The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
37
|
sequence length |
160
|
structure length |
155
|
Chain Sequence |
SGLQAYVDSYDGYEFLYPRGWVQVQVEDPVDVVFHDIIETTENVSVVVNTVASTKSLEELGSPEEVGDRLLRNIIAPSESGRSSALIAATSQKADDKTYYILEYAVTLPAQQRHNLSSIAVSRGKVYTLSVSAPEERWPKVEDQFKTIVSSFTVY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The Structure of Cyanop at 2.8A: Implications for the Evolution and Function of the Psbp Subunit of Photosystem II.
pubmed doi rcsb |
| molecule tags |
Photosynthesis
|
| source organism |
Thermosynechococcus elongatus
|
| molecule keywords |
PSBP PROTEIN
|
| total genus |
37
|
| structure length |
155
|
| sequence length |
160
|
| ec nomenclature | |
| pdb deposition date | 2010-04-03 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01789 | PsbP | PsbP |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Protein Transport Mog1p; Chain A | Mog1/PsbP, alpha/beta/alpha sandwich |
#chains in the Genus database with same CATH superfamily 4RTH A; 2LNJ A; 1EQ6 A; 1TU1 A; 2VU4 A; 4UI2 D; 3V7B A; 4BQ6 D; 3JCU P; 1V2B A; 4RTI A; 1JHS A; 3LYD A; 2XB3 A; 4BQ8 C; 3HLZ A; #chains in the Genus database with same CATH topology 2LNJ A; 1TU1 A; 4N88 B; 4UI2 D; 3V7B A; 4BQ6 D; 4OUH A; 4L9C A; 1EQ6 A; 2VU4 A; 4ESQ A; 4RTI A; 3LYD A; 4N7S B; 4RTH A; 3NR5 A; 1V2B A; 4L9H A; 1JHS A; 2XB3 A; 4M5F B; 1VR8 A; 3WA5 B; 2VT8 A; 3JCU P; 4N80 B; 4LUQ C; 3BCY A; 4BQ8 C; 3HLZ A; #chains in the Genus database with same CATH homology 4RTH A; 2LNJ A; 1EQ6 A; 1TU1 A; 2VU4 A; 4UI2 D; 3V7B A; 4BQ6 D; 3JCU P; 1V2B A; 4RTI A; 1JHS A; 3LYD A; 2XB3 A; 4BQ8 C; 3HLZ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
