4D7JA

Structure of bacillus subtilis nitric oxide synthase in complex with 6-(4-(((3-fluorophenethyl)amino)methyl)phenyl)-4-methylpyridin-2- amine
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
362
structure length
362
Chain Sequence
EEKEILWNEAKAFIAACYQELGKAAEVKDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPPEEKGEKQVEIWNHQLIRYAGYESDGERIGDPASCSLTAACEELGWRGERTDFDLLPLIFRMKGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQAEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDKPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NITRIC OXIDE SYNTHASE OXYGENASE
publication title Nitric Oxide Synthase as a Target for Methicillin-Resistant Staphylococcus Aureus.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
total genus 119
structure length 362
sequence length 362
ec nomenclature ec 1.14.14.47: Nitric-oxide synthase (flavodoxin).
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02898 NO_synthase Nitric oxide synthase, oxygenase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.340.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase; Chain A, domain 1 Nitric Oxide Synthase; Chain A, domain 1 4d7jA01
3.90.440.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase;Heme Domain; Chain A, domain 2 Nitric Oxide Synthase;Heme Domain;Chain A domain 2 4d7jA02
3.90.1230.10 Alpha Beta Alpha-Beta Complex Bovine Endothelial Nitric Oxide Synthase Heme Domain; Chain: A,domain 3 Nitric Oxide Synthase; Chain A, domain 3 4d7jA03
4UQSA 2G6IA 5FW0A 2FLQA 4EUXA 4D3UA 4UH6A 1RS6A 4K5KA 2ORSA 4LUXA 3N65A 1K2UA 4V3YA 3B3OA 4D1NA 2FBZX 5G6KA 1M7ZA 5G6BA 5ADBA 5G6EA 3N67A 5AGPA 4JSJA 4D1PA 2BHJA 3JX0A 4CFTA 5G6FA 4UGVA 1DM8A 3N5SA 4D37A 3UFTA 4CAMA 2FC1A 2G6OA 1D0OA 3B3NA 4LWBA 4UGLA 4CARA 4D38A 5G67A 3NLVA 3Q9AA 4CTZA 1ZZUA 3E7MA 3JWZA 3E7SB 3JTAA 3PNGA 4UGJA 3E6OA 1M9RA 4UGMA 3NLJA 4UGWA 3N6AA 5G68A 4K5EA 5AGMA 4UG7A 5FJ2A 5ADIA 5G66A 3JT7A 4UH0A 4UGAA 5FJ3A 4NSEA 1ZVLA 4CX5A 4CX4A 3N63A 3NLIA 3RQMA 3N5QA 3FC5A 4UGXA 3RQPA 4JSMA 5G6OA 3EAIA 3N6EA 3N68A 5AGLA 4D7JA 5AD5A 7NSEA 1P6KA 3TYOA 4D3MA 2OROA 4KCSA 5G6DA 1JWKA 4K5JA 3UFSA 1ZZRA 5FVWA 4KCQA 3RQNA 3E68A 3SVQA 4UG6A 4V3UA 4UGZA 4K5FA 1K2RA 3N5WA 4IMXA 1LZZA 5G6CA 3NLNA 4UPQA 1M8DA 3E65A 3NLGA 2AN0A 3JT6A 4JSKA 1D1VA 3JX3A 3DQTA 5G0NA 3N61A 5G6QA 3NOSA 5AD9A 1ZZTA 3HSNA 5ADLA 4UPPA 9NSEA 4D39A 1DMKA 4UGOA 1DWVA 3N6FA 1RS9A 2NOSA 4D1OA 3NLTA 3NLPA 4D3AA 4UPSA 5ADMA 4CTXA 4CAPA 4KCOA 4V3ZA 4CULA 3NNZA 4UH7A 1DMIA 3N5RA 4V3WA 4GQEA 4IMWA 1DM6A 4UCHA 3DWJA 1ED4A 5AD7A 3N5PA 4C3AA 3HSPA 4UH8A 3DQRA 5G6LA 5FVOA 3NLEA 2HX4A 1P6MA 2G6MA 5AD4A 3SVPA 5G6AA 3UFUA 4UH9A 5ADCA 4CU1B 4UGKA 4CU0A 4CU1A 5FVZA 1P6HA 3E7TA 3JT8A 3PNEA 3NLDA 1FOOA 4D3IA 3E6LA 1M8EA 3NODA 1P6LA 1ZZSA 1QW6A 4D3JA 5ADDA 4D3KA 3RQLA 5G65A 4CX1A 1M9MA 5NSEA 3E7GA 4D32A 4KCJA 3E7SA 1N2NA 3NLFA 4D36A 1OM5A 5G0OA 1I83A 1ZVIA 4UGSA 3JX2A 4CAOA 4UGFA 4JSLA 4CX7A 3UFRA 1M00A 3JWVA 3N2RA 4CWZA 4D7HA 2ORPA 4LWAA 4UPTA 5ADNA 5AD6A 1Q2OA 1FOPA 3PNHA 2HX2A 4CANA 2Y37A 4KCHA 4CX3A 8NSEA 5ADAA 3E7IA 1OM4A 4FW0A 4UPNA 4V3XA 1M8HA 3UFPA 1K2TA 4UG5A 2ORRA 4JSGA 4D3VA 1FOJA 5ADGA 3UFVA 4FVYA 3NLUA 4JSHA 4UGRA 1ED5A 4D3TA 1K2SA 1ED6A 5FVUA 3N6GA 4CTVA 5G0PA 3E67A 4JS9A 4CWXA 3NW2A 1NODA 3E6TA 4UH3A 4UGTA 1DWXA 4CWWA 5FVQA 5ADFA 1M9TA 4UGHA 5AD8A 3NLWA 1MMVA 1DMJA 3TYNA 1M9KA 5G6JA 4CVGA 4KCPA 3N5YA 2NSEA 3JT9A 4UGIA 3N5ZA 3NLKA 1P6IA 3JWXA 4CX0A 4KCKA 1NOCA 4JSEA 4UGBA 4D7OA 4KCLA 1RS8A 3N6CA 4UPMA 3B3MA 4K5GA 3RQJA 4CTWA 3TYLA 3B3PA 1R35A 3JX1A 1VAGA 4D7IA 1M9JA 3N5TA 4UH5A 5G6HA 1QW4A 4K5IA 3TYMA 4IMSA 6NSEA 4D31A 2NSIA 3Q99A 1FOLA 4UGEA 4UQRA 3JWYA 1M8IA 2G6KA 4C39A 4UPRA 1D1XA 2ORQA 5FVTA 5FVSA 5FVYA 4KCMA 1FOIA 3N5XA 3NLOA 3NSEA 5G6PA 3JWTA 3NQSA 3JT3A 3NM0A 4D3OA 3JX5A 1VAFA 4UGPA 4CWVA 4CFTB 4UGUA 4CTUA 3NLYA 4IMTA 1QOMA 4UG8A 2G6NA 4UHAA 5FVVA 3UFOA 3EAHA 4UGQA 4CTYA 3JWWA 2ORTA 4JSIA 5ADEA 1P6NA 4KCNA 1DWWA 3RQKA 4D35A 4CTPA 4CTTA 3NLRA 3N6BA 5FVRA 4D3BA 1MJTA 4UGCA 4D2ZA 4UGNA 3UFQA 3N5VA 4FVZA 4UGDA 5G6NA 3NLXA 4JSFA 5G6IA 3N66A 5G69A 4CUNA 4FVWA 1RS7A 4D3NA 4UGGA 1D1YA 3N6DA 4CTQA 3EBDA 4K5HA 4IMUA 3NNYA 3JX4A 3NLQA 1M7VA 3UFWA 2NODA 4CX2A 3EJ8A 4KCIA 4NOSA 4D33A 3NLMA 4UH2A 4CWYA 2FC2A 2G6HA 1DF1A 3HSOA 4CUMA 4D2YA 5FVPA 3N60A 1D0CA 1LZXA 3JWUA 5ADKA 5AGOA 3N64A 1JWJA 3JX6A 1QW5A 4UH4A 4UGYA 1NSIA 2G6JA 4D34A 2AMOA 1QWCA 2AN2A 3DQSA 3RQOA 4K5DA 5FVXA 2HX3A 1DD7A 1DM7A 2G6LA 1ZZQA 1NSEA 4CAQA 1D1WA 1P6JA 4FVXA 4UPOA 5ADJA 3N62A 3E6NA 3EBFA 5AGKA 4V3VA 4CX6A 1MMWA 3NLHA 1M9QA 3PNFA 3NLZA 3JT5A 4CDTA 4LUWA 3JT4A 5G6GA 3N69A 4UH1A 4UG9A 5G6MA 1NOSA 4KCRA 5AGNA 4CTRA 3JWSA 4D30A
chains in the Genus database with same CATH superfamily
4UQSA 2G6IA 5FW0A 2FLQA 4EUXA 4D3UA 4UH6A 1RS6A 4K5KA 2ORSA 4LUXA 3N65A 1K2UA 4V3YA 3B3OA 4D1NA 2FBZX 5G6KA 1M7ZA 5G6BA 5ADBA 5G6EA 3N67A 5AGPA 4JSJA 4D1PA 2BHJA 3JX0A 4CFTA 5G6FA 4UGVA 1DM8A 3N5SA 4D37A 3UFTA 4CAMA 2FC1A 2G6OA 1D0OA 3B3NA 4LWBA 4UGLA 4CARA 4D38A 5G67A 3NLVA 3Q9AA 4CTZA 1ZZUA 3E7MA 3JWZA 3E7SB 3JTAA 3PNGA 4UGJA 3E6OA 1M9RA 4UGMA 3NLJA 4UGWA 3N6AA 5G68A 4K5EA 5AGMA 4UG7A 5FJ2A 5ADIA 5G66A 3JT7A 4UH0A 4UGAA 5FJ3A 4NSEA 1ZVLA 4CX5A 4CX4A 3N63A 3NLIA 3RQMA 3N5QA 3FC5A 4UGXA 3RQPA 4JSMA 5G6OA 3EAIA 3N6EA 3N68A 5AGLA 4D7JA 5AD5A 7NSEA 1P6KA 3TYOA 4D3MA 2OROA 4KCSA 5G6DA 1JWKA 4K5JA 3UFSA 1ZZRA 5FVWA 4KCQA 3RQNA 3E68A 3SVQA 4UG6A 4V3UA 4UGZA 4K5FA 1K2RA 3N5WA 4IMXA 1LZZA 5G6CA 3NLNA 4UPQA 1M8DA 3E65A 3NLGA 2AN0A 3JT6A 4JSKA 1D1VA 3JX3A 3DQTA 5G0NA 3N61A 5G6QA 3NOSA 5AD9A 1ZZTA 3HSNA 5ADLA 4UPPA 9NSEA 4D39A 1DMKA 4UGOA 1DWVA 3N6FA 1RS9A 2NOSA 4D1OA 3NLTA 3NLPA 4D3AA 4UPSA 5ADMA 4CTXA 4CAPA 4KCOA 4V3ZA 4CULA 3NNZA 4UH7A 1DMIA 3N5RA 4V3WA 4GQEA 4IMWA 1DM6A 4UCHA 3DWJA 1ED4A 5AD7A 3N5PA 4C3AA 3HSPA 4UH8A 3DQRA 5G6LA 5FVOA 3NLEA 2HX4A 1P6MA 2G6MA 5AD4A 3SVPA 5G6AA 3UFUA 4UH9A 5ADCA 4CU1B 4UGKA 4CU0A 4CU1A 5FVZA 1P6HA 3E7TA 3JT8A 3PNEA 3NLDA 1FOOA 4D3IA 3E6LA 1M8EA 3NODA 1P6LA 1ZZSA 1QW6A 4D3JA 5ADDA 4D3KA 3RQLA 5G65A 4CX1A 1M9MA 5NSEA 3E7GA 4D32A 4KCJA 3E7SA 1N2NA 3NLFA 4D36A 1OM5A 5G0OA 1I83A 1ZVIA 4UGSA 3JX2A 4CAOA 4UGFA 4JSLA 4CX7A 3UFRA 1M00A 3JWVA 3N2RA 4CWZA 4D7HA 2ORPA 4LWAA 4UPTA 5ADNA 5AD6A 1Q2OA 1FOPA 3PNHA 2HX2A 4CANA 2Y37A 4KCHA 4CX3A 8NSEA 5ADAA 3E7IA 1OM4A 4FW0A 4UPNA 4V3XA 1M8HA 3UFPA 1K2TA 4UG5A 2ORRA 4JSGA 4D3VA 1FOJA 5ADGA 3UFVA 4FVYA 3NLUA 4JSHA 4UGRA 1ED5A 4D3TA 1K2SA 1ED6A 5FVUA 3N6GA 4CTVA 5G0PA 3E67A 4JS9A 4CWXA 3NW2A 1NODA 3E6TA 4UH3A 4UGTA 1DWXA 4CWWA 5FVQA 5ADFA 1M9TA 4UGHA 5AD8A 3NLWA 1MMVA 1DMJA 3TYNA 1M9KA 5G6JA 4CVGA 4KCPA 3N5YA 2NSEA 3JT9A 4UGIA 3N5ZA 3NLKA 1P6IA 3JWXA 4CX0A 4KCKA 1NOCA 4JSEA 4UGBA 4D7OA 4KCLA 1RS8A 3N6CA 4UPMA 3B3MA 4K5GA 3RQJA 4CTWA 3TYLA 3B3PA 1R35A 3JX1A 1VAGA 4D7IA 1M9JA 3N5TA 4UH5A 5G6HA 1QW4A 4K5IA 3TYMA 4IMSA 6NSEA 4D31A 2NSIA 3Q99A 1FOLA 4UGEA 4UQRA 3JWYA 1M8IA 2G6KA 4C39A 4UPRA 1D1XA 2ORQA 5FVTA 5FVSA 5FVYA 4KCMA 1FOIA 3N5XA 3NLOA 3NSEA 5G6PA 3JWTA 3NQSA 3JT3A 3NM0A 4D3OA 3JX5A 1VAFA 4UGPA 4CWVA 4CFTB 4UGUA 4CTUA 3NLYA 4IMTA 1QOMA 4UG8A 2G6NA 4UHAA 5FVVA 3UFOA 3EAHA 4UGQA 4CTYA 3JWWA 2ORTA 4JSIA 5ADEA 1P6NA 4KCNA 1DWWA 3RQKA 4D35A 4CTPA 4CTTA 3NLRA 3N6BA 5FVRA 4D3BA 1MJTA 4UGCA 4D2ZA 4UGNA 3UFQA 3N5VA 4FVZA 4UGDA 5G6NA 3NLXA 4JSFA 5G6IA 3N66A 5G69A 4CUNA 4FVWA 1RS7A 4D3NA 4UGGA 1D1YA 3N6DA 4CTQA 3EBDA 4K5HA 4IMUA 3NNYA 3JX4A 3NLQA 1M7VA 3UFWA 2NODA 4CX2A 3EJ8A 4KCIA 4NOSA 4D33A 3NLMA 4UH2A 4CWYA 2FC2A 2G6HA 1DF1A 3HSOA 4CUMA 4D2YA 5FVPA 3N60A 1D0CA 1LZXA 3JWUA 5ADKA 5AGOA 3N64A 1JWJA 3JX6A 1QW5A 4UH4A 4UGYA 1NSIA 2G6JA 4D34A 2AMOA 1QWCA 2AN2A 3DQSA 3RQOA 4K5DA 5FVXA 2HX3A 1DD7A 1DM7A 2G6LA 1ZZQA 1NSEA 4CAQA 1D1WA 1P6JA 4FVXA 4UPOA 5ADJA 3N62A 3E6NA 3EBFA 5AGKA 4V3VA 4CX6A 1MMWA 3NLHA 1M9QA 3PNFA 3NLZA 3JT5A 4CDTA 4LUWA 3JT4A 5G6GA 3N69A 4UH1A 4UG9A 5G6MA 1NOSA 4KCRA 5AGNA 4CTRA 3JWSA 4D30A
chains in the Genus database with same CATH topology
4UQSA 2G6IA 5FW0A 2FLQA 4EUXA 4D3UA 4UH6A 1RS6A 4K5KA 2ORSA 4LUXA 3N65A 1K2UA 4V3YA 3B3OA 4D1NA 2FBZX 5G6KA 1M7ZA 5G6BA 5ADBA 5G6EA 3N67A 5AGPA 4JSJA 4D1PA 2BHJA 3JX0A 4CFTA 5G6FA 4UGVA 1DM8A 3N5SA 4D37A 3UFTA 4CAMA 2FC1A 2G6OA 1D0OA 3B3NA 4LWBA 4UGLA 4CARA 4D38A 5G67A 3NLVA 3Q9AA 4CTZA 1ZZUA 3E7MA 3JWZA 3E7SB 3JTAA 3PNGA 4UGJA 3E6OA 1M9RA 4UGMA 3NLJA 4UGWA 3N6AA 5G68A 4K5EA 5AGMA 4UG7A 5FJ2A 5ADIA 5G66A 3JT7A 4UH0A 4UGAA 5FJ3A 4NSEA 1ZVLA 4CX5A 4CX4A 3N63A 3NLIA 3RQMA 3N5QA 3FC5A 4UGXA 3RQPA 4JSMA 5G6OA 3EAIA 3N6EA 3N68A 5AGLA 4D7JA 5AD5A 7NSEA 1P6KA 3TYOA 4D3MA 2OROA 4KCSA 5G6DA 1JWKA 4K5JA 3UFSA 1ZZRA 5FVWA 4KCQA 3RQNA 3E68A 3SVQA 4UG6A 4V3UA 4UGZA 4K5FA 1K2RA 3N5WA 4IMXA 1LZZA 5G6CA 3NLNA 4UPQA 1M8DA 3E65A 3NLGA 2AN0A 3JT6A 4JSKA 1D1VA 3JX3A 3DQTA 5G0NA 3N61A 5G6QA 3NOSA 5AD9A 1ZZTA 3HSNA 5ADLA 4UPPA 9NSEA 4D39A 1DMKA 4UGOA 1DWVA 3N6FA 1RS9A 2NOSA 4D1OA 3NLTA 3NLPA 4D3AA 4UPSA 5ADMA 4CTXA 4CAPA 4KCOA 4V3ZA 4CULA 3NNZA 4UH7A 1DMIA 3N5RA 4V3WA 4GQEA 4IMWA 1DM6A 4UCHA 3DWJA 1ED4A 5AD7A 3N5PA 4C3AA 3HSPA 4UH8A 3DQRA 5G6LA 5FVOA 3NLEA 2HX4A 1P6MA 2G6MA 5AD4A 3SVPA 5G6AA 3UFUA 4UH9A 5ADCA 4CU1B 4UGKA 4CU0A 4CU1A 5FVZA 1P6HA 3E7TA 3JT8A 3PNEA 3NLDA 1FOOA 4D3IA 3E6LA 1M8EA 3NODA 1P6LA 1ZZSA 1QW6A 4D3JA 5ADDA 4D3KA 3RQLA 5G65A 4CX1A 1M9MA 5NSEA 3E7GA 4D32A 4KCJA 3E7SA 1N2NA 3NLFA 4D36A 1OM5A 5G0OA 1I83A 1ZVIA 4UGSA 3JX2A 4CAOA 4UGFA 4JSLA 4CX7A 3UFRA 1M00A 3JWVA 3N2RA 4CWZA 4D7HA 2ORPA 4LWAA 4UPTA 5ADNA 5AD6A 1Q2OA 1FOPA 3PNHA 2HX2A 4CANA 2Y37A 4KCHA 4CX3A 8NSEA 5ADAA 3E7IA 1OM4A 4FW0A 4UPNA 4V3XA 1M8HA 3UFPA 1K2TA 4UG5A 2ORRA 4JSGA 4D3VA 1FOJA 5ADGA 3UFVA 4FVYA 3NLUA 4JSHA 4UGRA 1ED5A 4D3TA 1K2SA 1ED6A 5FVUA 3N6GA 4CTVA 5G0PA 3E67A 4JS9A 4CWXA 3NW2A 1NODA 3E6TA 4UH3A 4UGTA 1DWXA 4CWWA 5FVQA 5ADFA 1M9TA 4UGHA 5AD8A 3NLWA 1MMVA 1DMJA 3TYNA 1M9KA 5G6JA 4CVGA 4KCPA 3N5YA 2NSEA 3JT9A 4UGIA 3N5ZA 3NLKA 1P6IA 3JWXA 4CX0A 4KCKA 1NOCA 4JSEA 4UGBA 4D7OA 4KCLA 1RS8A 3N6CA 4UPMA 3B3MA 4K5GA 3RQJA 4CTWA 3TYLA 3B3PA 1R35A 3JX1A 1VAGA 4D7IA 1M9JA 3N5TA 4UH5A 5G6HA 1QW4A 4K5IA 3TYMA 4IMSA 6NSEA 4D31A 2NSIA 3Q99A 1FOLA 4UGEA 4UQRA 3JWYA 1M8IA 2G6KA 4C39A 4UPRA 1D1XA 2ORQA 5FVTA 5FVSA 5FVYA 4KCMA 1FOIA 3N5XA 3NLOA 3NSEA 5G6PA 3JWTA 3NQSA 3JT3A 3NM0A 4D3OA 3JX5A 1VAFA 4UGPA 4CWVA 4CFTB 4UGUA 4CTUA 3NLYA 4IMTA 1QOMA 4UG8A 2G6NA 4UHAA 5FVVA 3UFOA 3EAHA 4UGQA 4CTYA 3JWWA 2ORTA 4JSIA 5ADEA 1P6NA 4KCNA 1DWWA 3RQKA 4D35A 4CTPA 4CTTA 3NLRA 3N6BA 5FVRA 4D3BA 1MJTA 4UGCA 4D2ZA 4UGNA 3UFQA 3N5VA 4FVZA 4UGDA 5G6NA 3NLXA 4JSFA 5G6IA 3N66A 5G69A 4CUNA 4FVWA 1RS7A 4D3NA 4UGGA 1D1YA 3N6DA 4CTQA 3EBDA 4K5HA 4IMUA 3NNYA 3JX4A 3NLQA 1M7VA 3UFWA 2NODA 4CX2A 3EJ8A 4KCIA 4NOSA 4D33A 3NLMA 4UH2A 4CWYA 2FC2A 2G6HA 1DF1A 3HSOA 4CUMA 4D2YA 5FVPA 3N60A 1D0CA 1LZXA 3JWUA 5ADKA 5AGOA 3N64A 1JWJA 3JX6A 1QW5A 4UH4A 4UGYA 1NSIA 2G6JA 4D34A 2AMOA 1QWCA 2AN2A 3DQSA 3RQOA 4K5DA 5FVXA 2HX3A 1DD7A 1DM7A 2G6LA 1ZZQA 1NSEA 4CAQA 1D1WA 1P6JA 4FVXA 4UPOA 5ADJA 3N62A 3E6NA 3EBFA 5AGKA 4V3VA 4CX6A 1MMWA 3NLHA 1M9QA 3PNFA 3NLZA 3JT5A 4CDTA 4LUWA 3JT4A 5G6GA 3N69A 4UH1A 4UG9A 5G6MA 1NOSA 4KCRA 5AGNA 4CTRA 3JWSA 4D30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UQS A;  2G6I A;  5FW0 A;  2FLQ A;  4EUX A;  4D3U A;  4UH6 A;  1RS6 A;  4K5K A;  2ORS A;  4LUX A;  3N65 A;  1K2U A;  4V3Y A;  3B3O A;  4D1N A;  2FBZ X;  5G6K A;  1M7Z A;  5G6B A;  5ADB A;  5G6E A;  3N67 A;  5AGP A;  4JSJ A;  4D1P A;  2BHJ A;  3JX0 A;  4CFT A;  5G6F A;  4UGV A;  1DM8 A;  3N5S A;  4D37 A;  3UFT A;  4CAM A;  2FC1 A;  2G6O A;  1D0O A;  3B3N A;  4LWB A;  4UGL A;  4CAR A;  4D38 A;  5G67 A;  3NLV A;  3Q9A A;  4CTZ A;  1ZZU A;  3E7M A;  3JWZ A;  3E7S B;  3JTA A;  3PNG A;  4UGJ A;  3E6O A;  1M9R A;  4UGM A;  3NLJ A;  4UGW A;  3N6A A;  5G68 A;  4K5E A;  5AGM A;  4UG7 A;  5FJ2 A;  5ADI A;  5G66 A;  3JT7 A;  4UH0 A;  4UGA A;  5FJ3 A;  4NSE A;  1ZVL A;  4CX5 A;  4CX4 A;  3N63 A;  3NLI A;  3RQM A;  3N5Q A;  3FC5 A;  4UGX A;  3RQP A;  4JSM A;  5G6O A;  3EAI A;  3N6E A;  3N68 A;  5AGL A;  4D7J A;  5AD5 A;  7NSE A;  1P6K A;  3TYO A;  4D3M A;  2ORO A;  4KCS A;  5G6D A;  1JWK A;  4K5J A;  3UFS A;  1ZZR A;  5FVW A;  4KCQ A;  3RQN A;  3E68 A;  3SVQ A;  4UG6 A;  4V3U A;  4UGZ A;  4K5F A;  1K2R A;  3N5W A;  4IMX A;  1LZZ A;  5G6C A;  3NLN A;  4UPQ A;  1M8D A;  3E65 A;  3NLG A;  2AN0 A;  3JT6 A;  4JSK A;  1D1V A;  3JX3 A;  3DQT A;  5G0N A;  3N61 A;  5G6Q A;  3NOS A;  5AD9 A;  1ZZT A;  3HSN A;  5ADL A;  4UPP A;  9NSE A;  4D39 A;  1DMK A;  4UGO A;  1DWV A;  3N6F A;  1RS9 A;  2NOS A;  4D1O A;  3NLT A;  3NLP A;  4D3A A;  4UPS A;  5ADM A;  4CTX A;  4CAP A;  4KCO A;  4V3Z A;  4CUL A;  3NNZ A;  4UH7 A;  1DMI A;  3N5R A;  4V3W A;  4GQE A;  4IMW A;  1DM6 A;  4UCH A;  3DWJ A;  1ED4 A;  5AD7 A;  3N5P A;  4C3A A;  3HSP A;  4UH8 A;  3DQR A;  5G6L A;  5FVO A;  3NLE A;  2HX4 A;  1P6M A;  2G6M A;  5AD4 A;  3SVP A;  5G6A A;  3UFU A;  4UH9 A;  5ADC A;  4CU1 B;  4UGK A;  4CU0 A;  4CU1 A;  5FVZ A;  1P6H A;  3E7T A;  3JT8 A;  3PNE A;  3NLD A;  1FOO A;  4D3I A;  3E6L A;  1M8E A;  3NOD A;  1P6L A;  1ZZS A;  1QW6 A;  4D3J A;  5ADD A;  4D3K A;  3RQL A;  5G65 A;  4CX1 A;  1M9M A;  5NSE A;  3E7G A;  4D32 A;  4KCJ A;  3E7S A;  1N2N A;  3NLF A;  4D36 A;  1OM5 A;  5G0O A;  1I83 A;  1ZVI A;  4UGS A;  3JX2 A;  4CAO A;  4UGF A;  4JSL A;  4CX7 A;  3UFR A;  1M00 A;  3JWV A;  3N2R A;  4CWZ A;  4D7H A;  2ORP A;  4LWA A;  4UPT A;  5ADN A;  5AD6 A;  1Q2O A;  1FOP A;  3PNH A;  2HX2 A;  4CAN A;  2Y37 A;  4KCH A;  4CX3 A;  8NSE A;  5ADA A;  3E7I A;  1OM4 A;  4FW0 A;  4UPN A;  4V3X A;  1M8H A;  3UFP A;  1K2T A;  4UG5 A;  2ORR A;  4JSG A;  4D3V A;  1FOJ A;  5ADG A;  3UFV A;  4FVY A;  3NLU A;  4JSH A;  4UGR A;  1ED5 A;  4D3T A;  1K2S A;  1ED6 A;  5FVU A;  3N6G A;  4CTV A;  5G0P A;  3E67 A;  4JS9 A;  4CWX A;  3NW2 A;  1NOD A;  3E6T A;  4UH3 A;  4UGT A;  1DWX A;  4CWW A;  5FVQ A;  5ADF A;  1M9T A;  4UGH A;  5AD8 A;  3NLW A;  1MMV A;  1DMJ A;  3TYN A;  1M9K A;  5G6J A;  4CVG A;  4KCP A;  3N5Y A;  2NSE A;  3JT9 A;  4UGI A;  3N5Z A;  3NLK A;  1P6I A;  3JWX A;  4CX0 A;  4KCK A;  1NOC A;  4JSE A;  4UGB A;  4D7O A;  4KCL A;  1RS8 A;  3N6C A;  4UPM A;  3B3M A;  4K5G A;  3RQJ A;  4CTW A;  3TYL A;  3B3P A;  1R35 A;  3JX1 A;  1VAG A;  4D7I A;  1M9J A;  3N5T A;  4UH5 A;  5G6H A;  1QW4 A;  4K5I A;  3TYM A;  4IMS A;  6NSE A;  4D31 A;  2NSI A;  3Q99 A;  1FOL A;  4UGE A;  4UQR A;  3JWY A;  1M8I A;  2G6K A;  4C39 A;  4UPR A;  1D1X A;  2ORQ A;  5FVT A;  5FVS A;  5FVY A;  4KCM A;  1FOI A;  3N5X A;  3NLO A;  3NSE A;  5G6P A;  3JWT A;  3NQS A;  3JT3 A;  3NM0 A;  4D3O A;  3JX5 A;  1VAF A;  4UGP A;  4CWV A;  4CFT B;  4UGU A;  4CTU A;  3NLY A;  4IMT A;  1QOM A;  4UG8 A;  2G6N A;  4UHA A;  5FVV A;  3UFO A;  3EAH A;  4UGQ A;  4CTY A;  3JWW A;  2ORT A;  4JSI A;  5ADE A;  1P6N A;  4KCN A;  1DWW A;  3RQK A;  4D35 A;  4CTP A;  4CTT A;  3NLR A;  3N6B A;  5FVR A;  4D3B A;  1MJT A;  4UGC A;  4D2Z A;  4UGN A;  3UFQ A;  3N5V A;  4FVZ A;  4UGD A;  5G6N A;  3NLX A;  4JSF A;  5G6I A;  3N66 A;  5G69 A;  4CUN A;  4FVW A;  1RS7 A;  4D3N A;  4UGG A;  1D1Y A;  3N6D A;  4CTQ A;  3EBD A;  4K5H A;  4IMU A;  3NNY A;  3JX4 A;  3NLQ A;  1M7V A;  3UFW A;  2NOD A;  4CX2 A;  3EJ8 A;  4KCI A;  4NOS A;  4D33 A;  3NLM A;  4UH2 A;  4CWY A;  2FC2 A;  2G6H A;  1DF1 A;  3HSO A;  4CUM A;  4D2Y A;  5FVP A;  3N60 A;  1D0C A;  1LZX A;  3JWU A;  5ADK A;  5AGO A;  3N64 A;  1JWJ A;  3JX6 A;  1QW5 A;  4UH4 A;  4UGY A;  1NSI A;  2G6J A;  4D34 A;  2AMO A;  1QWC A;  2AN2 A;  3DQS A;  3RQO A;  4K5D A;  5FVX A;  2HX3 A;  1DD7 A;  1DM7 A;  2G6L A;  1ZZQ A;  1NSE A;  4CAQ A;  1D1W A;  1P6J A;  4FVX A;  4UPO A;  5ADJ A;  3N62 A;  3E6N A;  3EBF A;  5AGK A;  4V3V A;  4CX6 A;  1MMW A;  3NLH A;  1M9Q A;  3PNF A;  3NLZ A;  3JT5 A;  4CDT A;  4LUW A;  3JT4 A;  5G6G A;  3N69 A;  4UH1 A;  4UG9 A;  5G6M A;  1NOS A;  4KCR A;  5AGN A;  4CTR A;  3JWS A;  4D30 A; 
#chains in the Genus database with same CATH topology
 4UQS A;  2G6I A;  5FW0 A;  2FLQ A;  4EUX A;  4D3U A;  4UH6 A;  1RS6 A;  4K5K A;  2ORS A;  4LUX A;  3N65 A;  1K2U A;  4V3Y A;  3B3O A;  4D1N A;  2FBZ X;  5G6K A;  1M7Z A;  5G6B A;  5ADB A;  5G6E A;  3N67 A;  5AGP A;  4JSJ A;  4D1P A;  2BHJ A;  3JX0 A;  4CFT A;  5G6F A;  4UGV A;  1DM8 A;  3N5S A;  4D37 A;  3UFT A;  4CAM A;  2FC1 A;  2G6O A;  1D0O A;  3B3N A;  4LWB A;  4UGL A;  4CAR A;  4D38 A;  5G67 A;  3NLV A;  3Q9A A;  4CTZ A;  1ZZU A;  3E7M A;  3JWZ A;  3E7S B;  3JTA A;  3PNG A;  4UGJ A;  3E6O A;  1M9R A;  4UGM A;  3NLJ A;  4UGW A;  3N6A A;  5G68 A;  4K5E A;  5AGM A;  4UG7 A;  5FJ2 A;  5ADI A;  5G66 A;  3JT7 A;  4UH0 A;  4UGA A;  5FJ3 A;  4NSE A;  1ZVL A;  4CX5 A;  4CX4 A;  3N63 A;  3NLI A;  3RQM A;  3N5Q A;  3FC5 A;  4UGX A;  3RQP A;  4JSM A;  5G6O A;  3EAI A;  3N6E A;  3N68 A;  5AGL A;  4D7J A;  5AD5 A;  7NSE A;  1P6K A;  3TYO A;  4D3M A;  2ORO A;  4KCS A;  5G6D A;  1JWK A;  4K5J A;  3UFS A;  1ZZR A;  5FVW A;  4KCQ A;  3RQN A;  3E68 A;  3SVQ A;  4UG6 A;  4V3U A;  4UGZ A;  4K5F A;  1K2R A;  3N5W A;  4IMX A;  1LZZ A;  5G6C A;  3NLN A;  4UPQ A;  1M8D A;  3E65 A;  3NLG A;  2AN0 A;  3JT6 A;  4JSK A;  1D1V A;  3JX3 A;  3DQT A;  5G0N A;  3N61 A;  5G6Q A;  3NOS A;  5AD9 A;  1ZZT A;  3HSN A;  5ADL A;  4UPP A;  9NSE A;  4D39 A;  1DMK A;  4UGO A;  1DWV A;  3N6F A;  1RS9 A;  2NOS A;  4D1O A;  3NLT A;  3NLP A;  4D3A A;  4UPS A;  5ADM A;  4CTX A;  4CAP A;  4KCO A;  4V3Z A;  4CUL A;  3NNZ A;  4UH7 A;  1DMI A;  3N5R A;  4V3W A;  4GQE A;  4IMW A;  1DM6 A;  4UCH A;  3DWJ A;  1ED4 A;  5AD7 A;  3N5P A;  4C3A A;  3HSP A;  4UH8 A;  3DQR A;  5G6L A;  5FVO A;  3NLE A;  2HX4 A;  1P6M A;  2G6M A;  5AD4 A;  3SVP A;  5G6A A;  3UFU A;  4UH9 A;  5ADC A;  4CU1 B;  4UGK A;  4CU0 A;  4CU1 A;  5FVZ A;  1P6H A;  3E7T A;  3JT8 A;  3PNE A;  3NLD A;  1FOO A;  4D3I A;  3E6L A;  1M8E A;  3NOD A;  1P6L A;  1ZZS A;  1QW6 A;  4D3J A;  5ADD A;  4D3K A;  3RQL A;  5G65 A;  4CX1 A;  1M9M A;  5NSE A;  3E7G A;  4D32 A;  4KCJ A;  3E7S A;  1N2N A;  3NLF A;  4D36 A;  1OM5 A;  5G0O A;  1I83 A;  1ZVI A;  4UGS A;  3JX2 A;  4CAO A;  4UGF A;  4JSL A;  4CX7 A;  3UFR A;  1M00 A;  3JWV A;  3N2R A;  4CWZ A;  4D7H A;  2ORP A;  4LWA A;  4UPT A;  5ADN A;  5AD6 A;  1Q2O A;  1FOP A;  3PNH A;  2HX2 A;  4CAN A;  2Y37 A;  4KCH A;  4CX3 A;  8NSE A;  5ADA A;  3E7I A;  1OM4 A;  4FW0 A;  4UPN A;  4V3X A;  1M8H A;  3UFP A;  1K2T A;  4UG5 A;  2ORR A;  4JSG A;  4D3V A;  1FOJ A;  5ADG A;  3UFV A;  4FVY A;  3NLU A;  4JSH A;  4UGR A;  1ED5 A;  4D3T A;  1K2S A;  1ED6 A;  5FVU A;  3N6G A;  4CTV A;  5G0P A;  3E67 A;  4JS9 A;  4CWX A;  3NW2 A;  1NOD A;  3E6T A;  4UH3 A;  4UGT A;  1DWX A;  4CWW A;  5FVQ A;  5ADF A;  1M9T A;  4UGH A;  5AD8 A;  3NLW A;  1MMV A;  1DMJ A;  3TYN A;  1M9K A;  5G6J A;  4CVG A;  4KCP A;  3N5Y A;  2NSE A;  3JT9 A;  4UGI A;  3N5Z A;  3NLK A;  1P6I A;  3JWX A;  4CX0 A;  4KCK A;  1NOC A;  4JSE A;  4UGB A;  4D7O A;  4KCL A;  1RS8 A;  3N6C A;  4UPM A;  3B3M A;  4K5G A;  3RQJ A;  4CTW A;  3TYL A;  3B3P A;  1R35 A;  3JX1 A;  1VAG A;  4D7I A;  1M9J A;  3N5T A;  4UH5 A;  5G6H A;  1QW4 A;  4K5I A;  3TYM A;  4IMS A;  6NSE A;  4D31 A;  2NSI A;  3Q99 A;  1FOL A;  4UGE A;  4UQR A;  3JWY A;  1M8I A;  2G6K A;  4C39 A;  4UPR A;  1D1X A;  2ORQ A;  5FVT A;  5FVS A;  5FVY A;  4KCM A;  1FOI A;  3N5X A;  3NLO A;  3NSE A;  5G6P A;  3JWT A;  3NQS A;  3JT3 A;  3NM0 A;  4D3O A;  3JX5 A;  1VAF A;  4UGP A;  4CWV A;  4CFT B;  4UGU A;  4CTU A;  3NLY A;  4IMT A;  1QOM A;  4UG8 A;  2G6N A;  4UHA A;  5FVV A;  3UFO A;  3EAH A;  4UGQ A;  4CTY A;  3JWW A;  2ORT A;  4JSI A;  5ADE A;  1P6N A;  4KCN A;  1DWW A;  3RQK A;  4D35 A;  4CTP A;  4CTT A;  3NLR A;  3N6B A;  5FVR A;  4D3B A;  1MJT A;  4UGC A;  4D2Z A;  4UGN A;  3UFQ A;  3N5V A;  4FVZ A;  4UGD A;  5G6N A;  3NLX A;  4JSF A;  5G6I A;  3N66 A;  5G69 A;  4CUN A;  4FVW A;  1RS7 A;  4D3N A;  4UGG A;  1D1Y A;  3N6D A;  4CTQ A;  3EBD A;  4K5H A;  4IMU A;  3NNY A;  3JX4 A;  3NLQ A;  1M7V A;  3UFW A;  2NOD A;  4CX2 A;  3EJ8 A;  4KCI A;  4NOS A;  4D33 A;  3NLM A;  4UH2 A;  4CWY A;  2FC2 A;  2G6H A;  1DF1 A;  3HSO A;  4CUM A;  4D2Y A;  5FVP A;  3N60 A;  1D0C A;  1LZX A;  3JWU A;  5ADK A;  5AGO A;  3N64 A;  1JWJ A;  3JX6 A;  1QW5 A;  4UH4 A;  4UGY A;  1NSI A;  2G6J A;  4D34 A;  2AMO A;  1QWC A;  2AN2 A;  3DQS A;  3RQO A;  4K5D A;  5FVX A;  2HX3 A;  1DD7 A;  1DM7 A;  2G6L A;  1ZZQ A;  1NSE A;  4CAQ A;  1D1W A;  1P6J A;  4FVX A;  4UPO A;  5ADJ A;  3N62 A;  3E6N A;  3EBF A;  5AGK A;  4V3V A;  4CX6 A;  1MMW A;  3NLH A;  1M9Q A;  3PNF A;  3NLZ A;  3JT5 A;  4CDT A;  4LUW A;  3JT4 A;  5G6G A;  3N69 A;  4UH1 A;  4UG9 A;  5G6M A;  1NOS A;  4KCR A;  5AGN A;  4CTR A;  3JWS A;  4D30 A; 
#chains in the Genus database with same CATH homology
 4UQS A;  2G6I A;  5FW0 A;  2FLQ A;  4EUX A;  4D3U A;  4UH6 A;  1RS6 A;  4K5K A;  2ORS A;  4LUX A;  3N65 A;  1K2U A;  4V3Y A;  3B3O A;  4D1N A;  2FBZ X;  5G6K A;  1M7Z A;  5G6B A;  5ADB A;  5G6E A;  3N67 A;  5AGP A;  4JSJ A;  4D1P A;  2BHJ A;  3JX0 A;  4CFT A;  5G6F A;  4UGV A;  1DM8 A;  3N5S A;  4D37 A;  3UFT A;  4CAM A;  2FC1 A;  2G6O A;  1D0O A;  3B3N A;  4LWB A;  4UGL A;  4CAR A;  4D38 A;  5G67 A;  3NLV A;  3Q9A A;  4CTZ A;  1ZZU A;  3E7M A;  3JWZ A;  3E7S B;  3JTA A;  3PNG A;  4UGJ A;  3E6O A;  1M9R A;  4UGM A;  3NLJ A;  4UGW A;  3N6A A;  5G68 A;  4K5E A;  5AGM A;  4UG7 A;  5FJ2 A;  5ADI A;  5G66 A;  3JT7 A;  4UH0 A;  4UGA A;  5FJ3 A;  4NSE A;  1ZVL A;  4CX5 A;  4CX4 A;  3N63 A;  3NLI A;  3RQM A;  3N5Q A;  3FC5 A;  4UGX A;  3RQP A;  4JSM A;  5G6O A;  3EAI A;  3N6E A;  3N68 A;  5AGL A;  4D7J A;  5AD5 A;  7NSE A;  1P6K A;  3TYO A;  4D3M A;  2ORO A;  4KCS A;  5G6D A;  1JWK A;  4K5J A;  3UFS A;  1ZZR A;  5FVW A;  4KCQ A;  3RQN A;  3E68 A;  3SVQ A;  4UG6 A;  4V3U A;  4UGZ A;  4K5F A;  1K2R A;  3N5W A;  4IMX A;  1LZZ A;  5G6C A;  3NLN A;  4UPQ A;  1M8D A;  3E65 A;  3NLG A;  2AN0 A;  3JT6 A;  4JSK A;  1D1V A;  3JX3 A;  3DQT A;  5G0N A;  3N61 A;  5G6Q A;  3NOS A;  5AD9 A;  1ZZT A;  3HSN A;  5ADL A;  4UPP A;  9NSE A;  4D39 A;  1DMK A;  4UGO A;  1DWV A;  3N6F A;  1RS9 A;  2NOS A;  4D1O A;  3NLT A;  3NLP A;  4D3A A;  4UPS A;  5ADM A;  4CTX A;  4CAP A;  4KCO A;  4V3Z A;  4CUL A;  3NNZ A;  4UH7 A;  1DMI A;  3N5R A;  4V3W A;  4GQE A;  4IMW A;  1DM6 A;  4UCH A;  3DWJ A;  1ED4 A;  5AD7 A;  3N5P A;  4C3A A;  3HSP A;  4UH8 A;  3DQR A;  5G6L A;  5FVO A;  3NLE A;  2HX4 A;  1P6M A;  2G6M A;  5AD4 A;  3SVP A;  5G6A A;  3UFU A;  4UH9 A;  5ADC A;  4CU1 B;  4UGK A;  4CU0 A;  4CU1 A;  5FVZ A;  1P6H A;  3E7T A;  3JT8 A;  3PNE A;  3NLD A;  1FOO A;  4D3I A;  3E6L A;  1M8E A;  3NOD A;  1P6L A;  1ZZS A;  1QW6 A;  4D3J A;  5ADD A;  4D3K A;  3RQL A;  5G65 A;  4CX1 A;  1M9M A;  5NSE A;  3E7G A;  4D32 A;  4KCJ A;  3E7S A;  1N2N A;  3NLF A;  4D36 A;  1OM5 A;  5G0O A;  1I83 A;  1ZVI A;  4UGS A;  3JX2 A;  4CAO A;  4UGF A;  4JSL A;  4CX7 A;  3UFR A;  1M00 A;  3JWV A;  3N2R A;  4CWZ A;  4D7H A;  2ORP A;  4LWA A;  4UPT A;  5ADN A;  5AD6 A;  1Q2O A;  1FOP A;  3PNH A;  2HX2 A;  4CAN A;  2Y37 A;  4KCH A;  4CX3 A;  8NSE A;  5ADA A;  3E7I A;  1OM4 A;  4FW0 A;  4UPN A;  4V3X A;  1M8H A;  3UFP A;  1K2T A;  4UG5 A;  2ORR A;  4JSG A;  4D3V A;  1FOJ A;  5ADG A;  3UFV A;  4FVY A;  3NLU A;  4JSH A;  4UGR A;  1ED5 A;  4D3T A;  1K2S A;  1ED6 A;  5FVU A;  3N6G A;  4CTV A;  5G0P A;  3E67 A;  4JS9 A;  4CWX A;  3NW2 A;  1NOD A;  3E6T A;  4UH3 A;  4UGT A;  1DWX A;  4CWW A;  5FVQ A;  5ADF A;  1M9T A;  4UGH A;  5AD8 A;  3NLW A;  1MMV A;  1DMJ A;  3TYN A;  1M9K A;  5G6J A;  4CVG A;  4KCP A;  3N5Y A;  2NSE A;  3JT9 A;  4UGI A;  3N5Z A;  3NLK A;  1P6I A;  3JWX A;  4CX0 A;  4KCK A;  1NOC A;  4JSE A;  4UGB A;  4D7O A;  4KCL A;  1RS8 A;  3N6C A;  4UPM A;  3B3M A;  4K5G A;  3RQJ A;  4CTW A;  3TYL A;  3B3P A;  1R35 A;  3JX1 A;  1VAG A;  4D7I A;  1M9J A;  3N5T A;  4UH5 A;  5G6H A;  1QW4 A;  4K5I A;  3TYM A;  4IMS A;  6NSE A;  4D31 A;  2NSI A;  3Q99 A;  1FOL A;  4UGE A;  4UQR A;  3JWY A;  1M8I A;  2G6K A;  4C39 A;  4UPR A;  1D1X A;  2ORQ A;  5FVT A;  5FVS A;  5FVY A;  4KCM A;  1FOI A;  3N5X A;  3NLO A;  3NSE A;  5G6P A;  3JWT A;  3NQS A;  3JT3 A;  3NM0 A;  4D3O A;  3JX5 A;  1VAF A;  4UGP A;  4CWV A;  4CFT B;  4UGU A;  4CTU A;  3NLY A;  4IMT A;  1QOM A;  4UG8 A;  2G6N A;  4UHA A;  5FVV A;  3UFO A;  3EAH A;  4UGQ A;  4CTY A;  3JWW A;  2ORT A;  4JSI A;  5ADE A;  1P6N A;  4KCN A;  1DWW A;  3RQK A;  4D35 A;  4CTP A;  4CTT A;  3NLR A;  3N6B A;  5FVR A;  4D3B A;  1MJT A;  4UGC A;  4D2Z A;  4UGN A;  3UFQ A;  3N5V A;  4FVZ A;  4UGD A;  5G6N A;  3NLX A;  4JSF A;  5G6I A;  3N66 A;  5G69 A;  4CUN A;  4FVW A;  1RS7 A;  4D3N A;  4UGG A;  1D1Y A;  3N6D A;  4CTQ A;  3EBD A;  4K5H A;  4IMU A;  3NNY A;  3JX4 A;  3NLQ A;  1M7V A;  3UFW A;  2NOD A;  4CX2 A;  3EJ8 A;  4KCI A;  4NOS A;  4D33 A;  3NLM A;  4UH2 A;  4CWY A;  2FC2 A;  2G6H A;  1DF1 A;  3HSO A;  4CUM A;  4D2Y A;  5FVP A;  3N60 A;  1D0C A;  1LZX A;  3JWU A;  5ADK A;  5AGO A;  3N64 A;  1JWJ A;  3JX6 A;  1QW5 A;  4UH4 A;  4UGY A;  1NSI A;  2G6J A;  4D34 A;  2AMO A;  1QWC A;  2AN2 A;  3DQS A;  3RQO A;  4K5D A;  5FVX A;  2HX3 A;  1DD7 A;  1DM7 A;  2G6L A;  1ZZQ A;  1NSE A;  4CAQ A;  1D1W A;  1P6J A;  4FVX A;  4UPO A;  5ADJ A;  3N62 A;  3E6N A;  3EBF A;  5AGK A;  4V3V A;  4CX6 A;  1MMW A;  3NLH A;  1M9Q A;  3PNF A;  3NLZ A;  3JT5 A;  4CDT A;  4LUW A;  3JT4 A;  5G6G A;  3N69 A;  4UH1 A;  4UG9 A;  5G6M A;  1NOS A;  4KCR A;  5AGN A;  4CTR A;  3JWS A;  4D30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...