The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
38
|
sequence length |
144
|
structure length |
141
|
Chain Sequence |
SHMAGLEVLFASAAPAITRQDALVCFLHWEVVTHGYGLGVGDQPGPNDKKSELLPAGWNNNKDLYVLRYEYKDGRKLLVKAITVESSMILNVLEYGSQQVADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIITPI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of a Conserved Dimerization Domain within the F-Box Protein Fbxo7 and the Pi31 Proteasome Inhibitor.
pubmed doi rcsb |
| molecule tags |
Hydrolase inhibitor
|
| source organism |
Homo sapiens
|
| molecule keywords |
PROTEASOME INHIBITOR PI31 SUBUNIT
|
| total genus |
38
|
| structure length |
141
|
| sequence length |
144
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2008-05-12 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF11566 | PI31_Prot_N | PI31 proteasome regulator N-terminal |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Protein Transport Mog1p; Chain A | Protein Transport Mog1p; Chain A |
#chains in the Genus database with same CATH superfamily 4L9C A; 2VT8 A; 4OUH A; 4L9H A; #chains in the Genus database with same CATH topology 4RTH A; 3JCU P; 2LNJ A; 1TU1 A; 4BQ8 C; 1EQ6 A; 3NR5 A; 3V7B A; 4ESQ A; 4N7S B; 4L9C A; 4OUH A; 1JHS A; 3BCY A; 2VT8 A; 4RTI A; 3WA5 B; 4LUQ C; 1V2B A; 2XB3 A; 4UI2 D; 3LYD A; 4N80 B; 4N88 B; 1VR8 A; 4M5F B; 3HLZ A; 4L9H A; 2VU4 A; 4BQ6 D; #chains in the Genus database with same CATH homology 3NR5 A; 4N80 B; 4N88 B; 4ESQ A; 4M5F B; 4N7S B; 4L9C A; 4OUH A; 3WA5 B; 3BCY A; 2VT8 A; 4L9H A; 4LUQ C;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
