V10A 4OLUL 1YJDL 4NQSA 2R8SL 2D31B 4HUNB 2ZYSA 1HE7A 2VLJA 3RDTD 1I7UB 1XT5A 1A9EB 2AF2A 4QJ5B 1XR9B 5ACZB 4JHWL 6TAAA 3F00A 3IN0A 2X70A 4N2MA 5CJQL 2BRRL 1R5WA 4OUUA 4K2UL 5KSBA 4MB5A 3TA3B 4HKJB 4YDZA 4H8WH 4JFQA 5D7HA 5JR1L 3OPZH 1CFVL 4X4ME 1XGUB 4KNSA 4Z77A 2DBLL 1E5YA 1I7ZA 4G6KL 4F58H 3FT2B 4MHHI 5KVDE 5E8OB 3DRTB 2Y72A 2CO4A 4TPRH 5ICYB 5FGRA 3UAEA 5DMYA 5C07B 4M5YL 1Z66A 4PJ8C 3EFFA 3O4LE 4UCFA 4KKRA 3FT9A 2BK8A 3FHEA 2CIKA 1GGCL 2Y06L 3KYNB 5IWLA 3BUBA 5IW6B 3EO1B 2PXYA 4K3JL 5GRJH 1KIQA 3I6GA 4PJFF 3AUWB 2DD8L 1AI1L 4F7EA 4HAFA 2W94A 3D0AA 4JBSA 2OLDA 3WUWB 1A6VH 1EPFA 3GJFB 5GS3A 1YEWA 4J3BA 4OCXH 4YPJA 4JFFD 3BN9C 1DEDA 4LP4A 4N5EC 2FYYA 3LNFA 1IGJB 2JJSC 1KGYE 3PWNA 4GAYA 3WNMA 3HIZA 1S78C 2WKOF 3P4OA 3HC4H 3TJEH 4D9RE 2VERN 5JPNC 1QACA 4F5CE 1TO1I 3T09A 2O72A 4TULH 1AO7D 1NL0L 3UAJD 2B3RA 2YMOA 3HHSA 2WQVA 3ZKND 4HJUA 4ZTEA 2DRUA 4IDLA 1OE1A 2O6DA 4UM9B 5HJ3B 2HLEB 2XICA 3CK0H 2R4SL 3OBAA 3GXIA 5LN4A 3HS0C 2EJ1A 1WT5C 5E00A 5E1GA 3L13A 4P9MH 3VFMB 2VLRA 2BNQB 3BUDA 3F7RA 3PJNA 2R0WL 4WFHD 4QJ4B 4GKSA 1C8QA 1ZHKB 3GBDA 3KLKA 3QIBC 4EN3B 4PJ5E 3TO4D 4MAYA 4FQIH 1EXHA 1AHKA 1WA1X 2A73A 2IFFH 4D0DA 1V7NH 2X4TA 4FZEH 2NW3A 1ZDSA 2UWEB 3UTSA 4I5BB 3R4RA 4WUKL 4LF3A 2WN3A 2Y2YA 1VEOA 4WW2B 2VM9A 2Y7QA 5IQ9B 1YNKL 3PNWA 3EJYC 3P02A 5L0QC 5AUMB 4Y4FA 2HKAA 1SYSB 4A6YL 3ML8A 4UINL 4XAKE 4PRIB 3FSAA 3KXFB 2FT6A 3MOBH 1GGTA 1TCRB 2XSKA 3N40F 3RUGA 2F6AA 1KTCA 1A6PA 4U0RC 1DBJL 1G6RA 2H9GB 3UPAA 5GGQL 5DK0B 3H9ZA 3LS5L 5IK3B 3L1FA 1ACYH 4ZO7A 3FQXA 4KXZH 4E5XA 1A21A 1TJIH 4RFNC 2IJ0C 3RIAF 4WO4C 1CZ8H 3JXAA 2GTWB 2Q8BH 2WUCL 4UT9H 3W38A 2OBGA 3QWRA 5D1XB 2ZUVA 4LCCB 1P6WA 2ZWYA 4BUHA 2CK0H 3FUIA 3NG5A 1URZA 4U1HB 4V33A 4M7KH 2W65A 1S7QA 4NEHB 2QPDB 1AXSB 2WWKO 2IBZY 3BQUB 1RPUA 5T1LB 3JYCA 4BK5A 4YJZL 4PG9A 1VGEH 2CDFA 4WENB 1J8HA 1F42A 3E80A 4QYAA 1XSJA 3DOSB 5D9SA 3WD5L 3NUKA 1OPOA 1VCBC 4PLJD 1OQOA 4Q0XL 4FEIA 1VERA 1XGTB 4UUJB 3P11H 3PUCA 2X1OA 1NQBA 2FWOB 1XAUA 3MRHA 3UPRB 2ZWSA 4XC3L 4NQDE 3I02A 1RUAL 5D7JC 1XQ4A 3O3BB 5EZJA 4IJTA 5DS2A 3ZUNC 2Q6WB 3U7YH 2P5PA 3F85A 4R7VA 2YXFA 3LPFA 3UYRH 1CDHA 3KJ4B 2OMVB 3L6FA 4EI5D 1GYAA 1NCDH 3AXIA 1CGVA 4PGJA 2F53D 5F9DC 2J1ZA 5AD0B 1G9MC 3TVMB 1GZQB 4P5MA 4I0PD 5I71C 5DVLA 4OZGA 4UQAA 1C5DB 3RTQD 4PWJA 1KIRA 2WBKA 3G9VA 4FQHB 4G7RB 2H32B 4TSCH 3V6FB 4PJIB 4OBRA 3BCDA 5D71L 3WHE1 1CE1L 3D50A 2JNZA 2J43A 3SQRA 2H2SC 3HI6L 4DOHE 3LB6D 5EOTB 2I07A 2E9WA 1CPUA 5MP6L 3QI9A 4FNLL 2WXMA 7FABL 4U1IB 4ZPVB 4RFOL 2GY7B 1TKWA 3MN8A 3OC5A 2NNAB 4KDWA 3HE6D 5EZLB 1UCBH 3PDOA 2HYMA 2MRYA 2CM5A 3OJMB 3VI4E 1DBAH 2AK4E 2OTWA 4JO5A 3PWUB 4EKXA 2P47B 5M95B 2BFGA 1N9PA 3MOQA 3OTTA 4L9LB 1JZEA 4Z7WE 2IALA 2Y5EA 2IBZX 5DC9B 5F0PB 1S5HB 3SDYL 3KPNA 5BS0B 4BHUI 3O8XD 1I31A 1JERA 5KBNC 2ID5A 1CXLA 2X42A 3EYFA 1QSEB 1UVQB 2G60L 4F7PB 1E30A 5D7LB 3VXUA 5JHDD 2YKLL 2PO6C 4ODXB 3QYMA 2H8PB 5TDNA 1FL6A 3EDDA 4JGUA 4N1EA 1KJ2L 3D4YA 4YHMH 3QB7C 5AYUH 1PAMA 3B2PA 3DJRA 3BVTA 1MKFA 3BT2H 4IBWA 1DE4A 1UD8A 2D4FA 5AB0A 3B5HA 4ZTOH 3EHBD 3ULUC 5HHOB 4ALAC 4R6UA 1IEBB 3CPLA 3CVHH 3LD8C 3KBPA 3T77B 5AB2A 3BIKB 3NJFA 1JPGB 3APFA 1R3KB 2W95A 4FGMA 1WICA 2XXCB 2APSA 1WISA 3SYQA 2OTUA 1TZIA 3NIFE 1B88A 3L5IA 4J7RA 3JVGC 3VI4F 5I1CH 3QO1A 4GG6A 2RCSL 3HC2A 4G6AD 4Z7WF 4WJ5A 4PWHA 4FULA 3LXUX 4X7CC 1IIIA 2NX5E 4DERA 1W80A 4JB9L 5D5MF 3WS3B 2X6CA 3UZEC 1IV8A 1BFOA 2QQKH 3VUAA 4C4BA 2O93L 1VRSA 2G75A 4WJKB 4M56A 3U0PB 4QYOA 3QEUB 1G94A 2ZYRA 4Y4KB 4JKWA 4UU9B 5LDUA 5E51A 3G6JB 4XXDB 4RGOL 5JHLA 2OA9A 3EJPA 1JF1A 1THAA 3IDYB 2H45A 4NCC2 4OCSH 1A64A 1KGWA 2BIIA 1HSBB 3UGUA 4N2EA 1UOKA 4L8DA 5FDWB 3SKMB 4AE0A 5EEWA 3SDAD 4N9OB 1VCAA 1JN6A 2WQSA 5FUCE 2P8MB 3WTVA 4HPOH 3CFNA 2YBRA 4LRNL 1Z9NA 4CN4A 2NLJA 3GKWH 2MOGA 5CP7B 1ZLSH 4WWKC 2UZIH 3VRIB 1Y48I 2D9CA 2RQEA 1U8QB 3ISRA 5ID0A 3E6HB 3T6QC 3VAEA 4CKQA 3VRLE 2YC1B 3DUHA 3E2HB 4O58H 1CF8H 4OM0H 4JRXE 1AH1A 1BG9A 4PRHB 3CZFB 3RL1B 4KKBD 3H9SB 1Y1UA 3PABA 5C07E 2VSCA 4ICXA 4JPIA 3NIFF 3QQ3B 4Z1PA 1SUHA 2IADB 3MXWL 4XRCA 1OLZA 1JMXA 4PWKA 1D5BA 4ZMXA 4OCYH 1A7RH 5JIQA 5GSVA 1W72H 5FUOH 2CLVB 2BMKB 5E2TL 2QGDA 1UZ8A 3BXNB 1I53A 5GRVL 2YPLE 4KJQD 1T1XA 4XB7A 3SD2A 1K6QL 4I7ZC 1HI6A 1RU9H 4N25A 3SPHA 5KJ4A 4FFVD 2HJKA 3VXQA 3R0NA 4ZQKB 2GJZA 4S1DD 4HOMA 2X0VA 5AAMA 4KDTC 3R1GH 3K0WA 1GS8A 3IKKA 4L3AA 4BKLB 2X6VA 2B0SH 3GXNA 1CI3M 2CO7A 2FAUA 4YDIH 2XIDA 3M07A 5LBGA 3UXFA 5F0MB 4F33A 1TNNA 3HC0B 3GJEA 4JM4H 5LBSH 4HG4J 2O6CA 3UABA 2EC8A 5C71A 3AREA 1OAUL 1FH2A 3C60A 4YAQB 4EDWH 3ULUH 4ALAH 4DETA 3H4HA 4M1GL 2GKIA 3D8MA 1Y1KI 3WEOA 3LJ3A 2RMNA 1S7RA 2R0LH 3MCKA 3OD3A 3DPDA 4AZ8A 2BNQE 2ICES 1L9MA 2PW1A 4XAWH 3SE3C 1KJ3L 4F15B 3O3AA 3PXLA 4FLRA 4PYHA 5JW5B 3GMNA 3HHMA 5I1LB 1YECH 4HJSA 3GTNA 4CW1B 1CCZA 3T0ED 4PYGA 4MJ2A 3T4AC 4YPGA 3L9RA 4R2GC 4LCYA 2QLYA 2Y22A 4NKDB 3RBSA 4J1UA 5HGAB 3V7AE 2ZP9A 1LEKB 2ZOUA 2XQYG 3KXFE 3D3VA 4JFVA 1OOWA 3U2JA 3PL6A 2NQCA 1H6TA 2WLJA 1IAIM 1BD2E 5HDRA 3ZR5A 4OJAA 3DJ9A 3WGUB 3TCTA 3CN3A 4AUUA 3VTMA 4GAFB 5KOMC 1UA7A 1ZA3A 5DJDA 3OMAB 3ZKMC 1J05B 4XVTH 1T4KA 2J8OA 2XT1B 3QEQD 3FT4B 4PH8A 4F2ME 3P3TA 2Z8RA 4NJAL 4W9JC 5D1ZD 3VGHA 3RDYA 2FO1A 2YAFA 1WBZA 3V6ZA 1S8DB 3CLEH 3CDFA 4YDVA 5F8QC 5EOQH 5EBLA 3BC9A 5BZDA 4M7LH 5ANMB 5GISL 1OM9A 4PJBB 2EUZA 5FM5O 4N8VA 4R4FL 2G2NA 2VH5L 1E4KA 2X89A 4QRRA 2W5PA 5JLZA 2V0AA 2GEEA 2OXHB 4UT7L 1PKQB 4ISVA 2XKUA 4QTHB 5I24A 2JCCA 3B9KD 3OKEB 5FV2A 4ZMPA 2G4GA 3CVIL 1T22A 1ZSHA 1UEMA 2FGWH 2WTRB 1YY9D 3CD4A 2CJUH 4D8PB 4YDLB 1E2WA 2UWEF 5HSFA 4LFHG 2MSPA 3ILDA 3H7BA 4W4OA 4WW2F 3VVVA 2RJMA 1KCWA 1KCKA 1JXDA 1OGAD 5HDLA 1BQSA 5K1JA 4IDJL 4GKNB 3V8CA 4OLEA 4IW4C 4F7CA 4K3DH 3N40P 2A77H 4F8QA 4N8PA 1RXLA 4N6RA 1RHFA 1VZGA 3HR5A 3CVCA 3HZKA 1MFAL 2VC2H 4P2QB 3NIGB 3LH2H 4BYHA 1S2EA 5KJRH 3MXVH 3S8WA 1Y3CI 3WTUA 3FT3B 3UTPD 3KPSA 3QE5A 3NJLA 4H26A 1KLUB 5KVFH 1G43A 1MQKH 3F7YA 1QD0A 3FU6A 2XZQH 3QFDA 2J4WH 1FVCB 1SQMA 4G7SB 4IGBA 4MZ3A 4PJIE 3RB5A 1GGIH 4QRPA 1DQMH 4Y5YB 1V54B 6CGTA 2ADFH 3D05A 1CYWA 3LQMA 1QEWB 4NZJA 1X44A 2YPVL 2AXWA 4K23H 4LESA 2DI8A 5EZIL 1A7NL 1MCNA 3MI6A 4LU5H 1CR9L 2DV6A 2KLRA 5E08L 2MH4A 4B1TB 4HWUA 4NOBA 3TOPA 1X9UA 3UAAA 3FOMB 1VZHA 1W2KT 4AYDC 3EXJA 1BOYA 3WTYA 1KB5H 1KJMB 1KJ2B 4MAUH 3RWFA 1CFNB 5FA3A 2Z1KA 5F71A 3UGEA 3WNPA 3U9PL 3SZKC 2X6BA 2Y1ZA 3DUUB 3LDBB 2WIIA 2GK2A 3AM8A 4XP1H 4WI0B 5LGHL 1Z9PA 2WKGA 1Z9MA 4DP5X 3MFFB 3UTOA 1Y0LA 4K15A 3RKDD 4YVNA 5LAPA 3TV3L 3PIQA 3KPQB 5FDYA 1M7DB 1JFQH 3IU4L 1WZ1H 3GI8H 5AOIA 4HFWA 2Y69B 3ILEA 4NDMA 4OFYA 1U91A 3O9WC 2BIPA 3WXVH 3S35H 4GW1A 4NQCE 3RX7A 3OJDB 3WIIL 3QYNA 5J0BA 1HJBC 3MRJB 2F9BT 5AYTA 2BSSB 3N85H 1L3NA 4Y4FC 2A9MH 4KY1H 2R23B 4FQPA 1CFQB 3QDMA 4IOIA 4KUCF 4PJIF 4QF1A 3EZJB 1KPUA 3WHXA 2Q8AL 1IC7L 2EYTA 3ESMA 1NCNA 1MVUA 2YOCA 5C0AA 1IILE 3L4CA 3A6BH 2ZX6A 3IDGA 3SY6A 1CL7L 4EXKA 1BV8A 1J88A 1HZHL 5FLVA 5CHNA 3UZQB 2XX1A 1KBBA 2ENQA 2FB4H 2VDNH 4IMLB 4PJDE 5ABDE 4JQXA 3P0VL 1UWEL 3H0TA 4WW1A 5L4MA 1FFOA 3S3JA 2D3NA 3WL9B 1F2QA 1FHNA 2SEBB 1V7MH 4TUOB 2CLZA 4I77H 2K78A 4LNRA 3DXAA 4L4VB 1KB9J 1MJ7H 2F7IA 2I60H 2AV7A 4F92B 3BLPX 2VN6A 4BK5C 3ZOAA 2EKSA 4LQFL 3SCMD 15C8H 5ANHA 3VI3E 2IH3A 1E9OA 4KK6C 2FBJH 1WC7A 2WSPA 2WXQA 1WS7A 1BAFH 3B2MA 4AYFB 4EDXA 4F9PC 4NERA 2R69A 5D2LB 5I5IA 5B1JC 1YEIL 3N06B 3VSUA 3I6SA 4MNHB 1F1AA 3RWIB 1KJVB 4PP2A 2FVNA 4QHNA 4UM8A 3V0AC 5E6ID 5C92A 4PPTA 1B4JL 1AD0A 1MFDL 2J6EA 4PRPD 3VSQA 4B0MM 2QBWA 4KBPA 4ZD3H 1DBBL 3NFPB 3QZOA 4LRIC 4WU7A 4A66A 3MRDA 1PX3A 1IJNA 2H6OA 3MRKA 4PBWD 1SNRA 2X4OB 3CCHA 1HHIA 1E9QA 2OR8A 4I2XE 5T3ZL 2P4AB 4WKZA 1YQVL 1L0PA 1MREL 4PRHE 3WKNA 2QQLL 1A9BA 3MBEB 3H9SE 2XCMC 4KKLD 4TSAL 3GSWB 2CZNA 3SPVA 4OFIA 5E2VL 4LGRB 3L95B 4P2OA 4IIZA 4XB8A 1JVOA 4XX1G 5HJGA 3S34L 5I73B 2V2TA 2WXJA 3RIKA 3ZHFA 3UADA 2NMSA 5CBAB 4U05A 2DIBA 1BYOA 1ZIAA 4TVPL 3WJJA 3L54A 4FQLH 2WXFA 4J12A 3ZKSD 1JHTB 43C9A 3T0VA 3F7VA 4LCUA 5E8PB 3QI9C 3WKPA 1EZUA 2WXKA 1OKEA 1XXFC 3AQZA 2HLAA 1C12A 3OF6A 3RFZC 1HYRC 4G72B 2FEEL 1E4WL 1Y18A 5T1MA 2F5BL 2WWNA 2FCBA 1JNHA 4Z7VE 2GC4C 5F7WC 5HGDB 5HVHB 3G6JF 1FYTA 4R4NC 3KYKH 4KXCA 3HG1D 1FVDA 1QBMH 1RV6X 3DO7A 1CGSH 2EE2A 4R0LB 1I9JH 3N43B 3VA2C 2VLKA 3DARA 2BSDA 5AZ2H 3BVDB 3EH2A 1KCRL 3NYKA 3IWVA 5I17A 1BEYH 1KF9B 3ABLB 4HUUA 3WKQA 3DECA 2HH0H 1NMCC 2HT4C 4EBQL 2XY1A 1YPAI 3C2AL 4I88A 1YEGH 2CNYA 3HZMB 4E42A 3NEOA 3KS0H 4IMKC 4J8QA 2KI6A 2MPAH 1A02N 4AKPA 4AGMA 2E46A 4JUSA 5F1IB 4DK6A 2WBXA 4K71B 1A25A 2I32A 3ZDYE 4DUWA 5DHVH 3RWCB 3P0GB 1NEZA 4MASA 4XWOD 4S11A 3CHPA 4KVCL 1QLFB 1MCOL 4G80B 3GLZA 1HHHA 1ANUA 3OQRA 1P6FA 1OP9A 4IRJA 4MAZA 5MEPB 4TTGA 4HIQA 3NABH 4G83A 1TTAA 5FECB 3V0FA 1KTRL 5EC1B 1KBVA 2VXSH 3LKSB 4NN7B 3MNMA 5G55A 1QNZL 4BRJA 5FO2A 3UJJH 3GDCA 4RFEA 3IJYA 5JYLA 2FYVA 3BPLC 4NXSA 3RGVA 2XOTA 5IW1A 4TNFA 5JO5A 4JFDE 3UMTA 5A7BA 2HVJA 5KYWA 2J72A 2A6JB 3QPKA 3KYMA 3ENEA 1HVXA 2H3NB 3GMOA 1U58A 4TS6A 1WAAE 2GI0A 3FU5A 3L3KA 4PGDA 1X5JA 35C8L 3MUHL 5GRWA 1QKZH 1KBGH 2JKJA 1PLGH 5L6YL 4GMTH 4Q2ZA 4F3FA 4LLYB 1MCWW 4F7MA 1B2YA 2FUQA 3CDGA 1PKQE 2OJEA 3GRWL 4FQ2H 3C5XA 5CCKH 2JCWA 2F19L 1MH5A 3KGSA 5DMKA 5EUKA 4U1JB 3Q8FA 4AV5A 2XWZA 2BCKA 4GXVH 3AITA 3MCYA 1CD0A 5DUJA 4HV8A 1RZPA 1S7TA 1H6FA 3UJIL 1ZGLA 1BIIA 4FLOA 3VX1A 4QRRD 3KH4A 2UYLA 3WCYA 1P5VB 4D7PA 5AVYB 3LQAL 1NGWB 1ZXQA 4XPAH 2HFFB 4XPFL 4KO5A 1GVIA 4QD2E 1HOCA 4UOQA 2AV1A 3F64A 4JJ5B 5G4MA 1GSMA 3SKUD 4WHYH 3W37A 4P2QE 1QABA 3NIGE 2CKBA 5FX3A 5I2IB 4LAJH 1VFAB 3ULSA 4GQZA 3NCFB 4MDJB 1BQRA 1FC2D 3MA9L 4MMZB 4BFIA 5CCJA 2YFNA 4PJXE 4PJ9B 2WUBL 2K6ZA 1IM3A 3E1F1 1XCXA 5DHYA 1WH0A 3BZ4B 1IGIH 2DQTH 4NFCA 4O2FB 3SB3A 2NDFA 3ABGA 2K9UA 3T0AA 3TZVC 4JM2B 4I3GA 4MSWA 3QH3B 2WXGA 3LKOB 1BM3H 2GHZA 2Z4QB 3BAJA 3KGTA 4S0TD 3RA7L 2E9GA 1IT9L 2QPUA 4PJBF 1PQZA 5AAMC 3RY6C 4KUZH 1N26A 1NCWH 4XH2A 2L7EA 2X4QA 4U7MA 5IG7B 2DQEL 1KTDA 4XN8A 5SWZB 1CVSC 3S5YA 1WPCA 1U8JA 4P9HL 6PCYA 4M3KB 1FRGH 1QG3A 4I1RA 4WIQA 3D2UB 3STBA 3AREC 3C60C 4D9LL 5J12C 1OP3K 3HB3B 1RURH 4X4ZA 5TPWL 2FZ3A 1UHVA 4XCEA 1UA3A 5BOJA 3AS3A 4PJ8D 1BJ8A 2YK1L 4PVMA 1OW0A 4QRFA 5BZWB 4XO5A 4FNUA 4U3SA 1DEEB 1HH6B 4Y16C 5F3BA 1MHHA 3NIGF 4YDNA 4ETQA 3HPJA 3VXMA 2OL3L 3CFDB 5DJ0B 2B5IB 3MJGX 3FQNB 3S3CB 3SE9H 1PPIA 3VSVA 3FQTB 2HG0A 1Z9OA 1KPRA 3IDMB 3JWNH 3JWDL 4N5ED 3WENA 1G1KA 5DD1L 4UTBL 1Z6JT 4XPTL 3WMPA 1FE8H 3WFCH 1JNNL 4P59L 5B21A 3BP5B 1JZ3A 4X6CB 5CZXC 4KHTL 2CBMA 4DZ8B 5I1GH 1S78D 2YLKA 4NIKB 1IFHL 2ITCB 2VLME 3DBXA 3PQYA 2Q87A 5I8CB 4WHYG 3U2SA 4M6AA 2A4EA 3B5TA 5FV1L 4HT1L 1DDHB 1RZ7L 2X6UA 4HJTA 4JPVH 5KJ7E 2GTQA 4MXWL 4D94A 5HHPA 4G42B 1R3IH 4K73A 4G9FA 4JQIL 5DXWA 3OL2A 5DEGA 3BGMB 1ECZA 1AKPA 4QRSB 2E76C 1BD2A 3M7OA 4YNYB 1C16A 2X4UA 4Z3EA 4WFED 1CLCA 1RIUL 3ZTCC 1HS6A 1EHLL 4ZSOA 1HNGA 2B2XL 4QRUA 1OEZW 1UGNA 3QIBD 5DEFA 3QUMA 4XMLL 2MNUA 5INDB 1E4KC 4WWID 5I75C 1BMZA 4NNPL 3QNFA 1QPXA 1AE6L 1YMHB 3NCWA 4RAVA 2XLLA 2FO8A 2W07A 5DRNA 5DRZB 3SPGA 3OB0H 4MA8H 4WEMB 3X17A 3LIZA 5EC2A 1P5UA 2EDTA 4ONGH 4PGEB 2VR5A 2JIXB 3BISA 2ZNXA 1YO4A 1X5HA 1M1XB 4OLVL 5J89A 1I8KB 3EG9B 3IFLL 5FYJU 1GA2A 4BZ1A 5D6CA 4LASH 1NGXA 1KZQA 3QEHB 1I3RB 4IRSA 1GAFL 2VMFA 5CZVH 4HIXL 1UB6A 1B9ZA 2EC9U 4OSUL 5F70A 3A4FA 2VDPH 1GRWA 4KX7A 3ES6A 4M8RA 4WO4D 3FTYA 5BVJA 2J25A 3KDMB 5IROA 3BIAX 5I0VA 1H8SA 3P0YH 2QKIA 1MY7A 4LVOC 5CD3A 1JDDA 4QRAA 3JWNG 3KZ8A 4FABL 4IGBC 3VXOA 4C4KO 3Q1SH 3FPXA 3D39D 5EORL 5F8RC 4ANVA 4FNTA 3TBWA 4GJTB 2WLKA 2JJVA 3OMNB 1YEHH 1TM4I 1XDTT 4DEPC 5FYJL 5BPPA 5HHNB 3LAFA 3H1ZA 4P23B 1DN0A 3FTGA 1ODAA 3MMEB 3TX4A 4AJVA 1P2CB 3II2A 1KZYA 3QUZB 3K91A 1BLIA 4PV9A 1EVTC 3CE1A 1KCUH 2GVYA 3SY0A 2VTFA 4V1DB 5D7JD 5D2LF 1RMFL 2IAMB 5I6XB 3UIZA 1LGVA 1WFIA 4DN3L 3OC8A 4U6VL 1MW2A 4PY8J 3HFFA 2A38A 4UQDA 3AM8C 2HSIA 1OGTA 1T0PB 3OKNB 1DVZA 4WZ9A 2J71A 2Z7ZA 2FBRA 2I9LA 2K8MA 3D7PA 3DMMB 1IQWH 3MHZA 1BOGB 3S96B 4I3RH 1AQHA 3DRQA 2NUPA 4KH9A 4K55A 1DJGA 3MV7B 3TN0B 3VFVA 3M88A 3OLDA 4L3FA 3ZDWA 2Q3AA 4HIHA 4NM8L 4HH9B 3IEAA 3FU8A 4PJAB 4YHOL 1EZLA 3JZYA 1SVZA 4G8GE 1NDMA 2H2SD 3BZEA 3LEXA 1G9HA 1RPQA 3B37A 3ZT5A 4P8QA 1A47A 2HUHA 5T5FL 4HGKC 1E4HA 2Y6SC 1LHZA 3DGGA 4O4YH 1EO8H 3SKJH 3U0TB 1R3HB 2WCSA 5HHMB 5LQBH 1BA9A 4PWIA 4HWEH 2YAOA 2X9ZA 5BW7A 4EI0A 4Z5RA 2YAMA 3J07A 1TQBB 5H4YA 3VXRB 4JKPL 4JKNA 4GRMA 3UC2A 4KMQA 1S7XB 1W8OA 4MNGB 1HXMB 3BIBX 5ENWA 5CBEB 2BVQB 3N43F 5B3NA 2XFXB 2DQDL 1OK0A 2LFEA 4HSCX 1JSYA 1U8MB 4QHLB 2DMHA 2K4WA 2NY6C 1PKOA 2OMYA 2PO6D 2Y0SA 3D07A 2Z4TA 4JAMB 2DAVA 2BS9A 3E9UA 1GKOA 1K8DA 5DT1L 3S3PA 4P5TB 1H3XA 3K1DA 2XRAL 4MD5A 3OGCB 4S0SD 3GSXA 5KYXA 1NBVH 3CIAA 4LFHD 4ZMNA 3ULUD 4GQQA 4BA8A 2TSBA 4KC3B 1A3QA 4YDKL 3UFIA 2CMRH 5KVDH 2VXTH 4CU6A 1E6OL 3P9LA 1JV2A 4W6WB 2IGFH 3GJFK 3MRCA 5ILTL 4MQXC 3WU1A 2F18A 9CGTA 2ODIA 2AEQH 4OCLC 4ZW5A 4LSPL 2J5LB 3NQKA 5ACLA 4OM1L 4IU2A 2BVPB 2C7UA 5EU7E 4FXLA 4UT6H 3V52H 4NHUA 5E23A 3DHUA 4FG0A 4JN1H 2ATKB 2F74B 5EHFA 1AIFB 4H8VA 2MTPA 4GI9A 2VKWA 3WEXA 3ZHKA 1SJEB 1NCCH 4BWTA 2YXMA 3QP3A 3CQQA 1CDJA 4XMUA 5I9QB 1ZPLA 2G3XA 1NUFA 1BZ8A 1DCLA 3VGDA 2HB0A 5CIPA 5DI8B 4Z3FA 2OMTA 2NYYD 4DVBB 4S1SL 2DQHH 4QNPE 2APTA 4FN0A 3IGAB 3PWLA 2XETA 4FG4A 3KM2A 1KIUA 1U42A 2AJVH 4OW6A 1M6UA 1BWMA 2WO2B 3L3DA 4HJEA 5KANI 4HUXA 3LEYH 3R4DA 5IVXA 1JFHA 1CTNA 2DYPD 4WTQA 4PJ7A 3GGWB 4Q4EA 3SJVB 3SZ6A 3WEMA 1HYMA 1G0DA 5JZ7C 3LZNA 1NFAA 3MLSL 2TRYA 3BHBB 4FTDA 2DQ6A 5F1KC 5SWZE 3KPRB 3NJKA 3Q8BA 4TTDC 1OARH 2K7QA 3RBGA 4MCZB 4WWKD 1M57B 5C0DA 5F6IB 4HCRA 2ARWA 4C56D 4E9XA 5ES4B 3NAAL 4Z7VA 3JTTA 1ZLEA 3PHQB 5F1OB 1LE5A 2YHGA 3ASNB 5DZNA 4K4KA 5H94B 3X12B 2IC2A 3KPLA 3S6CA 1PTZA 5D2NA 2Z92B 4FNRA 4HMEA 1B0IA 3K2KA 1HILB 4OGYH 5IGXL 3TA4D 4GG8A 4K3HA 1GYVA 2WNKA 3V4LA 2ZSVA 3D08A 3GSNL 1RZQA 3CN2A 1O5PA 5LB1A 5AAPA 4D8OA 5F0LB 4XTRD 1QHOA 4NX0A 3T2OA 4QNPF 1X3DA 2R56H 4AW7A 4D0CA 1SY6L 1RUPL 3EYVA 3CQFA 1UZ6F 4TNWK 4LCIL 1H5BA 4ODSH 5DJCB 3QQ4A 2UY7A 4F1SA 4PJCA 4MJIE 2O6PA 4WGWB 5E4EC 2GFBB 2PUQT 4X6CE 1XGYL 2VB5A 4JM2F 2F58L 4IRJC 4YDJA 2XWRA 3UP6A 3UG4A 3QJFA 2CHZA 4KJPC 1YPZB 1QI5A 3DX9A 4P49A 1MJ8L 5AVZB 5ICZA 3OHXB 3H42H 3WIHA 4L8CB 1E5UI 3DX8B 1P1VA 2PP9A 2OI9C 2Y1VA 4A7GA 4CGTA 4BQ6A 4QO1B 3QQDB 4EQ3A 5TK4A 3H4FA 4Z7UA 3VG0H 5IB4A 2G2RB 3CIQA 1FNEA 1UACL 2OFQA 4GSDH 1RZJC 3D9AL 2FJHB 3Q9PA 2KZKA 3HNTH 1AHWA 3LN4B 4JDTH 2MPVA 5CINH 1GH7A 3ALWA 1EO5A 3ARUA 3OKLA 1DQKA 5DHDA 1WAAA 6FABL 1FZJB 2ZCLH 2E75C 4R2GD 5IIEA 5AW6B 32C2A 1VADA 3K80A 2O61A 1G7QA 5EO0B 1DLHB 3V4VA 5C7ZA 3BKMH 3QZWA 1FGNH 3S36X 3HKFA 4OD1H 3DBSA 4TLKA 4W9IC 2ROYA 2HFGH 3L7FB 2DZEA 2VR3A 4HD5A 3VD4A 4GAAA 4R97B 1SMAA 1EGLA 1U8LB 2NSMA 5ADOH 2XN9A 1ZT1A 3FQRA 2CSPA 4L5FE 4X6CF 1CF1A 5FUCC 4MB3A 5F89B 3RWHA 4U1KA 3VCLB 3ZKMD 4XOAA 1MRFH 1BYPA 4JFED 4JFFB 3G6AB 3B7TA 5GS1B 4AMWA 2X7LB 3CXHJ 4DP0X 1JDAA 2BOCA 2FATL 5D70L 5EU6A 2GG1A 2OPCA 5ALBH 3JBG7 4EJ1C 2PTTB 3H3KA 4HZLB 3T2PA 5AB1A 7TAAA 5C0GB 3DSFL 1TOXA 2KUTA 3E3QE 1TQTA 4ZMAT 4NC1C 1X9QA 4OIIL 1XIWA 3LRGA 1GPOH 1LO2H 2VR6A 3IFOA 1MJJA 2VDRL 1L9QA 5AL8A 5DUPL 4CUCA 3GSVA 3NSJA 4G71B 1TYRA 1U8KB 2BSRA 1FFPB 4PJXA 4Z7QB 3MRBB 4MXVE 2NSXA 3ESOA 4ZOAA 1QRNE 1E8WA 2DQIH 1R5VA 3L4VA 3VG9C 1HEHC 3TBVB 1VLXA 1T20B 4G70B 1TJGL 1HL5A 3O4OC 2NY2C 5HPOA 1DVUA 1ICTA 4G82A 3ZGHA 3Q3GB 4JRFA 2C3VB 2ZOKA 1Y1DA 4WLCA 3RWEA 2PR4H 1OW0C 3ZE2B 2AJSH 4QXUH 1FORH 3MCLL 3NSYA 4E41A 1IB5A 1MHEB 3HBPA 1JWMA 3R0MA 2FSEB 3MLYL 2VE6A 2HCZX 4UV4L 2GJ6D 1G7MA 3VDAA 3MV7E 4CDHA 2JXMA 2J20A 4XNXH 3UJTH 4PY7A 3EJUA 4K3EL 1YAZA 3PRZA 1UYWH 3IRCA 4WI9A 3T3PB 1E3ZA 4P4KA 2P5EE 3T1FB 4S0HA 1S7UB 3PP4H 3AG4B 1XB8A 4ZUUB 1TVBB 3BD3A 4R8WH 4FNPA 4UF7C 1RZJH 5GJTH 4AT6A 4U1GB 3QW9A 5L88H 1AGFB 1XF5A 3EJRA 1IZKA 4KZEH 4MXVF 2DOCA 1MAMH 5I8EA 4AH2B 3VXRE 1V3MA 3ZZ1A 3SKOA 2DEWX 4RMQA 1FZMB 1IVTA 5EEYA 4EF3A 2ITDA 2R7EB 4L8BB 1B4RA 2W1NA 3VXTA 2ADGA 2D7MA 4S2SA 2I27N 4NI6A 4WUUD 5BRZE 1AFVL 5D7SH 1E7VA 1X7QA 2H41A 1A0QH 3Q05A 4LSQH 3BGFB 1I1AD 2VMDA 3WV0A 4G5ZH 1R4XA 2FO4A 1AG0A 3O9WD 4ODWA 4OJDH 2CLRB 3L17A 4YC2B 5GGVL 5J11B 3IN2A 3E8UH 4YHZL 4EI5B 1E27B 3UIYA 5GGUA 5DZOA 2J88L 2BSED 2F53B 3FRPB 1TFHA 4Y4FD 2DF3A 4JRYD 2EDKA 3QZNA 4X9GA 4PJAF 4QRTA 1CG9B 4GXUN 4Z78B 4K7PL 1G5GA 1NEZG 1FV1B 1RUKH 5CGYD 3FSOA 3RTQB 1QASA 1HHKA 3WFEH 5KYNA 3GBML 4KKQA 2HUEA 2HFTA 3PGDA 3UYPB 4CSSA 1DBMH 4B53A 1EX0A 1K5WA 3DVNB 5IROC 2WZ6A 2QKIC 4S1QH 3FQ4A 3LZRA 1G7PB 3WEAA 4UTAA 5SWQB 4UDTB 1GTFA 5IZ7A 3P4LA 3B3IA 1KTJA 2DM4A 3MJ6A 4A1RA 3Q8EA 1EAJA 4N2NA 4YFLF 2FT7A 4CSTA 3PF2A 4X98A 5KSAB 2P8PB 1J8HD 2X40A 3KLSA 1JWUA 1NUDA 1ZV5A 4KK6D 3KS0J 4QKXB 2YMXL 3U4BL 1TINA 5IF0B 3ARYA 1JF5A 4ZDHB 2AHIA 1KBWA 3D87B 2BP0B 3X3FL 4WRLA 3Q9QA 3ESPA 1LE9B 1RULH 4POUB 1LDPL 3ZX1A 5CMAB 3L4XA 4KKPA 4F2EA 1W0WB 5GS2H 5JHDB 1TTRA 2ZWLT 1QQDA 4TN9A 3GSNB 1FDLH 2F54A 3I50H 3VXSA 2JKIS 2OSLA 2DJUA 5DWUH 4XNBA 5B39B 1K3IA 4AGLA 3SBWA 4N2GA 1B6UA 3EHBB 3GI9L 3O41A 4YXKL 3B7SA 5I1DB 3KPPB 2A9NL 1B6DA 4BGLA 3VDCA 1BHGA 3BYTA 4Q9CA 4AE1A 3ZL4L 5HHQB 1R75A 1OSPL 4OCWH 5KYYA 5FOBB 5J9PA 3GUTB 4H44C 4JZJB 3GEWB 4LIQH 4D9QD 4L37B 4P2AA 2BWDA 3C6SB 1UFGA 1ORSA 4JFZL 3ASOB 3EUUA 3QI9D 2XV6B 3U6RB 1CD1B 2PYED 3C6LA 4FLHA 1YEKL 3BZ5A 2VXUH 3ARFA 1JV5A 4ABQA 1AQKL 1WBYB 2QDWA 4QY8B 3BSZH 2XPZA 3OKKA 5BW7C 3G5XB 4R4ND 3TBYB 5DVPA 1GZHC 1A4KA 1AZZC 1ROCA 4YFEA 5FUZH 1YPZE 2IMNA 1YSOA 3CH1B 1NZRA 3MNZA 3PUUA 3P3RA 3VFSB 3THML 2DYSB 2E9JA 4JZOA 1ZANL 4WY7L 1QTYT 3OG6B 4NNYB 4QWWC 3MYZA 1MIEL 4GBXA 3G5ZA 1ODUA 5KG9B 1FGVL 3KCPA 4B60A 4MQSB 4LL1A 5J13C 4NQQA 1QZNA 2ALAA 3QIUA 1DVFC 3K72B 3NPZB 1T7XA 5SWSA 4BZ1H 1RJZB 4WF7A 2HT4D 3HN3A 3DHPA 5DR5H 5F9AC 1Q0EA 4YLCA 3QDJE 4RWHA 4WSGA 3UDWC 3M17B 1I8UA 1KFAL 1NLDH 1UUSA 3FN3A 3SQBB 4HS6A 4ODHH 4I8DA 2H4EA 3RPIB 3AFLA 3KNBB 5C8JB 2MGVA 3ARDD 3BJ91 1WWBX 4AYMC 5EF1A 1BZQK 4HCIA 4FLSA 2GCYA 4Q9BA 3BUYB 3ATAA 2AQRA 2V2WA 4NZDA 3U6XA 3IJSA 3NACL 3RHWK 1BCIA 3DV6B 3GIVB 1QFOA 4PWGA 2VDRB 4J4PA 4O2CB 1ZD6A 3M1BB 4IM8A 4O51A 4QAMB 5HD8C 3K0YA 5IMLB 5LGKA 2Q7AA 2YA0A 1C7SA 3GMLA 4BHUA 4NQEE 1M42A 3IMRA 1YPZF 1RFDH 5FYJE 5BXFB 1QPKA 2AKRA 1DDTA 5C3LD 1DL7H 3QUYA 2R1WA 5D7IE 5EULV 3U7AA 1R3LA 4KKCC 5K39B 2E9BA 1YUKB 3TPUB 2ZXDA 4TOYH 3LRSA 1CXIA 3CGTA 3KPTA 3IVKA 3MR9B 2C9UA 3D69B 4M8UA 4UV7L 1MWAA 3UBXB 5CILH 5ERWA 3WI9A 3VD7A 1ADQA 5IMMB 1MCDA 3U46A 4Z7QE 1ACXA 4NN5C 3FU7A 3SHSA 2JMRA 3MTRA 4JRWA 1CL7I 3C5SA 2FX8H 2CJ3A 4HF5H 4JHVA 3GNML 3DVGA 3F65A 4WFHE 2UXTA 4H88L 1TPXB 4RNRB 5HGHB 5KVMC 1GGUA 3C75A 3PNRB 4O9HH 1ZEAH 5AKSA 4ELMB 1G7HA 3DSNB 5AZEH 2XVBA 2WK2A 4XP6L 3QS2A 5FW8A 1LP9A 4AIOA 4HU2A 3T0EB 3FC8A 2DL9A 3IDIB 1YUHA 2XWDA 1CGYA 3MJ7A 3WFBH 1JI1A 5D2NC 1A1MB 1J5HA 3BE1H 3ZE2E 1GTNA 1WZLA 1EJFA 1SFHA 2ZUSA 2C9AA 4XN5A 1FL5A 1QFHA 2DWEB 1R3JB 1TQCB 2XWXA 3IKCA 1BFVH 3NN8A 2CBQA 4WTZA 2IANA 2M2DA 4NN6C 4H8WL 5D93B 5GSRA 1MUJA 4J6IA 3TZVD 2EDWA 3OPZL 4XHQA 5ISZB 3D1MC 1YQ2A 1AZBA 5EN2A 3TJHD 4QXVA 1V3KA 3T3PE 4F58L 5J7CC 2VABB 3ARBB 1VGKB 3QEQB 4TPRL 4J3WA 5IBTH 3ZYJA 3CH8A 4H0GA 2F7PA 4PB0H 3ZJAA 4ZXBC 2XV0A 1XR8A 4BFNA 4J3OC 3SSGA 2GT9A 3EOAB 3O2WH 4ZYKB 1BECA 4Z7QF 4BSWA 3C60D 2Y7NA 5GRJL 4YHIA 4XMVA 5F6HI 1S4IA 2CIIA 3S37X 4NUGL 1K2DA 3SDXA 1AOHA 1A6VL 4OCXL 3PAYA 3QDAA 4GP5B 4AUJA 1QP1A 3S4SB 3DDFA 3ARGA 4X4XA 2C4FU 4NUPA 4WNJA 4NFDA 4XCCH 4Y16D 3ZE2F 1OGAB 3QNXB 1HL4A 2Y5QA 1PJWA 4OGXH 4PRNA 3CFUA 3HC4L 3IJEA 3WS6A 3TJEL 5AOLA 1RIHH 1K4DA 2BVTA 4PBDA 2J1XA 4TULL 5I6PA 4HDIB 2WMPA 2FEEI 2AQ2A 4QHUA 3GLDA 2F53E 2ZAHA 2ZAIA 4TUJA 3CK0L 4B5ZA 3HKZA 1G9NC 1V3JA 5CZXD 3T3PF 5C0CA 4OZFA 4I0KA 1FI8C 4OIFA 4ADIA 4P9ML 4BFOA 4CMMA 1SEQH 1E3FA 2D9QB 3DJTA 3G08B 4Y7MA 3S48A 1J5OH 1UCTA 3E0GA 3GMQA 3WDHA 1I85C 1HEZA 4FQIL 5MHSD 5F0JB 1E5BA 3RIFF 5FFLA 2IFFL 1V7NL 4FZEL 2AJZB 3AROA 1NFDA 4QPEA 3GZKA 3TO2B 2HT3D 2OULB 1CE6B 5I6MA 3HMWH 5EMYA 4TNVF 3QDHA 3DC0A 3R18A 4IKJA 5I74C 5HYSB 1BXUA 3MOBL 4RCAA 1KCVH 4JGMA 3HRZA 4JEGB 1KLFA 1T89C 4JPWH 2ZG3A 1N5AA 2FR4A 1Q8MA 4FFTA 4JPQA 4PJFA 5DS8A 3OZ9H 4XXWA 1ACYL 2DN7A 4UDUA 5B3SB 4OFKA 1TJIL 1WD9A 3GXFA 5MI0C 1U93A 2EZ0C 4N2CA 3NZ8B 1CZ8L 3BPNC 2VAAB 2IXQB 1NIEA 2J8HA 2Q8BL 3PU7A 4GUPA 4APQA 1EZSA 4UT9L 1TU2B 2H6PA 4XMWA 5GGRB 5JHDE 1A6WH 4RGMB 2CK0L 4ZFOL 2L7JA 3LNDA 1AANA 2BNRE 4M7KL 3MGOB 3QG7H 4DW2H 3HZVA 4IKKA 2WKOA 3FSWA 4KRMB 3V4PB 3BDYH 2NNFA 1VGEL 1AQDA 5D6DA 1C08A 4MWFA 3FMGH 1UB5B 1FP5A 4FTVE 2EYRB 4XCNB 1ET5A 1QVOA 3P11L 4DPCX 2ZG1A 2WJ5A 1TF4A 4M4RA 4XMZA 5DMIH 5HVFB 3HAEA 1YNTB 3C9NA 4QRPD 3WNLA 3O4LD 2OMWA 4M8VA 5K33A 1KIPA 1U2YA 1TZHA 4P4KC 3I9GH 2WZPA 4YFLI 5IFAH 3A22A 3U7YL 5KSUB 2EXWC 2DIEA 4LO9A 3UYRL 4H1LA 2GBVA 3EAKA 1NBQA 1U95B 2Q0ZX 4RVBA 1TM5I 4MCYA 1NCDL 4YE4H 2VJXA 5DD6B 4PVNA 4PR5A 5KBKA 4JFUA 4MA1C 5DJYB 4A04A 4MMYA 1TENA 1LO3H 1ZE3C 5C09B 1RH8A 4Y2OA 3C5ZA 4I4WA 3SCMB 2FBOJ 4EUPA 1RZKC 4ZZKA 3WKYA 2OZ4H 1NC2D 1JTTA 3CDYA 4P46A 3WUZA 2X3AA 2YLHA 4N1HB 1R34A 4D9RD 1P69B 1QWHA 2KHAA 1I7RB 1G9NH 1E4XL 5FB8B 5J6GB 1MWOA 1ITCA 1MCHA 3BP7A 2DJMA 3CQPA 3ZY7A 2ERJB 1P7QA 5E6IB 4PP1C 1LL1A 3JT0A 5C08E 5TDPB 2G3ZA 4M8QB 1UCBL 2LE9A 4GSUA 3NMEA 1DBAL 4U6XB 5IR1A 1O9ZA 1T80A 2IO5A 2VM3A 3NIDB 3PP3H 4ZFFB 3NPSB 1SLVA 2KH2B 4PLKC 5CUSH 3A5VA 5JOPE 1ASQA 1NTDA 4X2UA 1ZAGA 3PJSB 1A4AA 1OB1B 5D96B 1BAGA 5C0BA 2DIJA 3RWDB 5H2BA 3DX0A 1QLEH 1NOLA 4GS7C 3V0VA 5I76B 4XAKD 1U8OA 2NTFA 4M93C 2ZX9A 5AYUL 3NT0A 4YHML 2YQ2A 2O6FA 3ILPB 1OSEA 4NNXB 3VU2A 4ANKA 4GQ9H 1CICC 5AOMA 3BT2L 1J12A 1DSFH 3QORA 3SOTA 1X5GA 3QWNA 4B9IA 2Y1AA 4XE5B 4ZTOL 4IHOB 1RSFA 1DQLH 3EADA 3FH5A 4HUCA 2NY6D 1EEYB 1XZ0A 1UXWB 4O5LH 1A6TB 3CVHL 3B1UA 4PRDA 2QGCA 5IJBC 3Q2NA 3PE9A 2BOBA 2VJ0A 1E5ZA 4B2BB 5IB1A 1IJ9A 2VZTA 1IUZA 1MW3A 4LXFA 4RBPK 5E94A 5I1CL 2VJ8A 4OVUA 2NY3D 2EYSB 3QS3A 1H15B 4H8PA 3KL3A 3FQWB 4NO2A 3AG2B 3C08H 4MQXD 3P4MB 2R2HB 2OX5B 4PTUA 1A22B 5L2KA 2AQTA 5AVQB 1I1FA 4PJGE 4EKJA 2QQKL 3RWJA 2MCPH 4Q56A 1NBYA 4NQDD 2QMKA 2F15A 2PCFB 3B56A 2V7HB 2FL5A 2NNXA 5LG1A 4DH2A 3TP4A 2ZKXA 4FYQA 4OD2A 4FFZA 5DU7A 3CMOH 4OCSL 4WV1B 5T33L 1DR9A 3MLZH 1SRDA 1ZE3H 4RA0C 1OSYA 4WWNA 1TTUA 4UB0H 1DBKH 2W0KA 1RZKH 1XGPA 2B8OT 4HPOL 4MZIA 5G2NA 1L6PA 3GKWL 1ZLSL 4LCWA 2UZIL 5JIMA 5ISZE 2IDCA 1DANU 1NBZA 4PS3A 3C6LC 2YEZB 2PLTA 2BVOA 1F3JB 4OV6F 4O58L 2D7QA 4G43A 4H20H 1CF8L 4OM0L 4R7NB 2JE8A 5TQ0H 1FPTH 3TV8A 1ZLVK 2WXPA 5SX4H 4UQ2A 3RJQB 5JZ7D 3SGEI 3HNSH 3H9HA 4TTDD 1SPDA 3UG3A 2YARA 5B7EA 4JL1A 3HLAB 2ATAA 4OCYL 2VLKD 1A7RL 3MLRH 4O00A 4HKZA 3QGVA 2ODHA 3POCA 1MCWM 1W72L 5FUOL 4G9DA 4GBXC 5DRWA 1N8OE 4MD4B 1IAKB 3VFGH 2AK4D 2BW4A 1D7BA 4ELMF 3QIUC 4IIQB 4WI4A 3FRUB 2EO9A 3QXUA 1RU9L 2JKLA 1QLRA 2Y4SA 3RNQA 2N0KA 4KZCA 4YSSA 3R1GL 4AOFA 1XFPA 5I1AA 2B0SL 1J86A 5DQJB 4OZ4B 2MJWA 4YDIL 4MDRA 5D5MA 4YL4A 1L6XA 2XWBA 4C83A 4KJWC 5LBSL 4JM4L 1NGQH 2DI7A 4LOEA 1T1WA 4OJFH 5IEKA 2RFXA 2BLFA 4EDWL 1MHCA 3ULUL 4ALAL 4H0HB 1NFIA 1INQA 1NCHA 1AD9A 2GTZB 4HC1A 4IRJD 3MREB 2R0LL 3QUXA 4KJPD 3WO4C 3PG2A 1IGTA 4J4PC 4XAWL 4YGVA 3RRQA 2EVJA 1CFSA 1JOIA 1NGZB 2X41A 4UZSA 4ZUSA 1ONQB 3BPOC 4X6BB 3X2QB 1YECL 3V5KA 3K2MC 4O2EA 5EU7C 3H56A 2IAAC 1N5YH 3AU0A 3QUYC 1U8HB 4J8RB 5IM7A 1ZSDB 4TUKH 4IU3B 3L5XH 4GSRA 1QUNA 2CUMA 1O9VA 2AAAA 4P5KB 5IB2B 1FVEA 4NQEA 2FIKA 4ZFOB 4OY9A 3IAPA 1SF5A 3DO3A 4FQQA 3S9DB 3R7QA 1FNFA 1G7LB 2HG5A 4JS7A 1QR1A 3VWKA 4GY4A 4WGKA 2NX5D 4B41A 1I8MA 2L04A 2CR0A 3DKHA 3B1TA 5L4FA 5JORA 5F96H 1FG2B 5C6WH 3O6FA 3NTCL 3TASA 4PLNC 4PJ8B 4NYLA 4X0KB 4XVTL 5E56A 1NANI 4PW4A 4LEOB 4JM2C 1DQVA 1SN5A 2DWSA 4MNQE 1DUYB 2P43B 2K3HA 2D31A 1HN1A 2E5EA 5AEAA 2XNAB 5EZOH 4NUMA 1I7UA 1TXKA 1WIPA 3CLEL 3MCG1 5EOQL 2WXIA 5ACZA 1ORQA 4M7LL 1KTLA 2ZJSH 3FO1B 3QRFM 5C97A 3TA3A 4G8EB 4G1EA 1T3FB 3D30A 4YLQT 2BW5A 2H3KA 2WC7A 5EF2A 4UILH 2FGWL 4UQEA 5JMOC 4HQQH 4JRXD 1XGUA 2CJUL 1TDQA 4YSEA 1Y33I 3V55A 1IM3D 2OCFD 5JPNB 3FT2A 5C07D 2IGTA 2YD5A 3FDWA 1P7BA 5E8OA 5ID1A 2NR6A 4ZO9A 3CZSA 3ZKQD 1OCCB 4K3DL 2A77L 1KC5H 3HS0B 4YHLH 3KYNA 2VC2L 1TT6A 5IW6A 2YPLD 1CYGA 3EO1A 3LH2L 5KJRL 3ILQC 3MXVL 1KT2B 1W8NA 5K9KB 2NY2D 2ADYA 5C09E 5AKTA 5JW4N 3WUWA 3GJFA 5JXAH 3TURA 2EDHA 5KVFL 2AJ3B 4XO4A 1MQKL 4IK6A 1MQ8A 1TEFA 2XZQL 2J4WL 1L9PA 4LLDB 2RALA 1EBAA 1GGIL 1OT4A 2VDMH 2Z93A 1DQML 3FQYA 3BLBA 3L1EA 5IB3A 3L3IA 1QA9B 1BZOA 3MKKA 4MCNA 2ADFL 3WYRA 4U1MA 1LWJA 3KGUA 1BLNB 3ARGC 4PRAA 3AQXA 4K23L 4G8FA 4LU5L 3VMPA 3LN5A 2PNDA 3TGXA 4QGTA 1Q1JH 2NCMA 4NQXA 5GS2D 3WS6C 3L4WA 4U0RB 3FULA 2CUHA 4N2AA 2QVTA 4PD4K 5DLLA 2ENJA 8FABB 1KB5L 1A7QH 2BNQD 3GTVA 4FYTA 4MAUL 4OGAD 4UQ9A 2EACA 4RFNB 2XN0A 1YNTF 2E27H 4ODVH 2DJ4A 1FHGA 4XP1L 2AJUH 2CO3A 4EN3A 4HGMA 1MLCB 4X0NA 4A55A 1EA9C 3CVHB 4JZNB 3EGXA 1MWAH 5I66B 1BFSA 4I89A 2UWEA 4OAWB 1JFQL 3HVDA 3GRGA 1WZ1L 1ADQH 3D39B 3GI8L 3KXFD 5F7AA 5FCUH 5IKCA 5IQ9A 2Z0BA 3WXVL 4GI8A 3S35L 4HLJA 1PYWA 5AUMA 3NJNA 1BD2D 3EGSA 4HH8A 2OAAA 4P5SA 2VITB 2ADIA 4PRIA 2AMUA 4FC3E 3CZJA 1KGCE 1TCRA 4LSSH 3EYQC 3GMPA 1JZGA 2A9ML 4KY1L 1KTKE 2R2EB 3FYEB 25C8H 3FTSA 1LWRA 1H9DA 5D7JB 3AMKA 4M1DH 4R3SA 5DK0A 5IK3A 2WXLA 2CPCA 2CJSA 4OF6A 1YN7A 2FT8A 3A6BL 3ZL2A 2A6IB 5DFAA 3LRHA 4DEWA 4ENZA 4TRPH 3IDJB 1FYHB 2Z8VC 3H7LA 4XXWC 1XMWA 2VDNL 2FB4L 2HWZH 3E3QC 1P7KA 4V11A 5EU4B 5TE4H 1TYEB 4WO0A 1L6ZA 5D1XA 4JY5H 3C8KB 4NWUH 3BQUD 4APQC 3UTZB 3EFDH 4RISH 2J56A 2WLLB 3H6JA 4U1HA 5I71B 1CN4A 1V7ML 3NIDF 5KVEE 4G6MH 4I77L 5F9JA 5T1LA 1GYCA 1U8PA 2ZPKH 1MJ7L 5EIIB 2BS8A 2I60L 1JK8B 2ESVA 2VT0A 4P06A 1D6EB 4S1RH 15C8L 4LPWA 2NW2A 4AM0B 2Z9TA 3LMJH 3N0PB 5D6DC 3ALPA 1XGTA 4ORGB 4UUJA 4M7ZC 4A2MA 2FBJL 5IROD 4J3VA 4M7JH 1Q9KB 2FK9A 2FWOA 3W3BA 3U9UB 1BAFL 4NZTH 4Y1SA 3ULVE 3FSVA 2BNRA 5E1QA 1X6LA 2G9HB 5BRQA 3O3BA 2Q6WA 4N85A 3B8SA 1SVBA 1U2HA 3QYCA 1RD6A 3W0WE 4PV8B 4ZD3L 3MNVB 2EP6A 3V5HB 2PYFB 3HUJE 4FTVA 1UWFA 5EPMA 5DZPA 1IC5H 3IMBA 1Y3FI 2VL4A 2ZT9C 4CC0A 5AD0A 1BVOA 5FKPB 3HPLA 2RHEA 1HWWA 3GB7A 2HPOA 3LV3A 4UNUA 1KGJA 1M7IA 3HJ0A 2HFEB 3ZPDA 2IPKB 2PO6B 4DSYA 1AP2A 2Y3NA 3UTTA 4XMKH 5T1JA 5E0ZA 3MRFB 1MN4A 4UTCA 3H85A 4JQVC 4P46C 4Q6IA 4FQLL 3LQZB 4U1IA 3KBHE 5E6UB 2HJLB 1R17A 3IGKA 2YD0A 2NNAA 1PZ2A 4OZFH 4HPHA 2ZCKH 1JJUA 4QHKI 4M1CC 4WFFD 5EZLA 3ZUCA 1I1YB 3OXSB 3LD8B 5C70A 3PWUA 1L9OA 3FCGA 1BQHG 3CC5A 5E1HB 5F7BA 3D51A 4L9LA 3O45B 3KYKL 3VE0A 1IGYB 4WTZG 4Y9EA 1SVCP 5BS0A 4IRZH 1QBML 1CGSL 3VGGA 1I9JL 1K4CB 1I8LC 1QSEA 4H13C 3BP6B 3P4NB 2PW2B 1I3GH 4L5FH 5AZ2L 3WELA 4F7PA 3N2JA 4K3GA 4ABUA 3KL0A 4N0UA 4X7TB 1EFXD 4NQCD 5D7LA 1BEYL 1SOKA 3QUKA 3L4UA 5CFAA 2H8PA 3TBTA 1FFNB 4L4TA 1CURA 2I26N 3BO8B 3JSSA 4P3DB 2Z31C 3M6DA 1UWGH 4QT5A 4GLRI 3ECUA 3LZPA 3F7LA 2ENPA 1YEGL 5LCVH 3CC1A 4LSTH 4Q7DA 4KNTA 3N1FC 5HHOA 1PLBA 4PGBB 1A7OH 1IEBA 2CE6A 4QWWD 3GPSA 2MPAL 4MD0B 2D7NA 4POZC 5CJ5A 3O11A 1DVFD 1JXJA 1WBXB 4PJHB 4AXWB 3HNVH 1GHFH 2D03H 4ZW3A 4YXLH 4L0ZA 4WWKB 4URKA 1UWXK 3WXWH 1PF3A 4FMVA 1RZ8A 3NK4A 1YEFH 2A83B 2CD0A 5GIRB 4C56B 3NABL 4YMPA 1W15A 1U8CB 1QSZA 2VXSL 2R83A 3KPOB 4JANA 1Y3BI 1DFXA 3O0RH 3CI2A 3NCBB 3UJJL 1JZIA 2NY1C 1OAQH 2DM7A 1YLBB 1ASPA 5AG8A 3ZTDC 1XF2B 4FQXC 4PCKA 3HAEH 3FCSB 2CWRA 4FMFA 5AAWA 3N44B 4LKXB 3U0PA 4ELKB 4FKKA 1U8IB 1U3HA 3BAEH 3MLTB 3HHRB 3P9WB 4FL4C 1PSKH 4MA3B 3MGTB 4OZFG 2WBJA 3I75B 4P4RB 4Y4KA 3BJLA 5HGBA 3G6JA 2HP4A 2WWMC 2QKSA 4MMXC 2R15A 1T5WA 5HD8D 1RP8A 4EMZA 1WZMA 3MUJA 1EMTH 1QKZL 1KBGL 3SN6N 4GRLC 1X5IA 3LKPB 1PLGL 4A39A 4BSJA 1G9EA 1Z32X 5FDWA 4G8IA 1N7MH 5L8JB 1IAOB 5D1ZI 2P8MA 3X1FA 1IFRA 4YIQB 1N3NA 1AZCA 2VC2B 1CDCA 3N5AA 3VWJA 4FQ2L 2O26U 2QGEA 1MNUH 4Z0XB 3OGOE 5CCKL 4P57B 3VRIA 4KKCD 1HKFA 4PRHD 3QDGE 2KC0A 1MLBB 2IQAA 2VSMB 3H9SD 4GXVL 2YC1A 1QO3B 4WNQB 5G4NA 1ZHNB 2Q76B 3GLAA 1QSFE 3GHBH 4DZBB 1IEAB 3CZFA 3RL1A 4EAEA 2P7TB 1CWVA 1N6UA 4QIRA 2WYHA 4XPAL 4IEFB 4AW4A 2FX7H 4M3HA 1HOEA 4NAQA 2XIIA 4O02H 5DEJA 2YZ8A