4D3MA

Structure of bacillus subtilis nitric oxide synthase in complex with 3-(2-(6-amino-4-methylpyridin-2-yl)ethyl)-5-(2-(4-methyl-6-(methylamino)pyridin-2-yl)ethyl)benzonitrile
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
362
structure length
362
Chain Sequence
EEKEILWNEAKAFIAACYQELGKAAEVKDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPPEEKGEKQVEIWNHQLIRYAGYESDGERIGDPASCSLTAACEELGWRGERTDFDLLPLIFRMKGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQAEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDKPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NITRIC OXIDE SYNTHASE OXYGENASE
publication title Structure-based design of bacterial nitric oxide synthase inhibitors.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
total genus 122
structure length 362
sequence length 362
ec nomenclature ec 1.14.14.47: Nitric-oxide synthase (flavodoxin).
pdb deposition date 2014-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02898 NO_synthase Nitric oxide synthase, oxygenase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.340.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase; Chain A, domain 1 Nitric Oxide Synthase; Chain A, domain 1 4d3mA01
3.90.440.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase;Heme Domain; Chain A, domain 2 Nitric Oxide Synthase;Heme Domain;Chain A domain 2 4d3mA02
3.90.1230.10 Alpha Beta Alpha-Beta Complex Bovine Endothelial Nitric Oxide Synthase Heme Domain; Chain: A,domain 3 Nitric Oxide Synthase; Chain A, domain 3 4d3mA03
4CTWA 4UPRA 4K5HA 4UGCA 3PNGA 1JWJA 3SVQA 3RQOA 3NLXA 5FVTA 3UFVA 5ADAA 4CAOA 4UG6A 4IMSA 5AD7A 4KCJA 1RS8A 5NSEA 5AD6A 1M8IA 4FVYA 1RS9A 5ADMA 1ZZSA 4UGNA 5ADKA 4CX7A 4LWBA 1NSEA 4UH7A 3NQSA 3N6CA 4FVXA 1ZZTA 5G6QA 4CULA 4D3OA 1DM6A 3N6EA 4CTTA 4UGPA 4IMTA 1DWVA 3N5RA 3NNYA 4UGAA 1DD7A 5AGPA 4CWYA 1P6MA 3N5XA 3NLMA 5ADGA 1K2RA 3E6NA 1M9QA 4D3VA 5FVSA 4FVZA 1ZVLA 3N6DA 5FVPA 3NLJA 5FVYA 4CX1A 4JSEA 4UGUA 5G69A 3N69A 4D3MA 1DMJA 4CWWA 4CTPA 2NOSA 4KCQA 4CTYA 4D7IA 3UFWA 4D3TA 5G6FA 3JWSA 3RQMA 4CX5A 3DQTA 1LZZA 1D1YA 4UH5A 5FVOA 4D32A 4UGXA 4LUWA 1ED4A 4UHAA 4UGGA 3E6OA 4UQRA 1ED6A 5G6GA 2HX4A 3NLTA 4D3IA 4CU0A 3JWZA 3EAIA 4D7HA 3RQLA 4CX0A 1QW6A 1P6JA 4LWAA 4UGTA 3RQNA 4NSEA 4KCNA 3JWUA 3N2RA 3E7SA 1FOPA 4K5GA 5G6BA 3N5WA 1DWWA 5ADNA 4CAMA 4UPSA 3HSNA 3N68A 2HX2A 3E7SB 3HSPA 3JT7A 3N6BA 3NW2A 3JX6A 4D30A 4UQSA 5ADCA 4C3AA 4UGKA 3NLRA 4D31A 3UFPA 4KCHA 3SVPA 4UGEA 4UPMA 3RQKA 1P6LA 1NODA 4UH6A 2FC1A 3NLUA 4UG7A 5G6PA 1K2UA 3E7IA 5G65A 4JS9A 2G6LA 5G6LA 3NM0A 1D1WA 4CWXA 1M7VA 4IMWA 4CUMA 1N2NA 5FVZA 1ZVIA 4CVGA 3NLGA 1M9TA 1M9JA 4D2ZA 3JT5A 4UG8A 4JSLA 1FOOA 4UGSA 1ED5A 4IMXA 4D7OA 3NLWA 1D0CA 4KCOA 4FW0A 3JX0A 3NLPA 5G6HA 2G6IA 3JT4A 3EAHA 1NOSA 3NLDA 3N5PA 3NNZA 4K5KA 4V3ZA 4UPQA 3UFTA 3PNFA 1OM5A 4NOSA 5G6MA 4D1OA 2NSEA 1P6NA 5FJ2A 1K2TA 1M8EA 3NLHA 1M9KA 4V3UA 5AGLA 3N5TA 3JT8A 3JX4A 4CX6A 5G68A 5ADIA 4CU1A 4JSMA 2FLQA 3TYLA 4CTRA 4KCRA 4D3BA 4K5FA 1VAFA 4CAPA 4UPTA 1FOLA 1ZZRA 4CARA 3E7TA 2OROA 4UGHA 4KCPA 1NSIA 4CX4A 3JWWA 1FOJA 3B3PA 4UH2A 4CDTA 1VAGA 4UGIA 7NSEA 4K5DA 4D33A 3JTAA 2AN0A 3N5ZA 4K5JA 3JX3A 3N5VA 1MMWA 4UH4A 4JSFA 2NODA 4UGQA 3B3MA 2NSIA 1NOCA 3DQSA 3N61A 3N65A 4UH1A 2ORPA 1D1VA 4UCHA 4UG5A 5FVUA 4CX3A 4D3NA 1M8DA 3NLZA 3JT6A 3NLVA 1QW5A 5ADDA 3PNHA 5FVWA 3UFRA 3NLOA 5ADFA 4UPPA 3Q99A 4CTXA 5G0PA 1RS6A 3JX5A 3N66A 3DQRA 4KCKA 4CFTA 4D1NA 3E65A 4CFTB 5ADBA 5G6OA 4UGMA 3N6GA 4UG9A 3NLNA 5AD8A 1QWCA 5FVVA 4GQEA 3UFSA 3N5SA 5FW0A 4KCMA 6NSEA 4D3JA 5FVXA 3JX1A 3NLQA 5FJ3A 4UGDA 4D3AA 1QW4A 4UGBA 5G66A 4UH9A 1P6HA 4UGWA 4UGYA 1P6IA 3NLIA 1P6KA 4D1PA 3TYOA 3N6AA 1JWKA 4KCSA 1DMKA 3N60A 5G6AA 4CTQA 4UPOA 5G0OA 4KCIA 4JSIA 1DMIA 2ORRA 2G6NA 3RQJA 4EUXA 1D1XA 4CX2A 2G6OA 2Y37A 4V3YA 4V3XA 2G6JA 3NLKA 4D38A 5G6EA 4UH8A 3UFOA 1Q2OA 5AD9A 2BHJA 4UGLA 4CU1B 2AMOA 3E6TA 5AD4A 3N5YA 1D0OA 5AGMA 5G6NA 4CTUA 3N6FA 4JSJA 4UH3A 5G6CA 4D34A 1ZZUA 2ORQA 3JT9A 3EBFA 3FC5A 4UGZA 4D36A 4D3UA 4UPNA 1DWXA 1M00A 3JWYA 1M8HA 1RS7A 5FVQA 5G6DA 4D39A 3NODA 4D35A 1MMVA 3UFQA 5ADLA 3N62A 3N67A 5FVRA 1FOIA 2ORTA 1QOMA 2G6MA 1MJTA 5AGOA 4D2YA 5AGKA 4D37A 1ZZQA 3NLFA 5ADJA 4CTVA 3N5QA 4UGFA 1M9MA 3NLYA 3NSEA 4JSGA 4UGRA 1K2SA 3JWXA 4KCLA 9NSEA 3EJ8A 3N63A 1OM4A 3B3NA 3DWJA 3B3OA 5G6IA 4UGVA 1R35A 2G6HA 3E6LA 4K5EA 3JX2A 3UFUA 4CWZA 2HX3A 3E68A 4V3VA 3NOSA 5AGNA 3Q9AA 4K5IA 1LZXA 4JSHA 4LUXA 5G6KA 3HSOA 3EBDA 2AN2A 3JWTA 4C39A 3RQPA 4CWVA 4UGOA 4FVWA 4CANA 4D7JA 1DF1A 1DM8A 4UH0A 3E7GA 1M9RA 4CUNA 2FC2A 4D3KA 3JT3A 3N64A 2G6KA 4V3WA 5G0NA 3NLEA 2FBZX 5G67A 4JSKA 1M7ZA 4UGJA 3JWVA 1I83A 3E7MA 5G6JA 4CTZA 5AD5A 5ADEA 1DM7A 3TYMA 3TYNA 2ORSA 4CAQA 3E67A 4IMUA 3PNEA 8NSEA
chains in the Genus database with same CATH superfamily
4CTWA 4UPRA 4K5HA 4UGCA 3PNGA 1JWJA 3SVQA 3RQOA 3NLXA 5FVTA 3UFVA 5ADAA 4CAOA 4UG6A 4IMSA 5AD7A 4KCJA 1RS8A 5NSEA 5AD6A 1M8IA 4FVYA 1RS9A 5ADMA 1ZZSA 4UGNA 5ADKA 4CX7A 4LWBA 1NSEA 4UH7A 3NQSA 3N6CA 4FVXA 1ZZTA 5G6QA 4CULA 4D3OA 1DM6A 3N6EA 4CTTA 4UGPA 4IMTA 1DWVA 3N5RA 3NNYA 4UGAA 1DD7A 5AGPA 4CWYA 1P6MA 3N5XA 3NLMA 5ADGA 1K2RA 3E6NA 1M9QA 4D3VA 5FVSA 4FVZA 1ZVLA 3N6DA 5FVPA 3NLJA 5FVYA 4CX1A 4JSEA 4UGUA 5G69A 3N69A 4D3MA 1DMJA 4CWWA 4CTPA 2NOSA 4KCQA 4CTYA 4D7IA 3UFWA 4D3TA 5G6FA 3JWSA 3RQMA 4CX5A 3DQTA 1LZZA 1D1YA 4UH5A 5FVOA 4D32A 4UGXA 4LUWA 1ED4A 4UHAA 4UGGA 3E6OA 4UQRA 1ED6A 5G6GA 2HX4A 3NLTA 4D3IA 4CU0A 3JWZA 3EAIA 4D7HA 3RQLA 4CX0A 1QW6A 1P6JA 4LWAA 4UGTA 3RQNA 4NSEA 4KCNA 3JWUA 3N2RA 3E7SA 1FOPA 4K5GA 5G6BA 3N5WA 1DWWA 5ADNA 4CAMA 4UPSA 3HSNA 3N68A 2HX2A 3E7SB 3HSPA 3JT7A 3N6BA 3NW2A 3JX6A 4D30A 4UQSA 5ADCA 4C3AA 4UGKA 3NLRA 4D31A 3UFPA 4KCHA 3SVPA 4UGEA 4UPMA 3RQKA 1P6LA 1NODA 4UH6A 2FC1A 3NLUA 4UG7A 5G6PA 1K2UA 3E7IA 5G65A 4JS9A 2G6LA 5G6LA 3NM0A 1D1WA 4CWXA 1M7VA 4IMWA 4CUMA 1N2NA 5FVZA 1ZVIA 4CVGA 3NLGA 1M9TA 1M9JA 4D2ZA 3JT5A 4UG8A 4JSLA 1FOOA 4UGSA 1ED5A 4IMXA 4D7OA 3NLWA 1D0CA 4KCOA 4FW0A 3JX0A 3NLPA 5G6HA 2G6IA 3JT4A 3EAHA 1NOSA 3NLDA 3N5PA 3NNZA 4K5KA 4V3ZA 4UPQA 3UFTA 3PNFA 1OM5A 4NOSA 5G6MA 4D1OA 2NSEA 1P6NA 5FJ2A 1K2TA 1M8EA 3NLHA 1M9KA 4V3UA 5AGLA 3N5TA 3JT8A 3JX4A 4CX6A 5G68A 5ADIA 4CU1A 4JSMA 2FLQA 3TYLA 4CTRA 4KCRA 4D3BA 4K5FA 1VAFA 4CAPA 4UPTA 1FOLA 1ZZRA 4CARA 3E7TA 2OROA 4UGHA 4KCPA 1NSIA 4CX4A 3JWWA 1FOJA 3B3PA 4UH2A 4CDTA 1VAGA 4UGIA 7NSEA 4K5DA 4D33A 3JTAA 2AN0A 3N5ZA 4K5JA 3JX3A 3N5VA 1MMWA 4UH4A 4JSFA 2NODA 4UGQA 3B3MA 2NSIA 1NOCA 3DQSA 3N61A 3N65A 4UH1A 2ORPA 1D1VA 4UCHA 4UG5A 5FVUA 4CX3A 4D3NA 1M8DA 3NLZA 3JT6A 3NLVA 1QW5A 5ADDA 3PNHA 5FVWA 3UFRA 3NLOA 5ADFA 4UPPA 3Q99A 4CTXA 5G0PA 1RS6A 3JX5A 3N66A 3DQRA 4KCKA 4CFTA 4D1NA 3E65A 4CFTB 5ADBA 5G6OA 4UGMA 3N6GA 4UG9A 3NLNA 5AD8A 1QWCA 5FVVA 4GQEA 3UFSA 3N5SA 5FW0A 4KCMA 6NSEA 4D3JA 5FVXA 3JX1A 3NLQA 5FJ3A 4UGDA 4D3AA 1QW4A 4UGBA 5G66A 4UH9A 1P6HA 4UGWA 4UGYA 1P6IA 3NLIA 1P6KA 4D1PA 3TYOA 3N6AA 1JWKA 4KCSA 1DMKA 3N60A 5G6AA 4CTQA 4UPOA 5G0OA 4KCIA 4JSIA 1DMIA 2ORRA 2G6NA 3RQJA 4EUXA 1D1XA 4CX2A 2G6OA 2Y37A 4V3YA 4V3XA 2G6JA 3NLKA 4D38A 5G6EA 4UH8A 3UFOA 1Q2OA 5AD9A 2BHJA 4UGLA 4CU1B 2AMOA 3E6TA 5AD4A 3N5YA 1D0OA 5AGMA 5G6NA 4CTUA 3N6FA 4JSJA 4UH3A 5G6CA 4D34A 1ZZUA 2ORQA 3JT9A 3EBFA 3FC5A 4UGZA 4D36A 4D3UA 4UPNA 1DWXA 1M00A 3JWYA 1M8HA 1RS7A 5FVQA 5G6DA 4D39A 3NODA 4D35A 1MMVA 3UFQA 5ADLA 3N62A 3N67A 5FVRA 1FOIA 2ORTA 1QOMA 2G6MA 1MJTA 5AGOA 4D2YA 5AGKA 4D37A 1ZZQA 3NLFA 5ADJA 4CTVA 3N5QA 4UGFA 1M9MA 3NLYA 3NSEA 4JSGA 4UGRA 1K2SA 3JWXA 4KCLA 9NSEA 3EJ8A 3N63A 1OM4A 3B3NA 3DWJA 3B3OA 5G6IA 4UGVA 1R35A 2G6HA 3E6LA 4K5EA 3JX2A 3UFUA 4CWZA 2HX3A 3E68A 4V3VA 3NOSA 5AGNA 3Q9AA 4K5IA 1LZXA 4JSHA 4LUXA 5G6KA 3HSOA 3EBDA 2AN2A 3JWTA 4C39A 3RQPA 4CWVA 4UGOA 4FVWA 4CANA 4D7JA 1DF1A 1DM8A 4UH0A 3E7GA 1M9RA 4CUNA 2FC2A 4D3KA 3JT3A 3N64A 2G6KA 4V3WA 5G0NA 3NLEA 2FBZX 5G67A 4JSKA 1M7ZA 4UGJA 3JWVA 1I83A 3E7MA 5G6JA 4CTZA 5AD5A 5ADEA 1DM7A 3TYMA 3TYNA 2ORSA 4CAQA 3E67A 4IMUA 3PNEA 8NSEA
chains in the Genus database with same CATH topology
4CTWA 4UPRA 4K5HA 4UGCA 3PNGA 1JWJA 3SVQA 3RQOA 3NLXA 5FVTA 3UFVA 5ADAA 4CAOA 4UG6A 4IMSA 5AD7A 4KCJA 1RS8A 5NSEA 5AD6A 1M8IA 4FVYA 1RS9A 5ADMA 1ZZSA 4UGNA 5ADKA 4CX7A 4LWBA 1NSEA 4UH7A 3NQSA 3N6CA 4FVXA 1ZZTA 5G6QA 4CULA 4D3OA 1DM6A 3N6EA 4CTTA 4UGPA 4IMTA 1DWVA 3N5RA 3NNYA 4UGAA 1DD7A 5AGPA 4CWYA 1P6MA 3N5XA 3NLMA 5ADGA 1K2RA 3E6NA 1M9QA 4D3VA 5FVSA 4FVZA 1ZVLA 3N6DA 5FVPA 3NLJA 5FVYA 4CX1A 4JSEA 4UGUA 5G69A 3N69A 4D3MA 1DMJA 4CWWA 4CTPA 2NOSA 4KCQA 4CTYA 4D7IA 3UFWA 4D3TA 5G6FA 3JWSA 3RQMA 4CX5A 3DQTA 1LZZA 1D1YA 4UH5A 5FVOA 4D32A 4UGXA 4LUWA 1ED4A 4UHAA 4UGGA 3E6OA 4UQRA 1ED6A 5G6GA 2HX4A 3NLTA 4D3IA 4CU0A 3JWZA 3EAIA 4D7HA 3RQLA 4CX0A 1QW6A 1P6JA 4LWAA 4UGTA 3RQNA 4NSEA 4KCNA 3JWUA 3N2RA 3E7SA 1FOPA 4K5GA 5G6BA 3N5WA 1DWWA 5ADNA 4CAMA 4UPSA 3HSNA 3N68A 2HX2A 3E7SB 3HSPA 3JT7A 3N6BA 3NW2A 3JX6A 4D30A 4UQSA 5ADCA 4C3AA 4UGKA 3NLRA 4D31A 3UFPA 4KCHA 3SVPA 4UGEA 4UPMA 3RQKA 1P6LA 1NODA 4UH6A 2FC1A 3NLUA 4UG7A 5G6PA 1K2UA 3E7IA 5G65A 4JS9A 2G6LA 5G6LA 3NM0A 1D1WA 4CWXA 1M7VA 4IMWA 4CUMA 1N2NA 5FVZA 1ZVIA 4CVGA 3NLGA 1M9TA 1M9JA 4D2ZA 3JT5A 4UG8A 4JSLA 1FOOA 4UGSA 1ED5A 4IMXA 4D7OA 3NLWA 1D0CA 4KCOA 4FW0A 3JX0A 3NLPA 5G6HA 2G6IA 3JT4A 3EAHA 1NOSA 3NLDA 3N5PA 3NNZA 4K5KA 4V3ZA 4UPQA 3UFTA 3PNFA 1OM5A 4NOSA 5G6MA 4D1OA 2NSEA 1P6NA 5FJ2A 1K2TA 1M8EA 3NLHA 1M9KA 4V3UA 5AGLA 3N5TA 3JT8A 3JX4A 4CX6A 5G68A 5ADIA 4CU1A 4JSMA 2FLQA 3TYLA 4CTRA 4KCRA 4D3BA 4K5FA 1VAFA 4CAPA 4UPTA 1FOLA 1ZZRA 4CARA 3E7TA 2OROA 4UGHA 4KCPA 1NSIA 4CX4A 3JWWA 1FOJA 3B3PA 4UH2A 4CDTA 1VAGA 4UGIA 7NSEA 4K5DA 4D33A 3JTAA 2AN0A 3N5ZA 4K5JA 3JX3A 3N5VA 1MMWA 4UH4A 4JSFA 2NODA 4UGQA 3B3MA 2NSIA 1NOCA 3DQSA 3N61A 3N65A 4UH1A 2ORPA 1D1VA 4UCHA 4UG5A 5FVUA 4CX3A 4D3NA 1M8DA 3NLZA 3JT6A 3NLVA 1QW5A 5ADDA 3PNHA 5FVWA 3UFRA 3NLOA 5ADFA 4UPPA 3Q99A 4CTXA 5G0PA 1RS6A 3JX5A 3N66A 3DQRA 4KCKA 4CFTA 4D1NA 3E65A 4CFTB 5ADBA 5G6OA 4UGMA 3N6GA 4UG9A 3NLNA 5AD8A 1QWCA 5FVVA 4GQEA 3UFSA 3N5SA 5FW0A 4KCMA 6NSEA 4D3JA 5FVXA 3JX1A 3NLQA 5FJ3A 4UGDA 4D3AA 1QW4A 4UGBA 5G66A 4UH9A 1P6HA 4UGWA 4UGYA 1P6IA 3NLIA 1P6KA 4D1PA 3TYOA 3N6AA 1JWKA 4KCSA 1DMKA 3N60A 5G6AA 4CTQA 4UPOA 5G0OA 4KCIA 4JSIA 1DMIA 2ORRA 2G6NA 3RQJA 4EUXA 1D1XA 4CX2A 2G6OA 2Y37A 4V3YA 4V3XA 2G6JA 3NLKA 4D38A 5G6EA 4UH8A 3UFOA 1Q2OA 5AD9A 2BHJA 4UGLA 4CU1B 2AMOA 3E6TA 5AD4A 3N5YA 1D0OA 5AGMA 5G6NA 4CTUA 3N6FA 4JSJA 4UH3A 5G6CA 4D34A 1ZZUA 2ORQA 3JT9A 3EBFA 3FC5A 4UGZA 4D36A 4D3UA 4UPNA 1DWXA 1M00A 3JWYA 1M8HA 1RS7A 5FVQA 5G6DA 4D39A 3NODA 4D35A 1MMVA 3UFQA 5ADLA 3N62A 3N67A 5FVRA 1FOIA 2ORTA 1QOMA 2G6MA 1MJTA 5AGOA 4D2YA 5AGKA 4D37A 1ZZQA 3NLFA 5ADJA 4CTVA 3N5QA 4UGFA 1M9MA 3NLYA 3NSEA 4JSGA 4UGRA 1K2SA 3JWXA 4KCLA 9NSEA 3EJ8A 3N63A 1OM4A 3B3NA 3DWJA 3B3OA 5G6IA 4UGVA 1R35A 2G6HA 3E6LA 4K5EA 3JX2A 3UFUA 4CWZA 2HX3A 3E68A 4V3VA 3NOSA 5AGNA 3Q9AA 4K5IA 1LZXA 4JSHA 4LUXA 5G6KA 3HSOA 3EBDA 2AN2A 3JWTA 4C39A 3RQPA 4CWVA 4UGOA 4FVWA 4CANA 4D7JA 1DF1A 1DM8A 4UH0A 3E7GA 1M9RA 4CUNA 2FC2A 4D3KA 3JT3A 3N64A 2G6KA 4V3WA 5G0NA 3NLEA 2FBZX 5G67A 4JSKA 1M7ZA 4UGJA 3JWVA 1I83A 3E7MA 5G6JA 4CTZA 5AD5A 5ADEA 1DM7A 3TYMA 3TYNA 2ORSA 4CAQA 3E67A 4IMUA 3PNEA 8NSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CTW A;  4UPR A;  4K5H A;  4UGC A;  3PNG A;  1JWJ A;  3SVQ A;  3RQO A;  3NLX A;  5FVT A;  3UFV A;  5ADA A;  4CAO A;  4UG6 A;  4IMS A;  5AD7 A;  4KCJ A;  1RS8 A;  5NSE A;  5AD6 A;  1M8I A;  4FVY A;  1RS9 A;  5ADM A;  1ZZS A;  4UGN A;  5ADK A;  4CX7 A;  4LWB A;  1NSE A;  4UH7 A;  3NQS A;  3N6C A;  4FVX A;  1ZZT A;  5G6Q A;  4CUL A;  4D3O A;  1DM6 A;  3N6E A;  4CTT A;  4UGP A;  4IMT A;  1DWV A;  3N5R A;  3NNY A;  4UGA A;  1DD7 A;  5AGP A;  4CWY A;  1P6M A;  3N5X A;  3NLM A;  5ADG A;  1K2R A;  3E6N A;  1M9Q A;  4D3V A;  5FVS A;  4FVZ A;  1ZVL A;  3N6D A;  5FVP A;  3NLJ A;  5FVY A;  4CX1 A;  4JSE A;  4UGU A;  5G69 A;  3N69 A;  4D3M A;  1DMJ A;  4CWW A;  4CTP A;  2NOS A;  4KCQ A;  4CTY A;  4D7I A;  3UFW A;  4D3T A;  5G6F A;  3JWS A;  3RQM A;  4CX5 A;  3DQT A;  1LZZ A;  1D1Y A;  4UH5 A;  5FVO A;  4D32 A;  4UGX A;  4LUW A;  1ED4 A;  4UHA A;  4UGG A;  3E6O A;  4UQR A;  1ED6 A;  5G6G A;  2HX4 A;  3NLT A;  4D3I A;  4CU0 A;  3JWZ A;  3EAI A;  4D7H A;  3RQL A;  4CX0 A;  1QW6 A;  1P6J A;  4LWA A;  4UGT A;  3RQN A;  4NSE A;  4KCN A;  3JWU A;  3N2R A;  3E7S A;  1FOP A;  4K5G A;  5G6B A;  3N5W A;  1DWW A;  5ADN A;  4CAM A;  4UPS A;  3HSN A;  3N68 A;  2HX2 A;  3E7S B;  3HSP A;  3JT7 A;  3N6B A;  3NW2 A;  3JX6 A;  4D30 A;  4UQS A;  5ADC A;  4C3A A;  4UGK A;  3NLR A;  4D31 A;  3UFP A;  4KCH A;  3SVP A;  4UGE A;  4UPM A;  3RQK A;  1P6L A;  1NOD A;  4UH6 A;  2FC1 A;  3NLU A;  4UG7 A;  5G6P A;  1K2U A;  3E7I A;  5G65 A;  4JS9 A;  2G6L A;  5G6L A;  3NM0 A;  1D1W A;  4CWX A;  1M7V A;  4IMW A;  4CUM A;  1N2N A;  5FVZ A;  1ZVI A;  4CVG A;  3NLG A;  1M9T A;  1M9J A;  4D2Z A;  3JT5 A;  4UG8 A;  4JSL A;  1FOO A;  4UGS A;  1ED5 A;  4IMX A;  4D7O A;  3NLW A;  1D0C A;  4KCO A;  4FW0 A;  3JX0 A;  3NLP A;  5G6H A;  2G6I A;  3JT4 A;  3EAH A;  1NOS A;  3NLD A;  3N5P A;  3NNZ A;  4K5K A;  4V3Z A;  4UPQ A;  3UFT A;  3PNF A;  1OM5 A;  4NOS A;  5G6M A;  4D1O A;  2NSE A;  1P6N A;  5FJ2 A;  1K2T A;  1M8E A;  3NLH A;  1M9K A;  4V3U A;  5AGL A;  3N5T A;  3JT8 A;  3JX4 A;  4CX6 A;  5G68 A;  5ADI A;  4CU1 A;  4JSM A;  2FLQ A;  3TYL A;  4CTR A;  4KCR A;  4D3B A;  4K5F A;  1VAF A;  4CAP A;  4UPT A;  1FOL A;  1ZZR A;  4CAR A;  3E7T A;  2ORO A;  4UGH A;  4KCP A;  1NSI A;  4CX4 A;  3JWW A;  1FOJ A;  3B3P A;  4UH2 A;  4CDT A;  1VAG A;  4UGI A;  7NSE A;  4K5D A;  4D33 A;  3JTA A;  2AN0 A;  3N5Z A;  4K5J A;  3JX3 A;  3N5V A;  1MMW A;  4UH4 A;  4JSF A;  2NOD A;  4UGQ A;  3B3M A;  2NSI A;  1NOC A;  3DQS A;  3N61 A;  3N65 A;  4UH1 A;  2ORP A;  1D1V A;  4UCH A;  4UG5 A;  5FVU A;  4CX3 A;  4D3N A;  1M8D A;  3NLZ A;  3JT6 A;  3NLV A;  1QW5 A;  5ADD A;  3PNH A;  5FVW A;  3UFR A;  3NLO A;  5ADF A;  4UPP A;  3Q99 A;  4CTX A;  5G0P A;  1RS6 A;  3JX5 A;  3N66 A;  3DQR A;  4KCK A;  4CFT A;  4D1N A;  3E65 A;  4CFT B;  5ADB A;  5G6O A;  4UGM A;  3N6G A;  4UG9 A;  3NLN A;  5AD8 A;  1QWC A;  5FVV A;  4GQE A;  3UFS A;  3N5S A;  5FW0 A;  4KCM A;  6NSE A;  4D3J A;  5FVX A;  3JX1 A;  3NLQ A;  5FJ3 A;  4UGD A;  4D3A A;  1QW4 A;  4UGB A;  5G66 A;  4UH9 A;  1P6H A;  4UGW A;  4UGY A;  1P6I A;  3NLI A;  1P6K A;  4D1P A;  3TYO A;  3N6A A;  1JWK A;  4KCS A;  1DMK A;  3N60 A;  5G6A A;  4CTQ A;  4UPO A;  5G0O A;  4KCI A;  4JSI A;  1DMI A;  2ORR A;  2G6N A;  3RQJ A;  4EUX A;  1D1X A;  4CX2 A;  2G6O A;  2Y37 A;  4V3Y A;  4V3X A;  2G6J A;  3NLK A;  4D38 A;  5G6E A;  4UH8 A;  3UFO A;  1Q2O A;  5AD9 A;  2BHJ A;  4UGL A;  4CU1 B;  2AMO A;  3E6T A;  5AD4 A;  3N5Y A;  1D0O A;  5AGM A;  5G6N A;  4CTU A;  3N6F A;  4JSJ A;  4UH3 A;  5G6C A;  4D34 A;  1ZZU A;  2ORQ A;  3JT9 A;  3EBF A;  3FC5 A;  4UGZ A;  4D36 A;  4D3U A;  4UPN A;  1DWX A;  1M00 A;  3JWY A;  1M8H A;  1RS7 A;  5FVQ A;  5G6D A;  4D39 A;  3NOD A;  4D35 A;  1MMV A;  3UFQ A;  5ADL A;  3N62 A;  3N67 A;  5FVR A;  1FOI A;  2ORT A;  1QOM A;  2G6M A;  1MJT A;  5AGO A;  4D2Y A;  5AGK A;  4D37 A;  1ZZQ A;  3NLF A;  5ADJ A;  4CTV A;  3N5Q A;  4UGF A;  1M9M A;  3NLY A;  3NSE A;  4JSG A;  4UGR A;  1K2S A;  3JWX A;  4KCL A;  9NSE A;  3EJ8 A;  3N63 A;  1OM4 A;  3B3N A;  3DWJ A;  3B3O A;  5G6I A;  4UGV A;  1R35 A;  2G6H A;  3E6L A;  4K5E A;  3JX2 A;  3UFU A;  4CWZ A;  2HX3 A;  3E68 A;  4V3V A;  3NOS A;  5AGN A;  3Q9A A;  4K5I A;  1LZX A;  4JSH A;  4LUX A;  5G6K A;  3HSO A;  3EBD A;  2AN2 A;  3JWT A;  4C39 A;  3RQP A;  4CWV A;  4UGO A;  4FVW A;  4CAN A;  4D7J A;  1DF1 A;  1DM8 A;  4UH0 A;  3E7G A;  1M9R A;  4CUN A;  2FC2 A;  4D3K A;  3JT3 A;  3N64 A;  2G6K A;  4V3W A;  5G0N A;  3NLE A;  2FBZ X;  5G67 A;  4JSK A;  1M7Z A;  4UGJ A;  3JWV A;  1I83 A;  3E7M A;  5G6J A;  4CTZ A;  5AD5 A;  5ADE A;  1DM7 A;  3TYM A;  3TYN A;  2ORS A;  4CAQ A;  3E67 A;  4IMU A;  3PNE A;  8NSE A; 
#chains in the Genus database with same CATH topology
 4CTW A;  4UPR A;  4K5H A;  4UGC A;  3PNG A;  1JWJ A;  3SVQ A;  3RQO A;  3NLX A;  5FVT A;  3UFV A;  5ADA A;  4CAO A;  4UG6 A;  4IMS A;  5AD7 A;  4KCJ A;  1RS8 A;  5NSE A;  5AD6 A;  1M8I A;  4FVY A;  1RS9 A;  5ADM A;  1ZZS A;  4UGN A;  5ADK A;  4CX7 A;  4LWB A;  1NSE A;  4UH7 A;  3NQS A;  3N6C A;  4FVX A;  1ZZT A;  5G6Q A;  4CUL A;  4D3O A;  1DM6 A;  3N6E A;  4CTT A;  4UGP A;  4IMT A;  1DWV A;  3N5R A;  3NNY A;  4UGA A;  1DD7 A;  5AGP A;  4CWY A;  1P6M A;  3N5X A;  3NLM A;  5ADG A;  1K2R A;  3E6N A;  1M9Q A;  4D3V A;  5FVS A;  4FVZ A;  1ZVL A;  3N6D A;  5FVP A;  3NLJ A;  5FVY A;  4CX1 A;  4JSE A;  4UGU A;  5G69 A;  3N69 A;  4D3M A;  1DMJ A;  4CWW A;  4CTP A;  2NOS A;  4KCQ A;  4CTY A;  4D7I A;  3UFW A;  4D3T A;  5G6F A;  3JWS A;  3RQM A;  4CX5 A;  3DQT A;  1LZZ A;  1D1Y A;  4UH5 A;  5FVO A;  4D32 A;  4UGX A;  4LUW A;  1ED4 A;  4UHA A;  4UGG A;  3E6O A;  4UQR A;  1ED6 A;  5G6G A;  2HX4 A;  3NLT A;  4D3I A;  4CU0 A;  3JWZ A;  3EAI A;  4D7H A;  3RQL A;  4CX0 A;  1QW6 A;  1P6J A;  4LWA A;  4UGT A;  3RQN A;  4NSE A;  4KCN A;  3JWU A;  3N2R A;  3E7S A;  1FOP A;  4K5G A;  5G6B A;  3N5W A;  1DWW A;  5ADN A;  4CAM A;  4UPS A;  3HSN A;  3N68 A;  2HX2 A;  3E7S B;  3HSP A;  3JT7 A;  3N6B A;  3NW2 A;  3JX6 A;  4D30 A;  4UQS A;  5ADC A;  4C3A A;  4UGK A;  3NLR A;  4D31 A;  3UFP A;  4KCH A;  3SVP A;  4UGE A;  4UPM A;  3RQK A;  1P6L A;  1NOD A;  4UH6 A;  2FC1 A;  3NLU A;  4UG7 A;  5G6P A;  1K2U A;  3E7I A;  5G65 A;  4JS9 A;  2G6L A;  5G6L A;  3NM0 A;  1D1W A;  4CWX A;  1M7V A;  4IMW A;  4CUM A;  1N2N A;  5FVZ A;  1ZVI A;  4CVG A;  3NLG A;  1M9T A;  1M9J A;  4D2Z A;  3JT5 A;  4UG8 A;  4JSL A;  1FOO A;  4UGS A;  1ED5 A;  4IMX A;  4D7O A;  3NLW A;  1D0C A;  4KCO A;  4FW0 A;  3JX0 A;  3NLP A;  5G6H A;  2G6I A;  3JT4 A;  3EAH A;  1NOS A;  3NLD A;  3N5P A;  3NNZ A;  4K5K A;  4V3Z A;  4UPQ A;  3UFT A;  3PNF A;  1OM5 A;  4NOS A;  5G6M A;  4D1O A;  2NSE A;  1P6N A;  5FJ2 A;  1K2T A;  1M8E A;  3NLH A;  1M9K A;  4V3U A;  5AGL A;  3N5T A;  3JT8 A;  3JX4 A;  4CX6 A;  5G68 A;  5ADI A;  4CU1 A;  4JSM A;  2FLQ A;  3TYL A;  4CTR A;  4KCR A;  4D3B A;  4K5F A;  1VAF A;  4CAP A;  4UPT A;  1FOL A;  1ZZR A;  4CAR A;  3E7T A;  2ORO A;  4UGH A;  4KCP A;  1NSI A;  4CX4 A;  3JWW A;  1FOJ A;  3B3P A;  4UH2 A;  4CDT A;  1VAG A;  4UGI A;  7NSE A;  4K5D A;  4D33 A;  3JTA A;  2AN0 A;  3N5Z A;  4K5J A;  3JX3 A;  3N5V A;  1MMW A;  4UH4 A;  4JSF A;  2NOD A;  4UGQ A;  3B3M A;  2NSI A;  1NOC A;  3DQS A;  3N61 A;  3N65 A;  4UH1 A;  2ORP A;  1D1V A;  4UCH A;  4UG5 A;  5FVU A;  4CX3 A;  4D3N A;  1M8D A;  3NLZ A;  3JT6 A;  3NLV A;  1QW5 A;  5ADD A;  3PNH A;  5FVW A;  3UFR A;  3NLO A;  5ADF A;  4UPP A;  3Q99 A;  4CTX A;  5G0P A;  1RS6 A;  3JX5 A;  3N66 A;  3DQR A;  4KCK A;  4CFT A;  4D1N A;  3E65 A;  4CFT B;  5ADB A;  5G6O A;  4UGM A;  3N6G A;  4UG9 A;  3NLN A;  5AD8 A;  1QWC A;  5FVV A;  4GQE A;  3UFS A;  3N5S A;  5FW0 A;  4KCM A;  6NSE A;  4D3J A;  5FVX A;  3JX1 A;  3NLQ A;  5FJ3 A;  4UGD A;  4D3A A;  1QW4 A;  4UGB A;  5G66 A;  4UH9 A;  1P6H A;  4UGW A;  4UGY A;  1P6I A;  3NLI A;  1P6K A;  4D1P A;  3TYO A;  3N6A A;  1JWK A;  4KCS A;  1DMK A;  3N60 A;  5G6A A;  4CTQ A;  4UPO A;  5G0O A;  4KCI A;  4JSI A;  1DMI A;  2ORR A;  2G6N A;  3RQJ A;  4EUX A;  1D1X A;  4CX2 A;  2G6O A;  2Y37 A;  4V3Y A;  4V3X A;  2G6J A;  3NLK A;  4D38 A;  5G6E A;  4UH8 A;  3UFO A;  1Q2O A;  5AD9 A;  2BHJ A;  4UGL A;  4CU1 B;  2AMO A;  3E6T A;  5AD4 A;  3N5Y A;  1D0O A;  5AGM A;  5G6N A;  4CTU A;  3N6F A;  4JSJ A;  4UH3 A;  5G6C A;  4D34 A;  1ZZU A;  2ORQ A;  3JT9 A;  3EBF A;  3FC5 A;  4UGZ A;  4D36 A;  4D3U A;  4UPN A;  1DWX A;  1M00 A;  3JWY A;  1M8H A;  1RS7 A;  5FVQ A;  5G6D A;  4D39 A;  3NOD A;  4D35 A;  1MMV A;  3UFQ A;  5ADL A;  3N62 A;  3N67 A;  5FVR A;  1FOI A;  2ORT A;  1QOM A;  2G6M A;  1MJT A;  5AGO A;  4D2Y A;  5AGK A;  4D37 A;  1ZZQ A;  3NLF A;  5ADJ A;  4CTV A;  3N5Q A;  4UGF A;  1M9M A;  3NLY A;  3NSE A;  4JSG A;  4UGR A;  1K2S A;  3JWX A;  4KCL A;  9NSE A;  3EJ8 A;  3N63 A;  1OM4 A;  3B3N A;  3DWJ A;  3B3O A;  5G6I A;  4UGV A;  1R35 A;  2G6H A;  3E6L A;  4K5E A;  3JX2 A;  3UFU A;  4CWZ A;  2HX3 A;  3E68 A;  4V3V A;  3NOS A;  5AGN A;  3Q9A A;  4K5I A;  1LZX A;  4JSH A;  4LUX A;  5G6K A;  3HSO A;  3EBD A;  2AN2 A;  3JWT A;  4C39 A;  3RQP A;  4CWV A;  4UGO A;  4FVW A;  4CAN A;  4D7J A;  1DF1 A;  1DM8 A;  4UH0 A;  3E7G A;  1M9R A;  4CUN A;  2FC2 A;  4D3K A;  3JT3 A;  3N64 A;  2G6K A;  4V3W A;  5G0N A;  3NLE A;  2FBZ X;  5G67 A;  4JSK A;  1M7Z A;  4UGJ A;  3JWV A;  1I83 A;  3E7M A;  5G6J A;  4CTZ A;  5AD5 A;  5ADE A;  1DM7 A;  3TYM A;  3TYN A;  2ORS A;  4CAQ A;  3E67 A;  4IMU A;  3PNE A;  8NSE A; 
#chains in the Genus database with same CATH homology
 4CTW A;  4UPR A;  4K5H A;  4UGC A;  3PNG A;  1JWJ A;  3SVQ A;  3RQO A;  3NLX A;  5FVT A;  3UFV A;  5ADA A;  4CAO A;  4UG6 A;  4IMS A;  5AD7 A;  4KCJ A;  1RS8 A;  5NSE A;  5AD6 A;  1M8I A;  4FVY A;  1RS9 A;  5ADM A;  1ZZS A;  4UGN A;  5ADK A;  4CX7 A;  4LWB A;  1NSE A;  4UH7 A;  3NQS A;  3N6C A;  4FVX A;  1ZZT A;  5G6Q A;  4CUL A;  4D3O A;  1DM6 A;  3N6E A;  4CTT A;  4UGP A;  4IMT A;  1DWV A;  3N5R A;  3NNY A;  4UGA A;  1DD7 A;  5AGP A;  4CWY A;  1P6M A;  3N5X A;  3NLM A;  5ADG A;  1K2R A;  3E6N A;  1M9Q A;  4D3V A;  5FVS A;  4FVZ A;  1ZVL A;  3N6D A;  5FVP A;  3NLJ A;  5FVY A;  4CX1 A;  4JSE A;  4UGU A;  5G69 A;  3N69 A;  4D3M A;  1DMJ A;  4CWW A;  4CTP A;  2NOS A;  4KCQ A;  4CTY A;  4D7I A;  3UFW A;  4D3T A;  5G6F A;  3JWS A;  3RQM A;  4CX5 A;  3DQT A;  1LZZ A;  1D1Y A;  4UH5 A;  5FVO A;  4D32 A;  4UGX A;  4LUW A;  1ED4 A;  4UHA A;  4UGG A;  3E6O A;  4UQR A;  1ED6 A;  5G6G A;  2HX4 A;  3NLT A;  4D3I A;  4CU0 A;  3JWZ A;  3EAI A;  4D7H A;  3RQL A;  4CX0 A;  1QW6 A;  1P6J A;  4LWA A;  4UGT A;  3RQN A;  4NSE A;  4KCN A;  3JWU A;  3N2R A;  3E7S A;  1FOP A;  4K5G A;  5G6B A;  3N5W A;  1DWW A;  5ADN A;  4CAM A;  4UPS A;  3HSN A;  3N68 A;  2HX2 A;  3E7S B;  3HSP A;  3JT7 A;  3N6B A;  3NW2 A;  3JX6 A;  4D30 A;  4UQS A;  5ADC A;  4C3A A;  4UGK A;  3NLR A;  4D31 A;  3UFP A;  4KCH A;  3SVP A;  4UGE A;  4UPM A;  3RQK A;  1P6L A;  1NOD A;  4UH6 A;  2FC1 A;  3NLU A;  4UG7 A;  5G6P A;  1K2U A;  3E7I A;  5G65 A;  4JS9 A;  2G6L A;  5G6L A;  3NM0 A;  1D1W A;  4CWX A;  1M7V A;  4IMW A;  4CUM A;  1N2N A;  5FVZ A;  1ZVI A;  4CVG A;  3NLG A;  1M9T A;  1M9J A;  4D2Z A;  3JT5 A;  4UG8 A;  4JSL A;  1FOO A;  4UGS A;  1ED5 A;  4IMX A;  4D7O A;  3NLW A;  1D0C A;  4KCO A;  4FW0 A;  3JX0 A;  3NLP A;  5G6H A;  2G6I A;  3JT4 A;  3EAH A;  1NOS A;  3NLD A;  3N5P A;  3NNZ A;  4K5K A;  4V3Z A;  4UPQ A;  3UFT A;  3PNF A;  1OM5 A;  4NOS A;  5G6M A;  4D1O A;  2NSE A;  1P6N A;  5FJ2 A;  1K2T A;  1M8E A;  3NLH A;  1M9K A;  4V3U A;  5AGL A;  3N5T A;  3JT8 A;  3JX4 A;  4CX6 A;  5G68 A;  5ADI A;  4CU1 A;  4JSM A;  2FLQ A;  3TYL A;  4CTR A;  4KCR A;  4D3B A;  4K5F A;  1VAF A;  4CAP A;  4UPT A;  1FOL A;  1ZZR A;  4CAR A;  3E7T A;  2ORO A;  4UGH A;  4KCP A;  1NSI A;  4CX4 A;  3JWW A;  1FOJ A;  3B3P A;  4UH2 A;  4CDT A;  1VAG A;  4UGI A;  7NSE A;  4K5D A;  4D33 A;  3JTA A;  2AN0 A;  3N5Z A;  4K5J A;  3JX3 A;  3N5V A;  1MMW A;  4UH4 A;  4JSF A;  2NOD A;  4UGQ A;  3B3M A;  2NSI A;  1NOC A;  3DQS A;  3N61 A;  3N65 A;  4UH1 A;  2ORP A;  1D1V A;  4UCH A;  4UG5 A;  5FVU A;  4CX3 A;  4D3N A;  1M8D A;  3NLZ A;  3JT6 A;  3NLV A;  1QW5 A;  5ADD A;  3PNH A;  5FVW A;  3UFR A;  3NLO A;  5ADF A;  4UPP A;  3Q99 A;  4CTX A;  5G0P A;  1RS6 A;  3JX5 A;  3N66 A;  3DQR A;  4KCK A;  4CFT A;  4D1N A;  3E65 A;  4CFT B;  5ADB A;  5G6O A;  4UGM A;  3N6G A;  4UG9 A;  3NLN A;  5AD8 A;  1QWC A;  5FVV A;  4GQE A;  3UFS A;  3N5S A;  5FW0 A;  4KCM A;  6NSE A;  4D3J A;  5FVX A;  3JX1 A;  3NLQ A;  5FJ3 A;  4UGD A;  4D3A A;  1QW4 A;  4UGB A;  5G66 A;  4UH9 A;  1P6H A;  4UGW A;  4UGY A;  1P6I A;  3NLI A;  1P6K A;  4D1P A;  3TYO A;  3N6A A;  1JWK A;  4KCS A;  1DMK A;  3N60 A;  5G6A A;  4CTQ A;  4UPO A;  5G0O A;  4KCI A;  4JSI A;  1DMI A;  2ORR A;  2G6N A;  3RQJ A;  4EUX A;  1D1X A;  4CX2 A;  2G6O A;  2Y37 A;  4V3Y A;  4V3X A;  2G6J A;  3NLK A;  4D38 A;  5G6E A;  4UH8 A;  3UFO A;  1Q2O A;  5AD9 A;  2BHJ A;  4UGL A;  4CU1 B;  2AMO A;  3E6T A;  5AD4 A;  3N5Y A;  1D0O A;  5AGM A;  5G6N A;  4CTU A;  3N6F A;  4JSJ A;  4UH3 A;  5G6C A;  4D34 A;  1ZZU A;  2ORQ A;  3JT9 A;  3EBF A;  3FC5 A;  4UGZ A;  4D36 A;  4D3U A;  4UPN A;  1DWX A;  1M00 A;  3JWY A;  1M8H A;  1RS7 A;  5FVQ A;  5G6D A;  4D39 A;  3NOD A;  4D35 A;  1MMV A;  3UFQ A;  5ADL A;  3N62 A;  3N67 A;  5FVR A;  1FOI A;  2ORT A;  1QOM A;  2G6M A;  1MJT A;  5AGO A;  4D2Y A;  5AGK A;  4D37 A;  1ZZQ A;  3NLF A;  5ADJ A;  4CTV A;  3N5Q A;  4UGF A;  1M9M A;  3NLY A;  3NSE A;  4JSG A;  4UGR A;  1K2S A;  3JWX A;  4KCL A;  9NSE A;  3EJ8 A;  3N63 A;  1OM4 A;  3B3N A;  3DWJ A;  3B3O A;  5G6I A;  4UGV A;  1R35 A;  2G6H A;  3E6L A;  4K5E A;  3JX2 A;  3UFU A;  4CWZ A;  2HX3 A;  3E68 A;  4V3V A;  3NOS A;  5AGN A;  3Q9A A;  4K5I A;  1LZX A;  4JSH A;  4LUX A;  5G6K A;  3HSO A;  3EBD A;  2AN2 A;  3JWT A;  4C39 A;  3RQP A;  4CWV A;  4UGO A;  4FVW A;  4CAN A;  4D7J A;  1DF1 A;  1DM8 A;  4UH0 A;  3E7G A;  1M9R A;  4CUN A;  2FC2 A;  4D3K A;  3JT3 A;  3N64 A;  2G6K A;  4V3W A;  5G0N A;  3NLE A;  2FBZ X;  5G67 A;  4JSK A;  1M7Z A;  4UGJ A;  3JWV A;  1I83 A;  3E7M A;  5G6J A;  4CTZ A;  5AD5 A;  5ADE A;  1DM7 A;  3TYM A;  3TYN A;  2ORS A;  4CAQ A;  3E67 A;  4IMU A;  3PNE A;  8NSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...