The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
40
|
sequence length |
150
|
structure length |
150
|
Chain Sequence |
HSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKWKLSGVYKLQYMHPLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKDLQKLSRLFKDQLVYPLLAFTRQALNLPDVF
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structure of the FP domain of Fbxo7 reveals a novel mode of protein-protein interaction.
pubmed doi rcsb |
molecule tags |
Protein binding
|
source organism |
Homo sapiens
|
molecule keywords |
F-box only protein 7
|
total genus |
40
|
structure length |
150
|
sequence length |
150
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2013-06-18 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF11566 | PI31_Prot_N | PI31 proteasome regulator N-terminal |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Protein Transport Mog1p; Chain A | Protein Transport Mog1p; Chain A |
#chains in the Genus database with same CATH superfamily 4L9C A; 2VT8 A; 4L9H A; 4OUH A; #chains in the Genus database with same CATH topology 4N88 B; 2LNJ A; 4N80 B; 4UI2 D; 3JCU P; 4BQ6 D; 2VT8 A; 1EQ6 A; 4L9H A; 4ESQ A; 3BCY A; 1JHS A; 3HLZ A; 4RTI A; 4OUH A; 4M5F B; 4BQ8 C; 1VR8 A; 3NR5 A; 3V7B A; 3LYD A; 1TU1 A; 4L9C A; 2VU4 A; 1V2B A; 4RTH A; 4LUQ C; 3WA5 B; 4N7S B; 2XB3 A; #chains in the Genus database with same CATH homology 2VT8 A; 4L9H A; 3NR5 A; 4N88 B; 4L9C A; 4ESQ A; 4LUQ C; 3BCY A; 3WA5 B; 4N7S B; 4N80 B; 4OUH A; 4M5F B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...