The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
41
|
sequence length |
166
|
structure length |
166
|
Chain Sequence |
LDETERVTLIVTLGHADTARIQAAPGTTAGQGTQYFWLSKDSYDFFPPLTIRNRRGTKATYSSLINMNYIDINYTDTQCRVTFEAENNFDFRLGTGKLRYTGVAKSNDIAAITRVGDSDYELRIIKQGTPEHSQLDPYAVSFIGNRGKRFGYISNEEFGRIIGVTF
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural Insight Into the Specificity of the B3 DNA-Binding Domains Provided by the Co-Crystal Structure of the C-Terminal Fragment of Bfii Restriction Enzyme
pubmed doi rcsb |
| molecule keywords |
RESTRICTION ENDONUCLEASE
|
| molecule tags |
Hydrolase/dna
|
| source organism |
Bacillus firmus
|
| total genus |
41
|
| structure length |
166
|
| sequence length |
166
|
| chains with identical sequence |
D
|
| ec nomenclature |
ec
3.1.21.4: Type II site-specific deoxyribonuclease. |
| pdb deposition date | 2013-01-03 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF18243 | BfiI_DBD | Metal-independent restriction enzyme BfiI DNA binding domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Beta Barrel | At1g16640 B3 domain | At1g16640 B3 domain |
#chains in the Genus database with same CATH superfamily 2C1L A; 3ZI5 A; #chains in the Genus database with same CATH topology 1N0G A; 4I1K A; 3ZI5 A; 1N0F A; 4LDW A; 4LDU A; 4LDV A; 2C1L A; 4LDX A; 1NA6 A; 1N0E A; 1YEL A; 3HQF A; 1WID A; 4LDY A; #chains in the Genus database with same CATH homology 1N0G A; 3ZI5 A; 1N0F A; 2C1L A; 1N0E A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...