The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
51
|
sequence length |
153
|
structure length |
149
|
Chain Sequence |
SSPMAGLEVLFASAAPAITCRQDALVCFLHWEVVTHGYCGLGVGDQPGPNDKKSELLPAGWNNNKDLYVLRYEYKDGSRKLLVKAITVESSMILNVLEQVADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIITPIHEQWEKAN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The FP domains of PI31 and Fbxo7 have the same protein fold but very different modes of protein-protein interaction.
pubmed doi rcsb |
| molecule tags |
Protein binding
|
| source organism |
Homo sapiens
|
| molecule keywords |
Proteasome inhibitor PI31 subunit
|
| total genus |
51
|
| structure length |
149
|
| sequence length |
153
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature | |
| pdb deposition date | 2014-02-17 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF11566 | PI31_Prot_N | PI31 proteasome regulator N-terminal |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Protein Transport Mog1p; Chain A | Protein Transport Mog1p; Chain A |
#chains in the Genus database with same CATH superfamily 2VT8 A; 4OUH A; 4L9H A; 4L9C A; #chains in the Genus database with same CATH topology 3BCY A; 4N88 B; 4OUH A; 3LYD A; 3WA5 B; 3NR5 A; 2VT8 A; 4UI2 D; 4RTI A; 1EQ6 A; 3V7B A; 4L9C A; 4ESQ A; 4N80 B; 4N7S B; 4L9H A; 4BQ8 C; 3JCU P; 4BQ6 D; 4LUQ C; 1VR8 A; 1TU1 A; 2LNJ A; 4M5F B; 1JHS A; 2VU4 A; 1V2B A; 2XB3 A; 4RTH A; 3HLZ A; #chains in the Genus database with same CATH homology 3BCY A; 4L9C A; 4N7S B; 4N88 B; 4ESQ A; 4OUH A; 4L9H A; 4M5F B; 3WA5 B; 3NR5 A; 2VT8 A; 4N80 B; 4LUQ C;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
