The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
121
|
sequence length |
406
|
structure length |
381
|
Chain Sequence |
TFDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQAANPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILENKESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNPWLEWEIMLQYCFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICRELDAIRTRDYKKTSLAPYVKVFEHFLENLDKSRKG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structures of Human Primase Reveal Design of Nucleotide Elongation Site and Mode of Pol Alpha Tethering
pubmed doi rcsb |
| molecule keywords |
DNA PRIMASE SMALL SUBUNIT
|
| molecule tags |
Transferase
|
| source organism |
Homo sapiens
|
| total genus |
121
|
| structure length |
381
|
| sequence length |
406
|
| chains with identical sequence |
C
|
| ec nomenclature |
ec
2.7.7.-: |
| pdb deposition date | 2013-05-28 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01896 | DNA_primase_S | DNA primase small subunit |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Complex | DNA primase, PRIM domain | DNA primase, PRIM domain |
#chains in the Genus database with same CATH superfamily 1ZT2 A; 4BPU A; 4BPX A; 2FAO A; 4LIL A; 4MM2 A; 4LIM A; 5EXR A; 2FAQ A; 4BPW A; 4LIK A; 4MHQ A; 4RR2 A; 2FAR A; #chains in the Genus database with same CATH topology 1ZT2 A; 4BPU A; 4BPX A; 1V33 A; 2ATZ A; 2FAO A; 4LIL A; 4MM2 A; 4LIM A; 5EXR A; 1G71 A; 1V34 A; 2FAQ A; 4LIK A; 4BPW A; 4MHQ A; 4RR2 A; 2FAR A; #chains in the Genus database with same CATH homology 1ZT2 A; 4BPU A; 4BPX A; 1V33 A; 2FAO A; 4LIL A; 4MM2 A; 4LIM A; 5EXR A; 1G71 A; 1V34 A; 2FAQ A; 4LIK A; 4BPW A; 4MHQ A; 4RR2 A; 2FAR A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...