4D3UA

Structure of bacillus subtilis nitric oxide synthase h128s in complex with n-{3-[(1s)-2-(3-{(z)-[amino(thiophen-2-yl)methylidene]amino}phenoxy)-1-hydroxyethyl]phenyl}thiophene-2-carboximidamide
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
362
structure length
362
Chain Sequence
EEKEILWNEAKAFIAACYQELGKAAEVKDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPPEEKGEKQVEIWNSQLIRYAGYESDGERIGDPASCSLTAACEELGWRGERTDFDLLPLIFRMKGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQAEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDKPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design of Bacterial Nitric Oxide Synthase Inhibitors.
pubmed doi rcsb
molecule keywords NITRIC OXIDE SYNTHASE OXYGENASE
molecule tags Oxidoreductase
source organism Bacillus subtilis subsp. subtilis str. 168
total genus 128
structure length 362
sequence length 362
ec nomenclature ec 1.14.14.47: Nitric-oxide synthase (flavodoxin).
pdb deposition date 2014-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02898 NO_synthase Nitric oxide synthase, oxygenase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.340.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase; Chain A, domain 1 Nitric Oxide Synthase; Chain A, domain 1 4d3uA01
3.90.440.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase;Heme Domain; Chain A, domain 2 Nitric Oxide Synthase;Heme Domain;Chain A domain 2 4d3uA02
3.90.1230.10 Alpha Beta Alpha-Beta Complex Bovine Endothelial Nitric Oxide Synthase Heme Domain; Chain: A,domain 3 Nitric Oxide Synthase; Chain A, domain 3 4d3uA03
3N6BA 4V3UA 3RQNA 1I83A 3SVPA 4K5KA 3E7TA 1DM7A 4D36A 4D2YA 4UGMA 5AGLA 3N61A 3NLYA 2FC2A 4KCNA 4CX0A 3RQJA 4D3UA 1P6IA 3HSNA 4UGRA 4CWXA 4KCIA 3JT9A 3JWWA 3UFQA 5ADAA 4UGOA 1M8EA 5G6MA 4KCLA 4CTWA 4CU1A 5G6IA 3NLOA 4UH0A 2ORRA 4UGEA 4CFTA 4CTQA 3UFWA 1D0OA 4UCHA 5AGPA 4KCHA 5FVRA 5G69A 5G6QA 3JT5A 4UH8A 1MJTA 3NLWA 3N5VA 1FOIA 4UH3A 3N63A 5G6PA 3EBFA 3JTAA 3NLJA 4UGFA 1P6NA 1OM4A 3B3NA 3NNYA 1DMIA 3E6TA 4UG7A 5G68A 3DQSA 3HSPA 5FW0A 1ZZQA 4D7IA 5AD7A 3JT7A 4FVXA 4CANA 4UGQA 2G6OA 4K5FA 3Q99A 4CX7A 4CTXA 3FC5A 5AD4A 1M8IA 1DWVA 8NSEA 4JSMA 4C3AA 3EJ8A 1NOCA 4CX1A 4CU1B 4LWAA 5FVZA 3N5YA 3DWJA 3E7GA 4UH6A 5G6JA 2ORTA 4JSGA 3RQPA 4UGVA 3EAIA 4CARA 5ADCA 3N62A 5G6EA 1RS7A 5ADFA 3UFRA 3NLRA 4UHAA 3N5TA 5AD8A 1FOPA 3NLKA 3Q9AA 3N5PA 4D3JA 4UGZA 5G0NA 4JS9A 4UGAA 3JWXA 3NLPA 3E68A 4V3WA 3JT6A 4UH1A 5G65A 2Y37A 3HSOA 2FBZX 3NOSA 1RS8A 5FVTA 4UG5A 5ADNA 2HX3A 1ZZRA 5FVXA 3NLEA 4D7JA 3N6AA 3B3OA 3JWVA 3N5SA 3N68A 5ADMA 4UGBA 3E6OA 5AGNA 2AMOA 3RQLA 4CDTA 3N6EA 5ADBA 1ZZSA 4UGTA 4CTTA 4CAOA 3EBDA 4UPMA 1FOOA 3NLQA 1OM5A 4CTYA 3E7SA 4KCQA 4V3XA 2ORPA 4D7HA 4UG8A 4C39A 4CTPA 2AN0A 3JX0A 3JT3A 2NSIA 1D1WA 1NOSA 1M9JA 4CAQA 5G6LA 3NM0A 3N5QA 3E7IA 4UGYA 5G0OA 4LWBA 3SVQA 3UFPA 4UGUA 4UPOA 5AD6A 1D0CA 5AGKA 3JT8A 1M7VA 4JSIA 1MMVA 5G6HA 7NSEA 2NOSA 5FJ3A 1P6KA 3NSEA 3JWTA 4K5DA 4D38A 4JSJA 4D3OA 1M9TA 4LUWA 3NNZA 2G6HA 5FVOA 4UPRA 4D3KA 5G6DA 3N6FA 4D1NA 5NSEA 4K5EA 4K5JA 1DWWA 1M8HA 3NLHA 4CX3A 3UFUA 4IMTA 5ADEA 5FVUA 4D34A 1DMJA 3N60A 6NSEA 4CULA 1D1YA 4CTZA 4D3NA 4CFTB 3N64A 3E65A 1K2RA 1DWXA 1QW6A 3NW2A 4NOSA 1RS6A 5G6FA 1N2NA 4D35A 4UGLA 5ADIA 5FVQA 5G66A 4IMSA 4UPSA 1M8DA 4UGCA 1Q2OA 4D2ZA 5AGMA 3PNEA 1R35A 3NLNA 1M9QA 5FVWA 4CWVA 4UPQA 4CU0A 3N65A 4UQRA 5G6OA 3UFVA 4CVGA 3EAHA 4KCOA 4K5IA 4UGNA 3JX5A 4CX5A 4KCPA 5G6BA 1ED4A 3N2RA 1ZZTA 5ADGA 1M9RA 4UGIA 4UPPA 4CUNA 1P6MA 3JWUA 3E6LA 4CWYA 4UH5A 1M7ZA 2G6JA 4D7OA 4UGXA 5FJ2A 4UGHA 5FVPA 1NSIA 2HX2A 1DM6A 3N6CA 2G6IA 3NLXA 4CAPA 5AD9A 5ADLA 4KCMA 3UFOA 3JX6A 3N5WA 3PNGA 4D39A 3N6DA 4CWZA 5AD5A 4KCSA 4V3VA 4CWWA 4FVZA 1LZZA 4D3BA 2G6NA 2ORSA 5AGOA 1ZVIA 3DQTA 4UGSA 3NLTA 4D31A 1NSEA 3N69A 5ADJA 1LZXA 4D30A 4KCJA 3B3PA 3NLUA 1MMWA 3PNHA 4UG6A 4UH7A 3JWZA 2BHJA 4D3TA 1M9MA 4K5HA 1RS9A 4IMXA 3JX4A 4UGJA 1DMKA 2OROA 1FOLA 4UQSA 5G6CA 3TYOA 4CX6A 4UH2A 3JX1A 4D3AA 3NLFA 4FW0A 3TYMA 3E7SB 1ED5A 3N5ZA 2ORQA 3NLGA 5G67A 3RQKA 2G6MA 3NLDA 1JWJA 5G6AA 4JSHA 4UPNA 4K5GA 3E7MA 2NSEA 1D1VA 4KCKA 4NSEA 4FVYA 4UGPA 3RQMA 4FVWA 1K2UA 3JT4A 4CAMA 1FOJA 2G6LA 3NLMA 5G6GA 3NQSA 3DQRA 3RQOA 1ED6A 4UGKA 1D1XA 4UH4A 1QW4A 1P6LA 4JSKA 4CX2A 5ADDA 4D3IA 1DF1A 1K2TA 4D37A 4KCRA 4UG9A 3NODA 3TYLA 4GQEA 3PNFA 1QOMA 3N5XA 4JSEA 5G0PA 4D33A 3TYNA 3NLIA 1ZVLA 5FVVA 4D3MA 1QWCA 2FC1A 2FLQA 3B3MA 1P6HA 5G6NA 5ADKA 3N6GA 1NODA 3E67A 4JSLA 4V3YA 4IMWA 2NODA 3NLVA 4JSFA 4CX4A 4UH9A 5FVYA 1K2SA 4CUMA 1DD7A 3N66A 1DM8A 4CTVA 3JWYA 4LUXA 4D1PA 1VAGA 1ZZUA 3UFTA 1M9KA 5FVSA 5G6KA 1P6JA 3N5RA 3N67A 3JX3A 4UGGA 4CTRA 1JWKA 3NLZA 4UGDA 4D1OA 1M00A 4EUXA 4D32A 4CTUA 9NSEA 3JWSA 4UPTA 4UGWA 4V3ZA 1QW5A 3UFSA 2AN2A 2G6KA 1VAFA 3E6NA 3JX2A 4D3VA 4IMUA 2HX4A
chains in the Genus database with same CATH superfamily
3N6BA 4V3UA 3RQNA 1I83A 3SVPA 4K5KA 3E7TA 1DM7A 4D36A 4D2YA 4UGMA 5AGLA 3N61A 3NLYA 2FC2A 4KCNA 4CX0A 3RQJA 4D3UA 1P6IA 3HSNA 4UGRA 4CWXA 4KCIA 3JT9A 3JWWA 3UFQA 5ADAA 4UGOA 1M8EA 5G6MA 4KCLA 4CTWA 4CU1A 5G6IA 3NLOA 4UH0A 2ORRA 4UGEA 4CFTA 4CTQA 3UFWA 1D0OA 4UCHA 5AGPA 4KCHA 5FVRA 5G69A 5G6QA 3JT5A 4UH8A 1MJTA 3NLWA 3N5VA 1FOIA 4UH3A 3N63A 5G6PA 3EBFA 3JTAA 3NLJA 4UGFA 1P6NA 1OM4A 3B3NA 3NNYA 1DMIA 3E6TA 4UG7A 5G68A 3DQSA 3HSPA 5FW0A 1ZZQA 4D7IA 5AD7A 3JT7A 4FVXA 4CANA 4UGQA 2G6OA 4K5FA 3Q99A 4CX7A 4CTXA 3FC5A 5AD4A 1M8IA 1DWVA 8NSEA 4JSMA 4C3AA 3EJ8A 1NOCA 4CX1A 4CU1B 4LWAA 5FVZA 3N5YA 3DWJA 3E7GA 4UH6A 5G6JA 2ORTA 4JSGA 3RQPA 4UGVA 3EAIA 4CARA 5ADCA 3N62A 5G6EA 1RS7A 5ADFA 3UFRA 3NLRA 4UHAA 3N5TA 5AD8A 1FOPA 3NLKA 3Q9AA 3N5PA 4D3JA 4UGZA 5G0NA 4JS9A 4UGAA 3JWXA 3NLPA 3E68A 4V3WA 3JT6A 4UH1A 5G65A 2Y37A 3HSOA 2FBZX 3NOSA 1RS8A 5FVTA 4UG5A 5ADNA 2HX3A 1ZZRA 5FVXA 3NLEA 4D7JA 3N6AA 3B3OA 3JWVA 3N5SA 3N68A 5ADMA 4UGBA 3E6OA 5AGNA 2AMOA 3RQLA 4CDTA 3N6EA 5ADBA 1ZZSA 4UGTA 4CTTA 4CAOA 3EBDA 4UPMA 1FOOA 3NLQA 1OM5A 4CTYA 3E7SA 4KCQA 4V3XA 2ORPA 4D7HA 4UG8A 4C39A 4CTPA 2AN0A 3JX0A 3JT3A 2NSIA 1D1WA 1NOSA 1M9JA 4CAQA 5G6LA 3NM0A 3N5QA 3E7IA 4UGYA 5G0OA 4LWBA 3SVQA 3UFPA 4UGUA 4UPOA 5AD6A 1D0CA 5AGKA 3JT8A 1M7VA 4JSIA 1MMVA 5G6HA 7NSEA 2NOSA 5FJ3A 1P6KA 3NSEA 3JWTA 4K5DA 4D38A 4JSJA 4D3OA 1M9TA 4LUWA 3NNZA 2G6HA 5FVOA 4UPRA 4D3KA 5G6DA 3N6FA 4D1NA 5NSEA 4K5EA 4K5JA 1DWWA 1M8HA 3NLHA 4CX3A 3UFUA 4IMTA 5ADEA 5FVUA 4D34A 1DMJA 3N60A 6NSEA 4CULA 1D1YA 4CTZA 4D3NA 4CFTB 3N64A 3E65A 1K2RA 1DWXA 1QW6A 3NW2A 4NOSA 1RS6A 5G6FA 1N2NA 4D35A 4UGLA 5ADIA 5FVQA 5G66A 4IMSA 4UPSA 1M8DA 4UGCA 1Q2OA 4D2ZA 5AGMA 3PNEA 1R35A 3NLNA 1M9QA 5FVWA 4CWVA 4UPQA 4CU0A 3N65A 4UQRA 5G6OA 3UFVA 4CVGA 3EAHA 4KCOA 4K5IA 4UGNA 3JX5A 4CX5A 4KCPA 5G6BA 1ED4A 3N2RA 1ZZTA 5ADGA 1M9RA 4UGIA 4UPPA 4CUNA 1P6MA 3JWUA 3E6LA 4CWYA 4UH5A 1M7ZA 2G6JA 4D7OA 4UGXA 5FJ2A 4UGHA 5FVPA 1NSIA 2HX2A 1DM6A 3N6CA 2G6IA 3NLXA 4CAPA 5AD9A 5ADLA 4KCMA 3UFOA 3JX6A 3N5WA 3PNGA 4D39A 3N6DA 4CWZA 5AD5A 4KCSA 4V3VA 4CWWA 4FVZA 1LZZA 4D3BA 2G6NA 2ORSA 5AGOA 1ZVIA 3DQTA 4UGSA 3NLTA 4D31A 1NSEA 3N69A 5ADJA 1LZXA 4D30A 4KCJA 3B3PA 3NLUA 1MMWA 3PNHA 4UG6A 4UH7A 3JWZA 2BHJA 4D3TA 1M9MA 4K5HA 1RS9A 4IMXA 3JX4A 4UGJA 1DMKA 2OROA 1FOLA 4UQSA 5G6CA 3TYOA 4CX6A 4UH2A 3JX1A 4D3AA 3NLFA 4FW0A 3TYMA 3E7SB 1ED5A 3N5ZA 2ORQA 3NLGA 5G67A 3RQKA 2G6MA 3NLDA 1JWJA 5G6AA 4JSHA 4UPNA 4K5GA 3E7MA 2NSEA 1D1VA 4KCKA 4NSEA 4FVYA 4UGPA 3RQMA 4FVWA 1K2UA 3JT4A 4CAMA 1FOJA 2G6LA 3NLMA 5G6GA 3NQSA 3DQRA 3RQOA 1ED6A 4UGKA 1D1XA 4UH4A 1QW4A 1P6LA 4JSKA 4CX2A 5ADDA 4D3IA 1DF1A 1K2TA 4D37A 4KCRA 4UG9A 3NODA 3TYLA 4GQEA 3PNFA 1QOMA 3N5XA 4JSEA 5G0PA 4D33A 3TYNA 3NLIA 1ZVLA 5FVVA 4D3MA 1QWCA 2FC1A 2FLQA 3B3MA 1P6HA 5G6NA 5ADKA 3N6GA 1NODA 3E67A 4JSLA 4V3YA 4IMWA 2NODA 3NLVA 4JSFA 4CX4A 4UH9A 5FVYA 1K2SA 4CUMA 1DD7A 3N66A 1DM8A 4CTVA 3JWYA 4LUXA 4D1PA 1VAGA 1ZZUA 3UFTA 1M9KA 5FVSA 5G6KA 1P6JA 3N5RA 3N67A 3JX3A 4UGGA 4CTRA 1JWKA 3NLZA 4UGDA 4D1OA 1M00A 4EUXA 4D32A 4CTUA 9NSEA 3JWSA 4UPTA 4UGWA 4V3ZA 1QW5A 3UFSA 2AN2A 2G6KA 1VAFA 3E6NA 3JX2A 4D3VA 4IMUA 2HX4A
chains in the Genus database with same CATH topology
3N6BA 4V3UA 3RQNA 1I83A 3SVPA 4K5KA 3E7TA 1DM7A 4D36A 4D2YA 4UGMA 5AGLA 3N61A 3NLYA 2FC2A 4KCNA 4CX0A 3RQJA 4D3UA 1P6IA 3HSNA 4UGRA 4CWXA 4KCIA 3JT9A 3JWWA 3UFQA 5ADAA 4UGOA 1M8EA 5G6MA 4KCLA 4CTWA 4CU1A 5G6IA 3NLOA 4UH0A 2ORRA 4UGEA 4CFTA 4CTQA 3UFWA 1D0OA 4UCHA 5AGPA 4KCHA 5FVRA 5G69A 5G6QA 3JT5A 4UH8A 1MJTA 3NLWA 3N5VA 1FOIA 4UH3A 3N63A 5G6PA 3EBFA 3JTAA 3NLJA 4UGFA 1P6NA 1OM4A 3B3NA 3NNYA 1DMIA 3E6TA 4UG7A 5G68A 3DQSA 3HSPA 5FW0A 1ZZQA 4D7IA 5AD7A 3JT7A 4FVXA 4CANA 4UGQA 2G6OA 4K5FA 3Q99A 4CX7A 4CTXA 3FC5A 5AD4A 1M8IA 1DWVA 8NSEA 4JSMA 4C3AA 3EJ8A 1NOCA 4CX1A 4CU1B 4LWAA 5FVZA 3N5YA 3DWJA 3E7GA 4UH6A 5G6JA 2ORTA 4JSGA 3RQPA 4UGVA 3EAIA 4CARA 5ADCA 3N62A 5G6EA 1RS7A 5ADFA 3UFRA 3NLRA 4UHAA 3N5TA 5AD8A 1FOPA 3NLKA 3Q9AA 3N5PA 4D3JA 4UGZA 5G0NA 4JS9A 4UGAA 3JWXA 3NLPA 3E68A 4V3WA 3JT6A 4UH1A 5G65A 2Y37A 3HSOA 2FBZX 3NOSA 1RS8A 5FVTA 4UG5A 5ADNA 2HX3A 1ZZRA 5FVXA 3NLEA 4D7JA 3N6AA 3B3OA 3JWVA 3N5SA 3N68A 5ADMA 4UGBA 3E6OA 5AGNA 2AMOA 3RQLA 4CDTA 3N6EA 5ADBA 1ZZSA 4UGTA 4CTTA 4CAOA 3EBDA 4UPMA 1FOOA 3NLQA 1OM5A 4CTYA 3E7SA 4KCQA 4V3XA 2ORPA 4D7HA 4UG8A 4C39A 4CTPA 2AN0A 3JX0A 3JT3A 2NSIA 1D1WA 1NOSA 1M9JA 4CAQA 5G6LA 3NM0A 3N5QA 3E7IA 4UGYA 5G0OA 4LWBA 3SVQA 3UFPA 4UGUA 4UPOA 5AD6A 1D0CA 5AGKA 3JT8A 1M7VA 4JSIA 1MMVA 5G6HA 7NSEA 2NOSA 5FJ3A 1P6KA 3NSEA 3JWTA 4K5DA 4D38A 4JSJA 4D3OA 1M9TA 4LUWA 3NNZA 2G6HA 5FVOA 4UPRA 4D3KA 5G6DA 3N6FA 4D1NA 5NSEA 4K5EA 4K5JA 1DWWA 1M8HA 3NLHA 4CX3A 3UFUA 4IMTA 5ADEA 5FVUA 4D34A 1DMJA 3N60A 6NSEA 4CULA 1D1YA 4CTZA 4D3NA 4CFTB 3N64A 3E65A 1K2RA 1DWXA 1QW6A 3NW2A 4NOSA 1RS6A 5G6FA 1N2NA 4D35A 4UGLA 5ADIA 5FVQA 5G66A 4IMSA 4UPSA 1M8DA 4UGCA 1Q2OA 4D2ZA 5AGMA 3PNEA 1R35A 3NLNA 1M9QA 5FVWA 4CWVA 4UPQA 4CU0A 3N65A 4UQRA 5G6OA 3UFVA 4CVGA 3EAHA 4KCOA 4K5IA 4UGNA 3JX5A 4CX5A 4KCPA 5G6BA 1ED4A 3N2RA 1ZZTA 5ADGA 1M9RA 4UGIA 4UPPA 4CUNA 1P6MA 3JWUA 3E6LA 4CWYA 4UH5A 1M7ZA 2G6JA 4D7OA 4UGXA 5FJ2A 4UGHA 5FVPA 1NSIA 2HX2A 1DM6A 3N6CA 2G6IA 3NLXA 4CAPA 5AD9A 5ADLA 4KCMA 3UFOA 3JX6A 3N5WA 3PNGA 4D39A 3N6DA 4CWZA 5AD5A 4KCSA 4V3VA 4CWWA 4FVZA 1LZZA 4D3BA 2G6NA 2ORSA 5AGOA 1ZVIA 3DQTA 4UGSA 3NLTA 4D31A 1NSEA 3N69A 5ADJA 1LZXA 4D30A 4KCJA 3B3PA 3NLUA 1MMWA 3PNHA 4UG6A 4UH7A 3JWZA 2BHJA 4D3TA 1M9MA 4K5HA 1RS9A 4IMXA 3JX4A 4UGJA 1DMKA 2OROA 1FOLA 4UQSA 5G6CA 3TYOA 4CX6A 4UH2A 3JX1A 4D3AA 3NLFA 4FW0A 3TYMA 3E7SB 1ED5A 3N5ZA 2ORQA 3NLGA 5G67A 3RQKA 2G6MA 3NLDA 1JWJA 5G6AA 4JSHA 4UPNA 4K5GA 3E7MA 2NSEA 1D1VA 4KCKA 4NSEA 4FVYA 4UGPA 3RQMA 4FVWA 1K2UA 3JT4A 4CAMA 1FOJA 2G6LA 3NLMA 5G6GA 3NQSA 3DQRA 3RQOA 1ED6A 4UGKA 1D1XA 4UH4A 1QW4A 1P6LA 4JSKA 4CX2A 5ADDA 4D3IA 1DF1A 1K2TA 4D37A 4KCRA 4UG9A 3NODA 3TYLA 4GQEA 3PNFA 1QOMA 3N5XA 4JSEA 5G0PA 4D33A 3TYNA 3NLIA 1ZVLA 5FVVA 4D3MA 1QWCA 2FC1A 2FLQA 3B3MA 1P6HA 5G6NA 5ADKA 3N6GA 1NODA 3E67A 4JSLA 4V3YA 4IMWA 2NODA 3NLVA 4JSFA 4CX4A 4UH9A 5FVYA 1K2SA 4CUMA 1DD7A 3N66A 1DM8A 4CTVA 3JWYA 4LUXA 4D1PA 1VAGA 1ZZUA 3UFTA 1M9KA 5FVSA 5G6KA 1P6JA 3N5RA 3N67A 3JX3A 4UGGA 4CTRA 1JWKA 3NLZA 4UGDA 4D1OA 1M00A 4EUXA 4D32A 4CTUA 9NSEA 3JWSA 4UPTA 4UGWA 4V3ZA 1QW5A 3UFSA 2AN2A 2G6KA 1VAFA 3E6NA 3JX2A 4D3VA 4IMUA 2HX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N6B A;  4V3U A;  3RQN A;  1I83 A;  3SVP A;  4K5K A;  3E7T A;  1DM7 A;  4D36 A;  4D2Y A;  4UGM A;  5AGL A;  3N61 A;  3NLY A;  2FC2 A;  4KCN A;  4CX0 A;  3RQJ A;  4D3U A;  1P6I A;  3HSN A;  4UGR A;  4CWX A;  4KCI A;  3JT9 A;  3JWW A;  3UFQ A;  5ADA A;  4UGO A;  1M8E A;  5G6M A;  4KCL A;  4CTW A;  4CU1 A;  5G6I A;  3NLO A;  4UH0 A;  2ORR A;  4UGE A;  4CFT A;  4CTQ A;  3UFW A;  1D0O A;  4UCH A;  5AGP A;  4KCH A;  5FVR A;  5G69 A;  5G6Q A;  3JT5 A;  4UH8 A;  1MJT A;  3NLW A;  3N5V A;  1FOI A;  4UH3 A;  3N63 A;  5G6P A;  3EBF A;  3JTA A;  3NLJ A;  4UGF A;  1P6N A;  1OM4 A;  3B3N A;  3NNY A;  1DMI A;  3E6T A;  4UG7 A;  5G68 A;  3DQS A;  3HSP A;  5FW0 A;  1ZZQ A;  4D7I A;  5AD7 A;  3JT7 A;  4FVX A;  4CAN A;  4UGQ A;  2G6O A;  4K5F A;  3Q99 A;  4CX7 A;  4CTX A;  3FC5 A;  5AD4 A;  1M8I A;  1DWV A;  8NSE A;  4JSM A;  4C3A A;  3EJ8 A;  1NOC A;  4CX1 A;  4CU1 B;  4LWA A;  5FVZ A;  3N5Y A;  3DWJ A;  3E7G A;  4UH6 A;  5G6J A;  2ORT A;  4JSG A;  3RQP A;  4UGV A;  3EAI A;  4CAR A;  5ADC A;  3N62 A;  5G6E A;  1RS7 A;  5ADF A;  3UFR A;  3NLR A;  4UHA A;  3N5T A;  5AD8 A;  1FOP A;  3NLK A;  3Q9A A;  3N5P A;  4D3J A;  4UGZ A;  5G0N A;  4JS9 A;  4UGA A;  3JWX A;  3NLP A;  3E68 A;  4V3W A;  3JT6 A;  4UH1 A;  5G65 A;  2Y37 A;  3HSO A;  2FBZ X;  3NOS A;  1RS8 A;  5FVT A;  4UG5 A;  5ADN A;  2HX3 A;  1ZZR A;  5FVX A;  3NLE A;  4D7J A;  3N6A A;  3B3O A;  3JWV A;  3N5S A;  3N68 A;  5ADM A;  4UGB A;  3E6O A;  5AGN A;  2AMO A;  3RQL A;  4CDT A;  3N6E A;  5ADB A;  1ZZS A;  4UGT A;  4CTT A;  4CAO A;  3EBD A;  4UPM A;  1FOO A;  3NLQ A;  1OM5 A;  4CTY A;  3E7S A;  4KCQ A;  4V3X A;  2ORP A;  4D7H A;  4UG8 A;  4C39 A;  4CTP A;  2AN0 A;  3JX0 A;  3JT3 A;  2NSI A;  1D1W A;  1NOS A;  1M9J A;  4CAQ A;  5G6L A;  3NM0 A;  3N5Q A;  3E7I A;  4UGY A;  5G0O A;  4LWB A;  3SVQ A;  3UFP A;  4UGU A;  4UPO A;  5AD6 A;  1D0C A;  5AGK A;  3JT8 A;  1M7V A;  4JSI A;  1MMV A;  5G6H A;  7NSE A;  2NOS A;  5FJ3 A;  1P6K A;  3NSE A;  3JWT A;  4K5D A;  4D38 A;  4JSJ A;  4D3O A;  1M9T A;  4LUW A;  3NNZ A;  2G6H A;  5FVO A;  4UPR A;  4D3K A;  5G6D A;  3N6F A;  4D1N A;  5NSE A;  4K5E A;  4K5J A;  1DWW A;  1M8H A;  3NLH A;  4CX3 A;  3UFU A;  4IMT A;  5ADE A;  5FVU A;  4D34 A;  1DMJ A;  3N60 A;  6NSE A;  4CUL A;  1D1Y A;  4CTZ A;  4D3N A;  4CFT B;  3N64 A;  3E65 A;  1K2R A;  1DWX A;  1QW6 A;  3NW2 A;  4NOS A;  1RS6 A;  5G6F A;  1N2N A;  4D35 A;  4UGL A;  5ADI A;  5FVQ A;  5G66 A;  4IMS A;  4UPS A;  1M8D A;  4UGC A;  1Q2O A;  4D2Z A;  5AGM A;  3PNE A;  1R35 A;  3NLN A;  1M9Q A;  5FVW A;  4CWV A;  4UPQ A;  4CU0 A;  3N65 A;  4UQR A;  5G6O A;  3UFV A;  4CVG A;  3EAH A;  4KCO A;  4K5I A;  4UGN A;  3JX5 A;  4CX5 A;  4KCP A;  5G6B A;  1ED4 A;  3N2R A;  1ZZT A;  5ADG A;  1M9R A;  4UGI A;  4UPP A;  4CUN A;  1P6M A;  3JWU A;  3E6L A;  4CWY A;  4UH5 A;  1M7Z A;  2G6J A;  4D7O A;  4UGX A;  5FJ2 A;  4UGH A;  5FVP A;  1NSI A;  2HX2 A;  1DM6 A;  3N6C A;  2G6I A;  3NLX A;  4CAP A;  5AD9 A;  5ADL A;  4KCM A;  3UFO A;  3JX6 A;  3N5W A;  3PNG A;  4D39 A;  3N6D A;  4CWZ A;  5AD5 A;  4KCS A;  4V3V A;  4CWW A;  4FVZ A;  1LZZ A;  4D3B A;  2G6N A;  2ORS A;  5AGO A;  1ZVI A;  3DQT A;  4UGS A;  3NLT A;  4D31 A;  1NSE A;  3N69 A;  5ADJ A;  1LZX A;  4D30 A;  4KCJ A;  3B3P A;  3NLU A;  1MMW A;  3PNH A;  4UG6 A;  4UH7 A;  3JWZ A;  2BHJ A;  4D3T A;  1M9M A;  4K5H A;  1RS9 A;  4IMX A;  3JX4 A;  4UGJ A;  1DMK A;  2ORO A;  1FOL A;  4UQS A;  5G6C A;  3TYO A;  4CX6 A;  4UH2 A;  3JX1 A;  4D3A A;  3NLF A;  4FW0 A;  3TYM A;  3E7S B;  1ED5 A;  3N5Z A;  2ORQ A;  3NLG A;  5G67 A;  3RQK A;  2G6M A;  3NLD A;  1JWJ A;  5G6A A;  4JSH A;  4UPN A;  4K5G A;  3E7M A;  2NSE A;  1D1V A;  4KCK A;  4NSE A;  4FVY A;  4UGP A;  3RQM A;  4FVW A;  1K2U A;  3JT4 A;  4CAM A;  1FOJ A;  2G6L A;  3NLM A;  5G6G A;  3NQS A;  3DQR A;  3RQO A;  1ED6 A;  4UGK A;  1D1X A;  4UH4 A;  1QW4 A;  1P6L A;  4JSK A;  4CX2 A;  5ADD A;  4D3I A;  1DF1 A;  1K2T A;  4D37 A;  4KCR A;  4UG9 A;  3NOD A;  3TYL A;  4GQE A;  3PNF A;  1QOM A;  3N5X A;  4JSE A;  5G0P A;  4D33 A;  3TYN A;  3NLI A;  1ZVL A;  5FVV A;  4D3M A;  1QWC A;  2FC1 A;  2FLQ A;  3B3M A;  1P6H A;  5G6N A;  5ADK A;  3N6G A;  1NOD A;  3E67 A;  4JSL A;  4V3Y A;  4IMW A;  2NOD A;  3NLV A;  4JSF A;  4CX4 A;  4UH9 A;  5FVY A;  1K2S A;  4CUM A;  1DD7 A;  3N66 A;  1DM8 A;  4CTV A;  3JWY A;  4LUX A;  4D1P A;  1VAG A;  1ZZU A;  3UFT A;  1M9K A;  5FVS A;  5G6K A;  1P6J A;  3N5R A;  3N67 A;  3JX3 A;  4UGG A;  4CTR A;  1JWK A;  3NLZ A;  4UGD A;  4D1O A;  1M00 A;  4EUX A;  4D32 A;  4CTU A;  9NSE A;  3JWS A;  4UPT A;  4UGW A;  4V3Z A;  1QW5 A;  3UFS A;  2AN2 A;  2G6K A;  1VAF A;  3E6N A;  3JX2 A;  4D3V A;  4IMU A;  2HX4 A; 
#chains in the Genus database with same CATH topology
 3N6B A;  4V3U A;  3RQN A;  1I83 A;  3SVP A;  4K5K A;  3E7T A;  1DM7 A;  4D36 A;  4D2Y A;  4UGM A;  5AGL A;  3N61 A;  3NLY A;  2FC2 A;  4KCN A;  4CX0 A;  3RQJ A;  4D3U A;  1P6I A;  3HSN A;  4UGR A;  4CWX A;  4KCI A;  3JT9 A;  3JWW A;  3UFQ A;  5ADA A;  4UGO A;  1M8E A;  5G6M A;  4KCL A;  4CTW A;  4CU1 A;  5G6I A;  3NLO A;  4UH0 A;  2ORR A;  4UGE A;  4CFT A;  4CTQ A;  3UFW A;  1D0O A;  4UCH A;  5AGP A;  4KCH A;  5FVR A;  5G69 A;  5G6Q A;  3JT5 A;  4UH8 A;  1MJT A;  3NLW A;  3N5V A;  1FOI A;  4UH3 A;  3N63 A;  5G6P A;  3EBF A;  3JTA A;  3NLJ A;  4UGF A;  1P6N A;  1OM4 A;  3B3N A;  3NNY A;  1DMI A;  3E6T A;  4UG7 A;  5G68 A;  3DQS A;  3HSP A;  5FW0 A;  1ZZQ A;  4D7I A;  5AD7 A;  3JT7 A;  4FVX A;  4CAN A;  4UGQ A;  2G6O A;  4K5F A;  3Q99 A;  4CX7 A;  4CTX A;  3FC5 A;  5AD4 A;  1M8I A;  1DWV A;  8NSE A;  4JSM A;  4C3A A;  3EJ8 A;  1NOC A;  4CX1 A;  4CU1 B;  4LWA A;  5FVZ A;  3N5Y A;  3DWJ A;  3E7G A;  4UH6 A;  5G6J A;  2ORT A;  4JSG A;  3RQP A;  4UGV A;  3EAI A;  4CAR A;  5ADC A;  3N62 A;  5G6E A;  1RS7 A;  5ADF A;  3UFR A;  3NLR A;  4UHA A;  3N5T A;  5AD8 A;  1FOP A;  3NLK A;  3Q9A A;  3N5P A;  4D3J A;  4UGZ A;  5G0N A;  4JS9 A;  4UGA A;  3JWX A;  3NLP A;  3E68 A;  4V3W A;  3JT6 A;  4UH1 A;  5G65 A;  2Y37 A;  3HSO A;  2FBZ X;  3NOS A;  1RS8 A;  5FVT A;  4UG5 A;  5ADN A;  2HX3 A;  1ZZR A;  5FVX A;  3NLE A;  4D7J A;  3N6A A;  3B3O A;  3JWV A;  3N5S A;  3N68 A;  5ADM A;  4UGB A;  3E6O A;  5AGN A;  2AMO A;  3RQL A;  4CDT A;  3N6E A;  5ADB A;  1ZZS A;  4UGT A;  4CTT A;  4CAO A;  3EBD A;  4UPM A;  1FOO A;  3NLQ A;  1OM5 A;  4CTY A;  3E7S A;  4KCQ A;  4V3X A;  2ORP A;  4D7H A;  4UG8 A;  4C39 A;  4CTP A;  2AN0 A;  3JX0 A;  3JT3 A;  2NSI A;  1D1W A;  1NOS A;  1M9J A;  4CAQ A;  5G6L A;  3NM0 A;  3N5Q A;  3E7I A;  4UGY A;  5G0O A;  4LWB A;  3SVQ A;  3UFP A;  4UGU A;  4UPO A;  5AD6 A;  1D0C A;  5AGK A;  3JT8 A;  1M7V A;  4JSI A;  1MMV A;  5G6H A;  7NSE A;  2NOS A;  5FJ3 A;  1P6K A;  3NSE A;  3JWT A;  4K5D A;  4D38 A;  4JSJ A;  4D3O A;  1M9T A;  4LUW A;  3NNZ A;  2G6H A;  5FVO A;  4UPR A;  4D3K A;  5G6D A;  3N6F A;  4D1N A;  5NSE A;  4K5E A;  4K5J A;  1DWW A;  1M8H A;  3NLH A;  4CX3 A;  3UFU A;  4IMT A;  5ADE A;  5FVU A;  4D34 A;  1DMJ A;  3N60 A;  6NSE A;  4CUL A;  1D1Y A;  4CTZ A;  4D3N A;  4CFT B;  3N64 A;  3E65 A;  1K2R A;  1DWX A;  1QW6 A;  3NW2 A;  4NOS A;  1RS6 A;  5G6F A;  1N2N A;  4D35 A;  4UGL A;  5ADI A;  5FVQ A;  5G66 A;  4IMS A;  4UPS A;  1M8D A;  4UGC A;  1Q2O A;  4D2Z A;  5AGM A;  3PNE A;  1R35 A;  3NLN A;  1M9Q A;  5FVW A;  4CWV A;  4UPQ A;  4CU0 A;  3N65 A;  4UQR A;  5G6O A;  3UFV A;  4CVG A;  3EAH A;  4KCO A;  4K5I A;  4UGN A;  3JX5 A;  4CX5 A;  4KCP A;  5G6B A;  1ED4 A;  3N2R A;  1ZZT A;  5ADG A;  1M9R A;  4UGI A;  4UPP A;  4CUN A;  1P6M A;  3JWU A;  3E6L A;  4CWY A;  4UH5 A;  1M7Z A;  2G6J A;  4D7O A;  4UGX A;  5FJ2 A;  4UGH A;  5FVP A;  1NSI A;  2HX2 A;  1DM6 A;  3N6C A;  2G6I A;  3NLX A;  4CAP A;  5AD9 A;  5ADL A;  4KCM A;  3UFO A;  3JX6 A;  3N5W A;  3PNG A;  4D39 A;  3N6D A;  4CWZ A;  5AD5 A;  4KCS A;  4V3V A;  4CWW A;  4FVZ A;  1LZZ A;  4D3B A;  2G6N A;  2ORS A;  5AGO A;  1ZVI A;  3DQT A;  4UGS A;  3NLT A;  4D31 A;  1NSE A;  3N69 A;  5ADJ A;  1LZX A;  4D30 A;  4KCJ A;  3B3P A;  3NLU A;  1MMW A;  3PNH A;  4UG6 A;  4UH7 A;  3JWZ A;  2BHJ A;  4D3T A;  1M9M A;  4K5H A;  1RS9 A;  4IMX A;  3JX4 A;  4UGJ A;  1DMK A;  2ORO A;  1FOL A;  4UQS A;  5G6C A;  3TYO A;  4CX6 A;  4UH2 A;  3JX1 A;  4D3A A;  3NLF A;  4FW0 A;  3TYM A;  3E7S B;  1ED5 A;  3N5Z A;  2ORQ A;  3NLG A;  5G67 A;  3RQK A;  2G6M A;  3NLD A;  1JWJ A;  5G6A A;  4JSH A;  4UPN A;  4K5G A;  3E7M A;  2NSE A;  1D1V A;  4KCK A;  4NSE A;  4FVY A;  4UGP A;  3RQM A;  4FVW A;  1K2U A;  3JT4 A;  4CAM A;  1FOJ A;  2G6L A;  3NLM A;  5G6G A;  3NQS A;  3DQR A;  3RQO A;  1ED6 A;  4UGK A;  1D1X A;  4UH4 A;  1QW4 A;  1P6L A;  4JSK A;  4CX2 A;  5ADD A;  4D3I A;  1DF1 A;  1K2T A;  4D37 A;  4KCR A;  4UG9 A;  3NOD A;  3TYL A;  4GQE A;  3PNF A;  1QOM A;  3N5X A;  4JSE A;  5G0P A;  4D33 A;  3TYN A;  3NLI A;  1ZVL A;  5FVV A;  4D3M A;  1QWC A;  2FC1 A;  2FLQ A;  3B3M A;  1P6H A;  5G6N A;  5ADK A;  3N6G A;  1NOD A;  3E67 A;  4JSL A;  4V3Y A;  4IMW A;  2NOD A;  3NLV A;  4JSF A;  4CX4 A;  4UH9 A;  5FVY A;  1K2S A;  4CUM A;  1DD7 A;  3N66 A;  1DM8 A;  4CTV A;  3JWY A;  4LUX A;  4D1P A;  1VAG A;  1ZZU A;  3UFT A;  1M9K A;  5FVS A;  5G6K A;  1P6J A;  3N5R A;  3N67 A;  3JX3 A;  4UGG A;  4CTR A;  1JWK A;  3NLZ A;  4UGD A;  4D1O A;  1M00 A;  4EUX A;  4D32 A;  4CTU A;  9NSE A;  3JWS A;  4UPT A;  4UGW A;  4V3Z A;  1QW5 A;  3UFS A;  2AN2 A;  2G6K A;  1VAF A;  3E6N A;  3JX2 A;  4D3V A;  4IMU A;  2HX4 A; 
#chains in the Genus database with same CATH homology
 3N6B A;  4V3U A;  3RQN A;  1I83 A;  3SVP A;  4K5K A;  3E7T A;  1DM7 A;  4D36 A;  4D2Y A;  4UGM A;  5AGL A;  3N61 A;  3NLY A;  2FC2 A;  4KCN A;  4CX0 A;  3RQJ A;  4D3U A;  1P6I A;  3HSN A;  4UGR A;  4CWX A;  4KCI A;  3JT9 A;  3JWW A;  3UFQ A;  5ADA A;  4UGO A;  1M8E A;  5G6M A;  4KCL A;  4CTW A;  4CU1 A;  5G6I A;  3NLO A;  4UH0 A;  2ORR A;  4UGE A;  4CFT A;  4CTQ A;  3UFW A;  1D0O A;  4UCH A;  5AGP A;  4KCH A;  5FVR A;  5G69 A;  5G6Q A;  3JT5 A;  4UH8 A;  1MJT A;  3NLW A;  3N5V A;  1FOI A;  4UH3 A;  3N63 A;  5G6P A;  3EBF A;  3JTA A;  3NLJ A;  4UGF A;  1P6N A;  1OM4 A;  3B3N A;  3NNY A;  1DMI A;  3E6T A;  4UG7 A;  5G68 A;  3DQS A;  3HSP A;  5FW0 A;  1ZZQ A;  4D7I A;  5AD7 A;  3JT7 A;  4FVX A;  4CAN A;  4UGQ A;  2G6O A;  4K5F A;  3Q99 A;  4CX7 A;  4CTX A;  3FC5 A;  5AD4 A;  1M8I A;  1DWV A;  8NSE A;  4JSM A;  4C3A A;  3EJ8 A;  1NOC A;  4CX1 A;  4CU1 B;  4LWA A;  5FVZ A;  3N5Y A;  3DWJ A;  3E7G A;  4UH6 A;  5G6J A;  2ORT A;  4JSG A;  3RQP A;  4UGV A;  3EAI A;  4CAR A;  5ADC A;  3N62 A;  5G6E A;  1RS7 A;  5ADF A;  3UFR A;  3NLR A;  4UHA A;  3N5T A;  5AD8 A;  1FOP A;  3NLK A;  3Q9A A;  3N5P A;  4D3J A;  4UGZ A;  5G0N A;  4JS9 A;  4UGA A;  3JWX A;  3NLP A;  3E68 A;  4V3W A;  3JT6 A;  4UH1 A;  5G65 A;  2Y37 A;  3HSO A;  2FBZ X;  3NOS A;  1RS8 A;  5FVT A;  4UG5 A;  5ADN A;  2HX3 A;  1ZZR A;  5FVX A;  3NLE A;  4D7J A;  3N6A A;  3B3O A;  3JWV A;  3N5S A;  3N68 A;  5ADM A;  4UGB A;  3E6O A;  5AGN A;  2AMO A;  3RQL A;  4CDT A;  3N6E A;  5ADB A;  1ZZS A;  4UGT A;  4CTT A;  4CAO A;  3EBD A;  4UPM A;  1FOO A;  3NLQ A;  1OM5 A;  4CTY A;  3E7S A;  4KCQ A;  4V3X A;  2ORP A;  4D7H A;  4UG8 A;  4C39 A;  4CTP A;  2AN0 A;  3JX0 A;  3JT3 A;  2NSI A;  1D1W A;  1NOS A;  1M9J A;  4CAQ A;  5G6L A;  3NM0 A;  3N5Q A;  3E7I A;  4UGY A;  5G0O A;  4LWB A;  3SVQ A;  3UFP A;  4UGU A;  4UPO A;  5AD6 A;  1D0C A;  5AGK A;  3JT8 A;  1M7V A;  4JSI A;  1MMV A;  5G6H A;  7NSE A;  2NOS A;  5FJ3 A;  1P6K A;  3NSE A;  3JWT A;  4K5D A;  4D38 A;  4JSJ A;  4D3O A;  1M9T A;  4LUW A;  3NNZ A;  2G6H A;  5FVO A;  4UPR A;  4D3K A;  5G6D A;  3N6F A;  4D1N A;  5NSE A;  4K5E A;  4K5J A;  1DWW A;  1M8H A;  3NLH A;  4CX3 A;  3UFU A;  4IMT A;  5ADE A;  5FVU A;  4D34 A;  1DMJ A;  3N60 A;  6NSE A;  4CUL A;  1D1Y A;  4CTZ A;  4D3N A;  4CFT B;  3N64 A;  3E65 A;  1K2R A;  1DWX A;  1QW6 A;  3NW2 A;  4NOS A;  1RS6 A;  5G6F A;  1N2N A;  4D35 A;  4UGL A;  5ADI A;  5FVQ A;  5G66 A;  4IMS A;  4UPS A;  1M8D A;  4UGC A;  1Q2O A;  4D2Z A;  5AGM A;  3PNE A;  1R35 A;  3NLN A;  1M9Q A;  5FVW A;  4CWV A;  4UPQ A;  4CU0 A;  3N65 A;  4UQR A;  5G6O A;  3UFV A;  4CVG A;  3EAH A;  4KCO A;  4K5I A;  4UGN A;  3JX5 A;  4CX5 A;  4KCP A;  5G6B A;  1ED4 A;  3N2R A;  1ZZT A;  5ADG A;  1M9R A;  4UGI A;  4UPP A;  4CUN A;  1P6M A;  3JWU A;  3E6L A;  4CWY A;  4UH5 A;  1M7Z A;  2G6J A;  4D7O A;  4UGX A;  5FJ2 A;  4UGH A;  5FVP A;  1NSI A;  2HX2 A;  1DM6 A;  3N6C A;  2G6I A;  3NLX A;  4CAP A;  5AD9 A;  5ADL A;  4KCM A;  3UFO A;  3JX6 A;  3N5W A;  3PNG A;  4D39 A;  3N6D A;  4CWZ A;  5AD5 A;  4KCS A;  4V3V A;  4CWW A;  4FVZ A;  1LZZ A;  4D3B A;  2G6N A;  2ORS A;  5AGO A;  1ZVI A;  3DQT A;  4UGS A;  3NLT A;  4D31 A;  1NSE A;  3N69 A;  5ADJ A;  1LZX A;  4D30 A;  4KCJ A;  3B3P A;  3NLU A;  1MMW A;  3PNH A;  4UG6 A;  4UH7 A;  3JWZ A;  2BHJ A;  4D3T A;  1M9M A;  4K5H A;  1RS9 A;  4IMX A;  3JX4 A;  4UGJ A;  1DMK A;  2ORO A;  1FOL A;  4UQS A;  5G6C A;  3TYO A;  4CX6 A;  4UH2 A;  3JX1 A;  4D3A A;  3NLF A;  4FW0 A;  3TYM A;  3E7S B;  1ED5 A;  3N5Z A;  2ORQ A;  3NLG A;  5G67 A;  3RQK A;  2G6M A;  3NLD A;  1JWJ A;  5G6A A;  4JSH A;  4UPN A;  4K5G A;  3E7M A;  2NSE A;  1D1V A;  4KCK A;  4NSE A;  4FVY A;  4UGP A;  3RQM A;  4FVW A;  1K2U A;  3JT4 A;  4CAM A;  1FOJ A;  2G6L A;  3NLM A;  5G6G A;  3NQS A;  3DQR A;  3RQO A;  1ED6 A;  4UGK A;  1D1X A;  4UH4 A;  1QW4 A;  1P6L A;  4JSK A;  4CX2 A;  5ADD A;  4D3I A;  1DF1 A;  1K2T A;  4D37 A;  4KCR A;  4UG9 A;  3NOD A;  3TYL A;  4GQE A;  3PNF A;  1QOM A;  3N5X A;  4JSE A;  5G0P A;  4D33 A;  3TYN A;  3NLI A;  1ZVL A;  5FVV A;  4D3M A;  1QWC A;  2FC1 A;  2FLQ A;  3B3M A;  1P6H A;  5G6N A;  5ADK A;  3N6G A;  1NOD A;  3E67 A;  4JSL A;  4V3Y A;  4IMW A;  2NOD A;  3NLV A;  4JSF A;  4CX4 A;  4UH9 A;  5FVY A;  1K2S A;  4CUM A;  1DD7 A;  3N66 A;  1DM8 A;  4CTV A;  3JWY A;  4LUX A;  4D1P A;  1VAG A;  1ZZU A;  3UFT A;  1M9K A;  5FVS A;  5G6K A;  1P6J A;  3N5R A;  3N67 A;  3JX3 A;  4UGG A;  4CTR A;  1JWK A;  3NLZ A;  4UGD A;  4D1O A;  1M00 A;  4EUX A;  4D32 A;  4CTU A;  9NSE A;  3JWS A;  4UPT A;  4UGW A;  4V3Z A;  1QW5 A;  3UFS A;  2AN2 A;  2G6K A;  1VAF A;  3E6N A;  3JX2 A;  4D3V A;  4IMU A;  2HX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...