4D3KA

Structure of bacillus subtilis nitric oxide synthase in complex with 6,6'-((5-(3-aminopropyl)-1,3-phenylene)bis(ethane-2,1-diyl))bis(4- methylpyridin-2-amine)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
362
structure length
362
Chain Sequence
EEKEILWNEAKAFIAACYQELGKAAEVKDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPPEEKGEKQVEIWNHQLIRYAGYESDGERIGDPASCSLTAACEELGWRGERTDFDLLPLIFRMKGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQAEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDKPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NITRIC OXIDE SYNTHASE OXYGENASE
publication title Structure-Based Design of Bacterial Nitric Oxide Synthase Inhibitors.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 122
structure length 362
sequence length 362
chains with identical sequence B
ec nomenclature ec 1.14.14.47: Nitric-oxide synthase (flavodoxin).
pdb deposition date 2014-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02898 NO_synthase Nitric oxide synthase, oxygenase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.340.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase; Chain A, domain 1 Nitric Oxide Synthase; Chain A, domain 1 4d3kA01
3.90.440.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase;Heme Domain; Chain A, domain 2 Nitric Oxide Synthase;Heme Domain;Chain A domain 2 4d3kA02
3.90.1230.10 Alpha Beta Alpha-Beta Complex Bovine Endothelial Nitric Oxide Synthase Heme Domain; Chain: A,domain 3 Nitric Oxide Synthase; Chain A, domain 3 4d3kA03
4UG6A 4NSEA 5FJ2A 4IMXA 4UGKA 1M8DA 4IMSA 3N2RA 4CTYA 1D1VA 3DWJA 4KCLA 5G66A 1FOPA 1FOIA 5G0NA 4CUMA 1VAFA 1QW6A 1P6HA 5G6CA 4UPQA 3TYMA 1QW4A 3JX6A 3N66A 5AD5A 3E7MA 2AMOA 4UGPA 3N69A 4K5KA 5G6PA 3N5RA 4UH9A 2G6IA 1P6KA 3E67A 1JWKA 1QWCA 3N64A 4UPOA 1DWXA 3PNGA 3N5PA 2HX3A 2G6NA 3E68A 3NLYA 5FVZA 4CTZA 5G6QA 5G69A 5ADNA 4IMWA 4LWBA 4V3ZA 4CVGA 1NOCA 4CWWA 3JWYA 4UHAA 1M8HA 1ZVLA 3RQPA 1M9QA 3E7IA 4LUWA 4CWXA 3EJ8A 4KCIA 4CDTA 5ADDA 4CTRA 4K5JA 4D3VA 4UGLA 3NLRA 5G0OA 1DM6A 4D3TA 4D37A 3EAHA 5AD7A 3FC5A 3N6AA 1M9MA 4FVWA 3NLVA 2NOSA 3N5QA 4V3UA 4D2ZA 3JT4A 2FBZX 8NSEA 3N5SA 4D7HA 3JWZA 3JT8A 1ZVIA 1QW5A 4UGJA 4UPMA 1DM7A 2ORPA 4CX1A 4UGUA 2HX4A 4UGSA 4CAPA 3EAIA 3HSOA 4UH8A 3NLGA 1N2NA 3Q99A 5AGNA 4D30A 1DMKA 3UFTA 1RS7A 3TYLA 3JWWA 3E7SA 1DF1A 3JX1A 4UGBA 3JWSA 3UFPA 3JX4A 4KCJA 4UG8A 1DMIA 5G6OA 3N60A 4KCRA 4UH2A 5FVWA 5ADBA 4CTTA 5NSEA 4UG7A 3SVPA 3N5ZA 3E7GA 4UGZA 4UGNA 4UH4A 3N6EA 3B3MA 3N5TA 5G65A 1QOMA 4D36A 5FVPA 4D3NA 3NLEA 4JSJA 2AN2A 1DM8A 5G6LA 1M8IA 5FVXA 4D7OA 5ADEA 5G6AA 4UH1A 1MMWA 4CTVA 5G6IA 4CWVA 3NLOA 1MMVA 4UQRA 3RQJA 4FW0A 4V3VA 1OM5A 4C39A 4UGXA 4K5GA 3N6DA 4UGMA 4KCHA 4UPPA 3NM0A 4D3OA 4KCOA 1M9TA 1DWWA 5ADCA 3JT3A 4K5HA 4V3YA 4D31A 4EUXA 3NLJA 2NSIA 4C3AA 1D1WA 4V3WA 1Q2OA 4UCHA 4UPTA 1M00A 3RQMA 3UFSA 3EBFA 4D1OA 2AN0A 4CX7A 1K2SA 3N5VA 3N65A 5AGMA 2G6MA 4D3IA 3N6GA 4UGIA 3TYOA 3E65A 4UG5A 5ADKA 3JT5A 3N67A 3N6FA 3E7SB 4KCKA 5AGLA 3UFVA 1FOOA 4CUNA 3JTAA 4KCQA 1P6MA 3JWVA 5FVTA 4CAOA 3JWTA 7NSEA 5AGOA 1ED6A 3NLKA 1D0CA 2ORRA 4UGGA 3NODA 3NNZA 4CWZA 3NLIA 1K2UA 3JT6A 4D7JA 4D35A 4LUXA 1ED4A 2G6KA 4D3BA 4CU1A 4CU0A 5G6GA 4UGOA 3NLFA 3UFWA 4D32A 5AD4A 5ADIA 4IMTA 3UFRA 3NLZA 3N6CA 4CX3A 3NLTA 3E6OA 5ADJA 1M7ZA 4UH0A 4UGYA 4D7IA 4KCPA 3NNYA 5G6FA 4D3KA 4CX5A 4D3MA 4UGVA 4CFTA 4D1NA 4JSGA 1ED5A 3EBDA 1NSEA 4JSEA 3N68A 3N63A 3N5YA 4CTWA 5G6JA 4CTQA 3NLWA 5FVYA 4UGFA 3NQSA 2NODA 1DMJA 4D39A 1M8EA 2FC1A 4UPNA 1ZZRA 4K5IA 4JSKA 5FVOA 4CAMA 3JWXA 3PNFA 1VAGA 1FOLA 3NW2A 4CX6A 4D1PA 5ADFA 1P6JA 4JS9A 2BHJA 4FVYA 5ADLA 4JSMA 3DQSA 2G6LA 5FW0A 2ORQA 4CAQA 4UPRA 1I83A 4D33A 3N6BA 1K2TA 3RQKA 5G68A 2G6HA 4JSFA 4CU1B 1RS9A 5G67A 1DWVA 4JSIA 4UGHA 4CWYA 2G6JA 4LWAA 3NLHA 1D1YA 4D3AA 5AGPA 1LZZA 5G6KA 1M9RA 5G0PA 5AD6A 1ZZSA 4KCNA 3UFOA 4UGWA 3E6LA 5FVUA 4UPSA 3RQOA 3TYNA 1M7VA 4UG9A 5G6MA 3DQRA 4UGTA 5G6EA 4CARA 1R35A 3NOSA 4UH5A 5G6HA 3JX2A 3B3OA 3Q9AA 4UH7A 4UH3A 2ORSA 5ADAA 4K5EA 4D38A 3NLXA 1ZZQA 4CFTB 3JX0A 3UFQA 3PNEA 4UGAA 4UGDA 1D1XA 2Y37A 4D3UA 1P6NA 3NLNA 4UGRA 3JT7A 2FC2A 4UH6A 4CULA 3RQLA 5FJ3A 1P6IA 5ADGA 5ADMA 4CTXA 3HSPA 5G6BA 1M9JA 3NLDA 2HX2A 1D0OA 3E7TA 4D2YA 1K2RA 1M9KA 1ZZTA 5G6DA 1RS6A 5FVSA 4FVZA 3E6TA 3B3PA 1RS8A 4GQEA 3NLUA 5AD8A 4KCSA 4K5FA 4UQSA 3JX3A 4D34A 4JSLA 3UFUA 1JWJA 5FVVA 2NSEA 3N62A 4KCMA 5FVRA 3E6NA 5AGKA 4UGQA 4UGCA 2FLQA 3SVQA 6NSEA 2OROA 3N5XA 4CX4A 1P6LA 3PNHA 3JT9A 3N5WA 3N61A 3DQTA 4CX2A 5AD9A 1MJTA 3NSEA 4CX0A 3NLQA 1ZZUA 2ORTA 1NSIA 3HSNA 4UGEA 5FVQA 3NLMA 4V3XA 3RQNA 1DD7A 1NODA 4D3JA 4CANA 3B3NA 4K5DA 5G6NA 2G6OA 3NLPA 3JWUA 4FVXA 4CTPA 4CTUA 3JX5A 1NOSA 1LZXA 4IMUA 4JSHA 1OM4A 9NSEA 4NOSA 1FOJA
chains in the Genus database with same CATH superfamily
4UG6A 4NSEA 5FJ2A 4IMXA 4UGKA 1M8DA 4IMSA 3N2RA 4CTYA 1D1VA 3DWJA 4KCLA 5G66A 1FOPA 1FOIA 5G0NA 4CUMA 1VAFA 1QW6A 1P6HA 5G6CA 4UPQA 3TYMA 1QW4A 3JX6A 3N66A 5AD5A 3E7MA 2AMOA 4UGPA 3N69A 4K5KA 5G6PA 3N5RA 4UH9A 2G6IA 1P6KA 3E67A 1JWKA 1QWCA 3N64A 4UPOA 1DWXA 3PNGA 3N5PA 2HX3A 2G6NA 3E68A 3NLYA 5FVZA 4CTZA 5G6QA 5G69A 5ADNA 4IMWA 4LWBA 4V3ZA 4CVGA 1NOCA 4CWWA 3JWYA 4UHAA 1M8HA 1ZVLA 3RQPA 1M9QA 3E7IA 4LUWA 4CWXA 3EJ8A 4KCIA 4CDTA 5ADDA 4CTRA 4K5JA 4D3VA 4UGLA 3NLRA 5G0OA 1DM6A 4D3TA 4D37A 3EAHA 5AD7A 3FC5A 3N6AA 1M9MA 4FVWA 3NLVA 2NOSA 3N5QA 4V3UA 4D2ZA 3JT4A 2FBZX 8NSEA 3N5SA 4D7HA 3JWZA 3JT8A 1ZVIA 1QW5A 4UGJA 4UPMA 1DM7A 2ORPA 4CX1A 4UGUA 2HX4A 4UGSA 4CAPA 3EAIA 3HSOA 4UH8A 3NLGA 1N2NA 3Q99A 5AGNA 4D30A 1DMKA 3UFTA 1RS7A 3TYLA 3JWWA 3E7SA 1DF1A 3JX1A 4UGBA 3JWSA 3UFPA 3JX4A 4KCJA 4UG8A 1DMIA 5G6OA 3N60A 4KCRA 4UH2A 5FVWA 5ADBA 4CTTA 5NSEA 4UG7A 3SVPA 3N5ZA 3E7GA 4UGZA 4UGNA 4UH4A 3N6EA 3B3MA 3N5TA 5G65A 1QOMA 4D36A 5FVPA 4D3NA 3NLEA 4JSJA 2AN2A 1DM8A 5G6LA 1M8IA 5FVXA 4D7OA 5ADEA 5G6AA 4UH1A 1MMWA 4CTVA 5G6IA 4CWVA 3NLOA 1MMVA 4UQRA 3RQJA 4FW0A 4V3VA 1OM5A 4C39A 4UGXA 4K5GA 3N6DA 4UGMA 4KCHA 4UPPA 3NM0A 4D3OA 4KCOA 1M9TA 1DWWA 5ADCA 3JT3A 4K5HA 4V3YA 4D31A 4EUXA 3NLJA 2NSIA 4C3AA 1D1WA 4V3WA 1Q2OA 4UCHA 4UPTA 1M00A 3RQMA 3UFSA 3EBFA 4D1OA 2AN0A 4CX7A 1K2SA 3N5VA 3N65A 5AGMA 2G6MA 4D3IA 3N6GA 4UGIA 3TYOA 3E65A 4UG5A 5ADKA 3JT5A 3N67A 3N6FA 3E7SB 4KCKA 5AGLA 3UFVA 1FOOA 4CUNA 3JTAA 4KCQA 1P6MA 3JWVA 5FVTA 4CAOA 3JWTA 7NSEA 5AGOA 1ED6A 3NLKA 1D0CA 2ORRA 4UGGA 3NODA 3NNZA 4CWZA 3NLIA 1K2UA 3JT6A 4D7JA 4D35A 4LUXA 1ED4A 2G6KA 4D3BA 4CU1A 4CU0A 5G6GA 4UGOA 3NLFA 3UFWA 4D32A 5AD4A 5ADIA 4IMTA 3UFRA 3NLZA 3N6CA 4CX3A 3NLTA 3E6OA 5ADJA 1M7ZA 4UH0A 4UGYA 4D7IA 4KCPA 3NNYA 5G6FA 4D3KA 4CX5A 4D3MA 4UGVA 4CFTA 4D1NA 4JSGA 1ED5A 3EBDA 1NSEA 4JSEA 3N68A 3N63A 3N5YA 4CTWA 5G6JA 4CTQA 3NLWA 5FVYA 4UGFA 3NQSA 2NODA 1DMJA 4D39A 1M8EA 2FC1A 4UPNA 1ZZRA 4K5IA 4JSKA 5FVOA 4CAMA 3JWXA 3PNFA 1VAGA 1FOLA 3NW2A 4CX6A 4D1PA 5ADFA 1P6JA 4JS9A 2BHJA 4FVYA 5ADLA 4JSMA 3DQSA 2G6LA 5FW0A 2ORQA 4CAQA 4UPRA 1I83A 4D33A 3N6BA 1K2TA 3RQKA 5G68A 2G6HA 4JSFA 4CU1B 1RS9A 5G67A 1DWVA 4JSIA 4UGHA 4CWYA 2G6JA 4LWAA 3NLHA 1D1YA 4D3AA 5AGPA 1LZZA 5G6KA 1M9RA 5G0PA 5AD6A 1ZZSA 4KCNA 3UFOA 4UGWA 3E6LA 5FVUA 4UPSA 3RQOA 3TYNA 1M7VA 4UG9A 5G6MA 3DQRA 4UGTA 5G6EA 4CARA 1R35A 3NOSA 4UH5A 5G6HA 3JX2A 3B3OA 3Q9AA 4UH7A 4UH3A 2ORSA 5ADAA 4K5EA 4D38A 3NLXA 1ZZQA 4CFTB 3JX0A 3UFQA 3PNEA 4UGAA 4UGDA 1D1XA 2Y37A 4D3UA 1P6NA 3NLNA 4UGRA 3JT7A 2FC2A 4UH6A 4CULA 3RQLA 5FJ3A 1P6IA 5ADGA 5ADMA 4CTXA 3HSPA 5G6BA 1M9JA 3NLDA 2HX2A 1D0OA 3E7TA 4D2YA 1K2RA 1M9KA 1ZZTA 5G6DA 1RS6A 5FVSA 4FVZA 3E6TA 3B3PA 1RS8A 4GQEA 3NLUA 5AD8A 4KCSA 4K5FA 4UQSA 3JX3A 4D34A 4JSLA 3UFUA 1JWJA 5FVVA 2NSEA 3N62A 4KCMA 5FVRA 3E6NA 5AGKA 4UGQA 4UGCA 2FLQA 3SVQA 6NSEA 2OROA 3N5XA 4CX4A 1P6LA 3PNHA 3JT9A 3N5WA 3N61A 3DQTA 4CX2A 5AD9A 1MJTA 3NSEA 4CX0A 3NLQA 1ZZUA 2ORTA 1NSIA 3HSNA 4UGEA 5FVQA 3NLMA 4V3XA 3RQNA 1DD7A 1NODA 4D3JA 4CANA 3B3NA 4K5DA 5G6NA 2G6OA 3NLPA 3JWUA 4FVXA 4CTPA 4CTUA 3JX5A 1NOSA 1LZXA 4IMUA 4JSHA 1OM4A 9NSEA 4NOSA 1FOJA
chains in the Genus database with same CATH topology
4UG6A 4NSEA 5FJ2A 4IMXA 4UGKA 1M8DA 4IMSA 3N2RA 4CTYA 1D1VA 3DWJA 4KCLA 5G66A 1FOPA 1FOIA 5G0NA 4CUMA 1VAFA 1QW6A 1P6HA 5G6CA 4UPQA 3TYMA 1QW4A 3JX6A 3N66A 5AD5A 3E7MA 2AMOA 4UGPA 3N69A 4K5KA 5G6PA 3N5RA 4UH9A 2G6IA 1P6KA 3E67A 1JWKA 1QWCA 3N64A 4UPOA 1DWXA 3PNGA 3N5PA 2HX3A 2G6NA 3E68A 3NLYA 5FVZA 4CTZA 5G6QA 5G69A 5ADNA 4IMWA 4LWBA 4V3ZA 4CVGA 1NOCA 4CWWA 3JWYA 4UHAA 1M8HA 1ZVLA 3RQPA 1M9QA 3E7IA 4LUWA 4CWXA 3EJ8A 4KCIA 4CDTA 5ADDA 4CTRA 4K5JA 4D3VA 4UGLA 3NLRA 5G0OA 1DM6A 4D3TA 4D37A 3EAHA 5AD7A 3FC5A 3N6AA 1M9MA 4FVWA 3NLVA 2NOSA 3N5QA 4V3UA 4D2ZA 3JT4A 2FBZX 8NSEA 3N5SA 4D7HA 3JWZA 3JT8A 1ZVIA 1QW5A 4UGJA 4UPMA 1DM7A 2ORPA 4CX1A 4UGUA 2HX4A 4UGSA 4CAPA 3EAIA 3HSOA 4UH8A 3NLGA 1N2NA 3Q99A 5AGNA 4D30A 1DMKA 3UFTA 1RS7A 3TYLA 3JWWA 3E7SA 1DF1A 3JX1A 4UGBA 3JWSA 3UFPA 3JX4A 4KCJA 4UG8A 1DMIA 5G6OA 3N60A 4KCRA 4UH2A 5FVWA 5ADBA 4CTTA 5NSEA 4UG7A 3SVPA 3N5ZA 3E7GA 4UGZA 4UGNA 4UH4A 3N6EA 3B3MA 3N5TA 5G65A 1QOMA 4D36A 5FVPA 4D3NA 3NLEA 4JSJA 2AN2A 1DM8A 5G6LA 1M8IA 5FVXA 4D7OA 5ADEA 5G6AA 4UH1A 1MMWA 4CTVA 5G6IA 4CWVA 3NLOA 1MMVA 4UQRA 3RQJA 4FW0A 4V3VA 1OM5A 4C39A 4UGXA 4K5GA 3N6DA 4UGMA 4KCHA 4UPPA 3NM0A 4D3OA 4KCOA 1M9TA 1DWWA 5ADCA 3JT3A 4K5HA 4V3YA 4D31A 4EUXA 3NLJA 2NSIA 4C3AA 1D1WA 4V3WA 1Q2OA 4UCHA 4UPTA 1M00A 3RQMA 3UFSA 3EBFA 4D1OA 2AN0A 4CX7A 1K2SA 3N5VA 3N65A 5AGMA 2G6MA 4D3IA 3N6GA 4UGIA 3TYOA 3E65A 4UG5A 5ADKA 3JT5A 3N67A 3N6FA 3E7SB 4KCKA 5AGLA 3UFVA 1FOOA 4CUNA 3JTAA 4KCQA 1P6MA 3JWVA 5FVTA 4CAOA 3JWTA 7NSEA 5AGOA 1ED6A 3NLKA 1D0CA 2ORRA 4UGGA 3NODA 3NNZA 4CWZA 3NLIA 1K2UA 3JT6A 4D7JA 4D35A 4LUXA 1ED4A 2G6KA 4D3BA 4CU1A 4CU0A 5G6GA 4UGOA 3NLFA 3UFWA 4D32A 5AD4A 5ADIA 4IMTA 3UFRA 3NLZA 3N6CA 4CX3A 3NLTA 3E6OA 5ADJA 1M7ZA 4UH0A 4UGYA 4D7IA 4KCPA 3NNYA 5G6FA 4D3KA 4CX5A 4D3MA 4UGVA 4CFTA 4D1NA 4JSGA 1ED5A 3EBDA 1NSEA 4JSEA 3N68A 3N63A 3N5YA 4CTWA 5G6JA 4CTQA 3NLWA 5FVYA 4UGFA 3NQSA 2NODA 1DMJA 4D39A 1M8EA 2FC1A 4UPNA 1ZZRA 4K5IA 4JSKA 5FVOA 4CAMA 3JWXA 3PNFA 1VAGA 1FOLA 3NW2A 4CX6A 4D1PA 5ADFA 1P6JA 4JS9A 2BHJA 4FVYA 5ADLA 4JSMA 3DQSA 2G6LA 5FW0A 2ORQA 4CAQA 4UPRA 1I83A 4D33A 3N6BA 1K2TA 3RQKA 5G68A 2G6HA 4JSFA 4CU1B 1RS9A 5G67A 1DWVA 4JSIA 4UGHA 4CWYA 2G6JA 4LWAA 3NLHA 1D1YA 4D3AA 5AGPA 1LZZA 5G6KA 1M9RA 5G0PA 5AD6A 1ZZSA 4KCNA 3UFOA 4UGWA 3E6LA 5FVUA 4UPSA 3RQOA 3TYNA 1M7VA 4UG9A 5G6MA 3DQRA 4UGTA 5G6EA 4CARA 1R35A 3NOSA 4UH5A 5G6HA 3JX2A 3B3OA 3Q9AA 4UH7A 4UH3A 2ORSA 5ADAA 4K5EA 4D38A 3NLXA 1ZZQA 4CFTB 3JX0A 3UFQA 3PNEA 4UGAA 4UGDA 1D1XA 2Y37A 4D3UA 1P6NA 3NLNA 4UGRA 3JT7A 2FC2A 4UH6A 4CULA 3RQLA 5FJ3A 1P6IA 5ADGA 5ADMA 4CTXA 3HSPA 5G6BA 1M9JA 3NLDA 2HX2A 1D0OA 3E7TA 4D2YA 1K2RA 1M9KA 1ZZTA 5G6DA 1RS6A 5FVSA 4FVZA 3E6TA 3B3PA 1RS8A 4GQEA 3NLUA 5AD8A 4KCSA 4K5FA 4UQSA 3JX3A 4D34A 4JSLA 3UFUA 1JWJA 5FVVA 2NSEA 3N62A 4KCMA 5FVRA 3E6NA 5AGKA 4UGQA 4UGCA 2FLQA 3SVQA 6NSEA 2OROA 3N5XA 4CX4A 1P6LA 3PNHA 3JT9A 3N5WA 3N61A 3DQTA 4CX2A 5AD9A 1MJTA 3NSEA 4CX0A 3NLQA 1ZZUA 2ORTA 1NSIA 3HSNA 4UGEA 5FVQA 3NLMA 4V3XA 3RQNA 1DD7A 1NODA 4D3JA 4CANA 3B3NA 4K5DA 5G6NA 2G6OA 3NLPA 3JWUA 4FVXA 4CTPA 4CTUA 3JX5A 1NOSA 1LZXA 4IMUA 4JSHA 1OM4A 9NSEA 4NOSA 1FOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UG6 A;  4NSE A;  5FJ2 A;  4IMX A;  4UGK A;  1M8D A;  4IMS A;  3N2R A;  4CTY A;  1D1V A;  3DWJ A;  4KCL A;  5G66 A;  1FOP A;  1FOI A;  5G0N A;  4CUM A;  1VAF A;  1QW6 A;  1P6H A;  5G6C A;  4UPQ A;  3TYM A;  1QW4 A;  3JX6 A;  3N66 A;  5AD5 A;  3E7M A;  2AMO A;  4UGP A;  3N69 A;  4K5K A;  5G6P A;  3N5R A;  4UH9 A;  2G6I A;  1P6K A;  3E67 A;  1JWK A;  1QWC A;  3N64 A;  4UPO A;  1DWX A;  3PNG A;  3N5P A;  2HX3 A;  2G6N A;  3E68 A;  3NLY A;  5FVZ A;  4CTZ A;  5G6Q A;  5G69 A;  5ADN A;  4IMW A;  4LWB A;  4V3Z A;  4CVG A;  1NOC A;  4CWW A;  3JWY A;  4UHA A;  1M8H A;  1ZVL A;  3RQP A;  1M9Q A;  3E7I A;  4LUW A;  4CWX A;  3EJ8 A;  4KCI A;  4CDT A;  5ADD A;  4CTR A;  4K5J A;  4D3V A;  4UGL A;  3NLR A;  5G0O A;  1DM6 A;  4D3T A;  4D37 A;  3EAH A;  5AD7 A;  3FC5 A;  3N6A A;  1M9M A;  4FVW A;  3NLV A;  2NOS A;  3N5Q A;  4V3U A;  4D2Z A;  3JT4 A;  2FBZ X;  8NSE A;  3N5S A;  4D7H A;  3JWZ A;  3JT8 A;  1ZVI A;  1QW5 A;  4UGJ A;  4UPM A;  1DM7 A;  2ORP A;  4CX1 A;  4UGU A;  2HX4 A;  4UGS A;  4CAP A;  3EAI A;  3HSO A;  4UH8 A;  3NLG A;  1N2N A;  3Q99 A;  5AGN A;  4D30 A;  1DMK A;  3UFT A;  1RS7 A;  3TYL A;  3JWW A;  3E7S A;  1DF1 A;  3JX1 A;  4UGB A;  3JWS A;  3UFP A;  3JX4 A;  4KCJ A;  4UG8 A;  1DMI A;  5G6O A;  3N60 A;  4KCR A;  4UH2 A;  5FVW A;  5ADB A;  4CTT A;  5NSE A;  4UG7 A;  3SVP A;  3N5Z A;  3E7G A;  4UGZ A;  4UGN A;  4UH4 A;  3N6E A;  3B3M A;  3N5T A;  5G65 A;  1QOM A;  4D36 A;  5FVP A;  4D3N A;  3NLE A;  4JSJ A;  2AN2 A;  1DM8 A;  5G6L A;  1M8I A;  5FVX A;  4D7O A;  5ADE A;  5G6A A;  4UH1 A;  1MMW A;  4CTV A;  5G6I A;  4CWV A;  3NLO A;  1MMV A;  4UQR A;  3RQJ A;  4FW0 A;  4V3V A;  1OM5 A;  4C39 A;  4UGX A;  4K5G A;  3N6D A;  4UGM A;  4KCH A;  4UPP A;  3NM0 A;  4D3O A;  4KCO A;  1M9T A;  1DWW A;  5ADC A;  3JT3 A;  4K5H A;  4V3Y A;  4D31 A;  4EUX A;  3NLJ A;  2NSI A;  4C3A A;  1D1W A;  4V3W A;  1Q2O A;  4UCH A;  4UPT A;  1M00 A;  3RQM A;  3UFS A;  3EBF A;  4D1O A;  2AN0 A;  4CX7 A;  1K2S A;  3N5V A;  3N65 A;  5AGM A;  2G6M A;  4D3I A;  3N6G A;  4UGI A;  3TYO A;  3E65 A;  4UG5 A;  5ADK A;  3JT5 A;  3N67 A;  3N6F A;  3E7S B;  4KCK A;  5AGL A;  3UFV A;  1FOO A;  4CUN A;  3JTA A;  4KCQ A;  1P6M A;  3JWV A;  5FVT A;  4CAO A;  3JWT A;  7NSE A;  5AGO A;  1ED6 A;  3NLK A;  1D0C A;  2ORR A;  4UGG A;  3NOD A;  3NNZ A;  4CWZ A;  3NLI A;  1K2U A;  3JT6 A;  4D7J A;  4D35 A;  4LUX A;  1ED4 A;  2G6K A;  4D3B A;  4CU1 A;  4CU0 A;  5G6G A;  4UGO A;  3NLF A;  3UFW A;  4D32 A;  5AD4 A;  5ADI A;  4IMT A;  3UFR A;  3NLZ A;  3N6C A;  4CX3 A;  3NLT A;  3E6O A;  5ADJ A;  1M7Z A;  4UH0 A;  4UGY A;  4D7I A;  4KCP A;  3NNY A;  5G6F A;  4D3K A;  4CX5 A;  4D3M A;  4UGV A;  4CFT A;  4D1N A;  4JSG A;  1ED5 A;  3EBD A;  1NSE A;  4JSE A;  3N68 A;  3N63 A;  3N5Y A;  4CTW A;  5G6J A;  4CTQ A;  3NLW A;  5FVY A;  4UGF A;  3NQS A;  2NOD A;  1DMJ A;  4D39 A;  1M8E A;  2FC1 A;  4UPN A;  1ZZR A;  4K5I A;  4JSK A;  5FVO A;  4CAM A;  3JWX A;  3PNF A;  1VAG A;  1FOL A;  3NW2 A;  4CX6 A;  4D1P A;  5ADF A;  1P6J A;  4JS9 A;  2BHJ A;  4FVY A;  5ADL A;  4JSM A;  3DQS A;  2G6L A;  5FW0 A;  2ORQ A;  4CAQ A;  4UPR A;  1I83 A;  4D33 A;  3N6B A;  1K2T A;  3RQK A;  5G68 A;  2G6H A;  4JSF A;  4CU1 B;  1RS9 A;  5G67 A;  1DWV A;  4JSI A;  4UGH A;  4CWY A;  2G6J A;  4LWA A;  3NLH A;  1D1Y A;  4D3A A;  5AGP A;  1LZZ A;  5G6K A;  1M9R A;  5G0P A;  5AD6 A;  1ZZS A;  4KCN A;  3UFO A;  4UGW A;  3E6L A;  5FVU A;  4UPS A;  3RQO A;  3TYN A;  1M7V A;  4UG9 A;  5G6M A;  3DQR A;  4UGT A;  5G6E A;  4CAR A;  1R35 A;  3NOS A;  4UH5 A;  5G6H A;  3JX2 A;  3B3O A;  3Q9A A;  4UH7 A;  4UH3 A;  2ORS A;  5ADA A;  4K5E A;  4D38 A;  3NLX A;  1ZZQ A;  4CFT B;  3JX0 A;  3UFQ A;  3PNE A;  4UGA A;  4UGD A;  1D1X A;  2Y37 A;  4D3U A;  1P6N A;  3NLN A;  4UGR A;  3JT7 A;  2FC2 A;  4UH6 A;  4CUL A;  3RQL A;  5FJ3 A;  1P6I A;  5ADG A;  5ADM A;  4CTX A;  3HSP A;  5G6B A;  1M9J A;  3NLD A;  2HX2 A;  1D0O A;  3E7T A;  4D2Y A;  1K2R A;  1M9K A;  1ZZT A;  5G6D A;  1RS6 A;  5FVS A;  4FVZ A;  3E6T A;  3B3P A;  1RS8 A;  4GQE A;  3NLU A;  5AD8 A;  4KCS A;  4K5F A;  4UQS A;  3JX3 A;  4D34 A;  4JSL A;  3UFU A;  1JWJ A;  5FVV A;  2NSE A;  3N62 A;  4KCM A;  5FVR A;  3E6N A;  5AGK A;  4UGQ A;  4UGC A;  2FLQ A;  3SVQ A;  6NSE A;  2ORO A;  3N5X A;  4CX4 A;  1P6L A;  3PNH A;  3JT9 A;  3N5W A;  3N61 A;  3DQT A;  4CX2 A;  5AD9 A;  1MJT A;  3NSE A;  4CX0 A;  3NLQ A;  1ZZU A;  2ORT A;  1NSI A;  3HSN A;  4UGE A;  5FVQ A;  3NLM A;  4V3X A;  3RQN A;  1DD7 A;  1NOD A;  4D3J A;  4CAN A;  3B3N A;  4K5D A;  5G6N A;  2G6O A;  3NLP A;  3JWU A;  4FVX A;  4CTP A;  4CTU A;  3JX5 A;  1NOS A;  1LZX A;  4IMU A;  4JSH A;  1OM4 A;  9NSE A;  4NOS A;  1FOJ A; 
#chains in the Genus database with same CATH topology
 4UG6 A;  4NSE A;  5FJ2 A;  4IMX A;  4UGK A;  1M8D A;  4IMS A;  3N2R A;  4CTY A;  1D1V A;  3DWJ A;  4KCL A;  5G66 A;  1FOP A;  1FOI A;  5G0N A;  4CUM A;  1VAF A;  1QW6 A;  1P6H A;  5G6C A;  4UPQ A;  3TYM A;  1QW4 A;  3JX6 A;  3N66 A;  5AD5 A;  3E7M A;  2AMO A;  4UGP A;  3N69 A;  4K5K A;  5G6P A;  3N5R A;  4UH9 A;  2G6I A;  1P6K A;  3E67 A;  1JWK A;  1QWC A;  3N64 A;  4UPO A;  1DWX A;  3PNG A;  3N5P A;  2HX3 A;  2G6N A;  3E68 A;  3NLY A;  5FVZ A;  4CTZ A;  5G6Q A;  5G69 A;  5ADN A;  4IMW A;  4LWB A;  4V3Z A;  4CVG A;  1NOC A;  4CWW A;  3JWY A;  4UHA A;  1M8H A;  1ZVL A;  3RQP A;  1M9Q A;  3E7I A;  4LUW A;  4CWX A;  3EJ8 A;  4KCI A;  4CDT A;  5ADD A;  4CTR A;  4K5J A;  4D3V A;  4UGL A;  3NLR A;  5G0O A;  1DM6 A;  4D3T A;  4D37 A;  3EAH A;  5AD7 A;  3FC5 A;  3N6A A;  1M9M A;  4FVW A;  3NLV A;  2NOS A;  3N5Q A;  4V3U A;  4D2Z A;  3JT4 A;  2FBZ X;  8NSE A;  3N5S A;  4D7H A;  3JWZ A;  3JT8 A;  1ZVI A;  1QW5 A;  4UGJ A;  4UPM A;  1DM7 A;  2ORP A;  4CX1 A;  4UGU A;  2HX4 A;  4UGS A;  4CAP A;  3EAI A;  3HSO A;  4UH8 A;  3NLG A;  1N2N A;  3Q99 A;  5AGN A;  4D30 A;  1DMK A;  3UFT A;  1RS7 A;  3TYL A;  3JWW A;  3E7S A;  1DF1 A;  3JX1 A;  4UGB A;  3JWS A;  3UFP A;  3JX4 A;  4KCJ A;  4UG8 A;  1DMI A;  5G6O A;  3N60 A;  4KCR A;  4UH2 A;  5FVW A;  5ADB A;  4CTT A;  5NSE A;  4UG7 A;  3SVP A;  3N5Z A;  3E7G A;  4UGZ A;  4UGN A;  4UH4 A;  3N6E A;  3B3M A;  3N5T A;  5G65 A;  1QOM A;  4D36 A;  5FVP A;  4D3N A;  3NLE A;  4JSJ A;  2AN2 A;  1DM8 A;  5G6L A;  1M8I A;  5FVX A;  4D7O A;  5ADE A;  5G6A A;  4UH1 A;  1MMW A;  4CTV A;  5G6I A;  4CWV A;  3NLO A;  1MMV A;  4UQR A;  3RQJ A;  4FW0 A;  4V3V A;  1OM5 A;  4C39 A;  4UGX A;  4K5G A;  3N6D A;  4UGM A;  4KCH A;  4UPP A;  3NM0 A;  4D3O A;  4KCO A;  1M9T A;  1DWW A;  5ADC A;  3JT3 A;  4K5H A;  4V3Y A;  4D31 A;  4EUX A;  3NLJ A;  2NSI A;  4C3A A;  1D1W A;  4V3W A;  1Q2O A;  4UCH A;  4UPT A;  1M00 A;  3RQM A;  3UFS A;  3EBF A;  4D1O A;  2AN0 A;  4CX7 A;  1K2S A;  3N5V A;  3N65 A;  5AGM A;  2G6M A;  4D3I A;  3N6G A;  4UGI A;  3TYO A;  3E65 A;  4UG5 A;  5ADK A;  3JT5 A;  3N67 A;  3N6F A;  3E7S B;  4KCK A;  5AGL A;  3UFV A;  1FOO A;  4CUN A;  3JTA A;  4KCQ A;  1P6M A;  3JWV A;  5FVT A;  4CAO A;  3JWT A;  7NSE A;  5AGO A;  1ED6 A;  3NLK A;  1D0C A;  2ORR A;  4UGG A;  3NOD A;  3NNZ A;  4CWZ A;  3NLI A;  1K2U A;  3JT6 A;  4D7J A;  4D35 A;  4LUX A;  1ED4 A;  2G6K A;  4D3B A;  4CU1 A;  4CU0 A;  5G6G A;  4UGO A;  3NLF A;  3UFW A;  4D32 A;  5AD4 A;  5ADI A;  4IMT A;  3UFR A;  3NLZ A;  3N6C A;  4CX3 A;  3NLT A;  3E6O A;  5ADJ A;  1M7Z A;  4UH0 A;  4UGY A;  4D7I A;  4KCP A;  3NNY A;  5G6F A;  4D3K A;  4CX5 A;  4D3M A;  4UGV A;  4CFT A;  4D1N A;  4JSG A;  1ED5 A;  3EBD A;  1NSE A;  4JSE A;  3N68 A;  3N63 A;  3N5Y A;  4CTW A;  5G6J A;  4CTQ A;  3NLW A;  5FVY A;  4UGF A;  3NQS A;  2NOD A;  1DMJ A;  4D39 A;  1M8E A;  2FC1 A;  4UPN A;  1ZZR A;  4K5I A;  4JSK A;  5FVO A;  4CAM A;  3JWX A;  3PNF A;  1VAG A;  1FOL A;  3NW2 A;  4CX6 A;  4D1P A;  5ADF A;  1P6J A;  4JS9 A;  2BHJ A;  4FVY A;  5ADL A;  4JSM A;  3DQS A;  2G6L A;  5FW0 A;  2ORQ A;  4CAQ A;  4UPR A;  1I83 A;  4D33 A;  3N6B A;  1K2T A;  3RQK A;  5G68 A;  2G6H A;  4JSF A;  4CU1 B;  1RS9 A;  5G67 A;  1DWV A;  4JSI A;  4UGH A;  4CWY A;  2G6J A;  4LWA A;  3NLH A;  1D1Y A;  4D3A A;  5AGP A;  1LZZ A;  5G6K A;  1M9R A;  5G0P A;  5AD6 A;  1ZZS A;  4KCN A;  3UFO A;  4UGW A;  3E6L A;  5FVU A;  4UPS A;  3RQO A;  3TYN A;  1M7V A;  4UG9 A;  5G6M A;  3DQR A;  4UGT A;  5G6E A;  4CAR A;  1R35 A;  3NOS A;  4UH5 A;  5G6H A;  3JX2 A;  3B3O A;  3Q9A A;  4UH7 A;  4UH3 A;  2ORS A;  5ADA A;  4K5E A;  4D38 A;  3NLX A;  1ZZQ A;  4CFT B;  3JX0 A;  3UFQ A;  3PNE A;  4UGA A;  4UGD A;  1D1X A;  2Y37 A;  4D3U A;  1P6N A;  3NLN A;  4UGR A;  3JT7 A;  2FC2 A;  4UH6 A;  4CUL A;  3RQL A;  5FJ3 A;  1P6I A;  5ADG A;  5ADM A;  4CTX A;  3HSP A;  5G6B A;  1M9J A;  3NLD A;  2HX2 A;  1D0O A;  3E7T A;  4D2Y A;  1K2R A;  1M9K A;  1ZZT A;  5G6D A;  1RS6 A;  5FVS A;  4FVZ A;  3E6T A;  3B3P A;  1RS8 A;  4GQE A;  3NLU A;  5AD8 A;  4KCS A;  4K5F A;  4UQS A;  3JX3 A;  4D34 A;  4JSL A;  3UFU A;  1JWJ A;  5FVV A;  2NSE A;  3N62 A;  4KCM A;  5FVR A;  3E6N A;  5AGK A;  4UGQ A;  4UGC A;  2FLQ A;  3SVQ A;  6NSE A;  2ORO A;  3N5X A;  4CX4 A;  1P6L A;  3PNH A;  3JT9 A;  3N5W A;  3N61 A;  3DQT A;  4CX2 A;  5AD9 A;  1MJT A;  3NSE A;  4CX0 A;  3NLQ A;  1ZZU A;  2ORT A;  1NSI A;  3HSN A;  4UGE A;  5FVQ A;  3NLM A;  4V3X A;  3RQN A;  1DD7 A;  1NOD A;  4D3J A;  4CAN A;  3B3N A;  4K5D A;  5G6N A;  2G6O A;  3NLP A;  3JWU A;  4FVX A;  4CTP A;  4CTU A;  3JX5 A;  1NOS A;  1LZX A;  4IMU A;  4JSH A;  1OM4 A;  9NSE A;  4NOS A;  1FOJ A; 
#chains in the Genus database with same CATH homology
 4UG6 A;  4NSE A;  5FJ2 A;  4IMX A;  4UGK A;  1M8D A;  4IMS A;  3N2R A;  4CTY A;  1D1V A;  3DWJ A;  4KCL A;  5G66 A;  1FOP A;  1FOI A;  5G0N A;  4CUM A;  1VAF A;  1QW6 A;  1P6H A;  5G6C A;  4UPQ A;  3TYM A;  1QW4 A;  3JX6 A;  3N66 A;  5AD5 A;  3E7M A;  2AMO A;  4UGP A;  3N69 A;  4K5K A;  5G6P A;  3N5R A;  4UH9 A;  2G6I A;  1P6K A;  3E67 A;  1JWK A;  1QWC A;  3N64 A;  4UPO A;  1DWX A;  3PNG A;  3N5P A;  2HX3 A;  2G6N A;  3E68 A;  3NLY A;  5FVZ A;  4CTZ A;  5G6Q A;  5G69 A;  5ADN A;  4IMW A;  4LWB A;  4V3Z A;  4CVG A;  1NOC A;  4CWW A;  3JWY A;  4UHA A;  1M8H A;  1ZVL A;  3RQP A;  1M9Q A;  3E7I A;  4LUW A;  4CWX A;  3EJ8 A;  4KCI A;  4CDT A;  5ADD A;  4CTR A;  4K5J A;  4D3V A;  4UGL A;  3NLR A;  5G0O A;  1DM6 A;  4D3T A;  4D37 A;  3EAH A;  5AD7 A;  3FC5 A;  3N6A A;  1M9M A;  4FVW A;  3NLV A;  2NOS A;  3N5Q A;  4V3U A;  4D2Z A;  3JT4 A;  2FBZ X;  8NSE A;  3N5S A;  4D7H A;  3JWZ A;  3JT8 A;  1ZVI A;  1QW5 A;  4UGJ A;  4UPM A;  1DM7 A;  2ORP A;  4CX1 A;  4UGU A;  2HX4 A;  4UGS A;  4CAP A;  3EAI A;  3HSO A;  4UH8 A;  3NLG A;  1N2N A;  3Q99 A;  5AGN A;  4D30 A;  1DMK A;  3UFT A;  1RS7 A;  3TYL A;  3JWW A;  3E7S A;  1DF1 A;  3JX1 A;  4UGB A;  3JWS A;  3UFP A;  3JX4 A;  4KCJ A;  4UG8 A;  1DMI A;  5G6O A;  3N60 A;  4KCR A;  4UH2 A;  5FVW A;  5ADB A;  4CTT A;  5NSE A;  4UG7 A;  3SVP A;  3N5Z A;  3E7G A;  4UGZ A;  4UGN A;  4UH4 A;  3N6E A;  3B3M A;  3N5T A;  5G65 A;  1QOM A;  4D36 A;  5FVP A;  4D3N A;  3NLE A;  4JSJ A;  2AN2 A;  1DM8 A;  5G6L A;  1M8I A;  5FVX A;  4D7O A;  5ADE A;  5G6A A;  4UH1 A;  1MMW A;  4CTV A;  5G6I A;  4CWV A;  3NLO A;  1MMV A;  4UQR A;  3RQJ A;  4FW0 A;  4V3V A;  1OM5 A;  4C39 A;  4UGX A;  4K5G A;  3N6D A;  4UGM A;  4KCH A;  4UPP A;  3NM0 A;  4D3O A;  4KCO A;  1M9T A;  1DWW A;  5ADC A;  3JT3 A;  4K5H A;  4V3Y A;  4D31 A;  4EUX A;  3NLJ A;  2NSI A;  4C3A A;  1D1W A;  4V3W A;  1Q2O A;  4UCH A;  4UPT A;  1M00 A;  3RQM A;  3UFS A;  3EBF A;  4D1O A;  2AN0 A;  4CX7 A;  1K2S A;  3N5V A;  3N65 A;  5AGM A;  2G6M A;  4D3I A;  3N6G A;  4UGI A;  3TYO A;  3E65 A;  4UG5 A;  5ADK A;  3JT5 A;  3N67 A;  3N6F A;  3E7S B;  4KCK A;  5AGL A;  3UFV A;  1FOO A;  4CUN A;  3JTA A;  4KCQ A;  1P6M A;  3JWV A;  5FVT A;  4CAO A;  3JWT A;  7NSE A;  5AGO A;  1ED6 A;  3NLK A;  1D0C A;  2ORR A;  4UGG A;  3NOD A;  3NNZ A;  4CWZ A;  3NLI A;  1K2U A;  3JT6 A;  4D7J A;  4D35 A;  4LUX A;  1ED4 A;  2G6K A;  4D3B A;  4CU1 A;  4CU0 A;  5G6G A;  4UGO A;  3NLF A;  3UFW A;  4D32 A;  5AD4 A;  5ADI A;  4IMT A;  3UFR A;  3NLZ A;  3N6C A;  4CX3 A;  3NLT A;  3E6O A;  5ADJ A;  1M7Z A;  4UH0 A;  4UGY A;  4D7I A;  4KCP A;  3NNY A;  5G6F A;  4D3K A;  4CX5 A;  4D3M A;  4UGV A;  4CFT A;  4D1N A;  4JSG A;  1ED5 A;  3EBD A;  1NSE A;  4JSE A;  3N68 A;  3N63 A;  3N5Y A;  4CTW A;  5G6J A;  4CTQ A;  3NLW A;  5FVY A;  4UGF A;  3NQS A;  2NOD A;  1DMJ A;  4D39 A;  1M8E A;  2FC1 A;  4UPN A;  1ZZR A;  4K5I A;  4JSK A;  5FVO A;  4CAM A;  3JWX A;  3PNF A;  1VAG A;  1FOL A;  3NW2 A;  4CX6 A;  4D1P A;  5ADF A;  1P6J A;  4JS9 A;  2BHJ A;  4FVY A;  5ADL A;  4JSM A;  3DQS A;  2G6L A;  5FW0 A;  2ORQ A;  4CAQ A;  4UPR A;  1I83 A;  4D33 A;  3N6B A;  1K2T A;  3RQK A;  5G68 A;  2G6H A;  4JSF A;  4CU1 B;  1RS9 A;  5G67 A;  1DWV A;  4JSI A;  4UGH A;  4CWY A;  2G6J A;  4LWA A;  3NLH A;  1D1Y A;  4D3A A;  5AGP A;  1LZZ A;  5G6K A;  1M9R A;  5G0P A;  5AD6 A;  1ZZS A;  4KCN A;  3UFO A;  4UGW A;  3E6L A;  5FVU A;  4UPS A;  3RQO A;  3TYN A;  1M7V A;  4UG9 A;  5G6M A;  3DQR A;  4UGT A;  5G6E A;  4CAR A;  1R35 A;  3NOS A;  4UH5 A;  5G6H A;  3JX2 A;  3B3O A;  3Q9A A;  4UH7 A;  4UH3 A;  2ORS A;  5ADA A;  4K5E A;  4D38 A;  3NLX A;  1ZZQ A;  4CFT B;  3JX0 A;  3UFQ A;  3PNE A;  4UGA A;  4UGD A;  1D1X A;  2Y37 A;  4D3U A;  1P6N A;  3NLN A;  4UGR A;  3JT7 A;  2FC2 A;  4UH6 A;  4CUL A;  3RQL A;  5FJ3 A;  1P6I A;  5ADG A;  5ADM A;  4CTX A;  3HSP A;  5G6B A;  1M9J A;  3NLD A;  2HX2 A;  1D0O A;  3E7T A;  4D2Y A;  1K2R A;  1M9K A;  1ZZT A;  5G6D A;  1RS6 A;  5FVS A;  4FVZ A;  3E6T A;  3B3P A;  1RS8 A;  4GQE A;  3NLU A;  5AD8 A;  4KCS A;  4K5F A;  4UQS A;  3JX3 A;  4D34 A;  4JSL A;  3UFU A;  1JWJ A;  5FVV A;  2NSE A;  3N62 A;  4KCM A;  5FVR A;  3E6N A;  5AGK A;  4UGQ A;  4UGC A;  2FLQ A;  3SVQ A;  6NSE A;  2ORO A;  3N5X A;  4CX4 A;  1P6L A;  3PNH A;  3JT9 A;  3N5W A;  3N61 A;  3DQT A;  4CX2 A;  5AD9 A;  1MJT A;  3NSE A;  4CX0 A;  3NLQ A;  1ZZU A;  2ORT A;  1NSI A;  3HSN A;  4UGE A;  5FVQ A;  3NLM A;  4V3X A;  3RQN A;  1DD7 A;  1NOD A;  4D3J A;  4CAN A;  3B3N A;  4K5D A;  5G6N A;  2G6O A;  3NLP A;  3JWU A;  4FVX A;  4CTP A;  4CTU A;  3JX5 A;  1NOS A;  1LZX A;  4IMU A;  4JSH A;  1OM4 A;  9NSE A;  4NOS A;  1FOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...