4UGDA

Structure of bacillus subtilis nitric oxide synthase in complex with 6-((((2s)-1-amino-4-((6-amino-4-methylpyridin-2-yl)methoxy)butan-2-yl) oxy)methyl)-4-methylpyridin-2-amine
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
362
structure length
362
Chain Sequence
EEKEILWNEAKAFIAACYQELGKAAEVKDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPPEEKGEKQVEIWNHQLIRYAGYESDGERIGDPASCSLTAACEELGWRGERTDFDLLPLIFRMKGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQAEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDKPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NITRIC OXIDE SYNTHASE OXYGENASE
publication title Inhibitor Bound Crystal Structures of Bacterial Nitric Oxide Synthase.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 121
structure length 362
sequence length 362
ec nomenclature ec 1.14.14.47: Nitric-oxide synthase (flavodoxin).
pdb deposition date 2015-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02898 NO_synthase Nitric oxide synthase, oxygenase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.340.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase; Chain A, domain 1 Nitric Oxide Synthase; Chain A, domain 1 4ugdA01
3.90.440.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase;Heme Domain; Chain A, domain 2 Nitric Oxide Synthase;Heme Domain;Chain A domain 2 4ugdA02
3.90.1230.10 Alpha Beta Alpha-Beta Complex Bovine Endothelial Nitric Oxide Synthase Heme Domain; Chain: A,domain 3 Nitric Oxide Synthase; Chain A, domain 3 4ugdA03
2NOSA 4KCIA 5FVQA 1QOMA 5G6CA 4CTZA 3JWWA 4CX5A 4UGBA 3UFQA 5FVWA 2AMOA 3SVPA 1OM5A 5G6PA 3TYOA 3B3MA 5ADBA 3N6GA 3HSNA 4CWZA 3UFTA 5AD9A 4K5GA 1JWKA 3N68A 3N6DA 1M00A 1K2SA 3TYNA 5FJ3A 4CARA 3NSEA 4CX6A 3JT3A 4UGMA 1K2UA 4GQEA 2ORQA 4UG8A 3EJ8A 3UFVA 4KCOA 3JX1A 3NLEA 4KCMA 4UGJA 4D7OA 5G0NA 1D0CA 4D33A 5AGNA 4UGXA 1D1YA 4UGWA 3N67A 4JS9A 3NLQA 2Y37A 4D3JA 3EBFA 3N5ZA 3NLNA 4CTYA 4CDTA 3N5RA 1ED6A 4CUNA 3E7GA 5G6GA 3N5XA 4D3AA 5FVUA 4FVYA 4CFTB 4D7JA 3NQSA 4CTRA 1OM4A 3DQRA 4UGRA 4D2YA 4V3UA 4UPMA 4K5JA 4KCKA 4UH7A 5G6IA 4D1PA 3NLHA 1D1VA 1ZVIA 1RS9A 4CUMA 1P6NA 2OROA 3RQNA 1FOOA 5G6NA 4D3MA 5G0PA 5AD7A 4UPQA 4UH2A 5FVTA 1QWCA 3UFPA 4NSEA 4UPTA 4UGQA 5G6DA 4K5EA 4CAOA 4D7IA 4UH6A 1ED4A 5ADDA 5FVPA 3JT8A 1DMIA 3JWZA 3JX0A 4CAPA 1ZZRA 5G66A 3PNHA 1M7VA 1ZVLA 1VAFA 3N6EA 3NLJA 4JSGA 5FVOA 4UGLA 4K5FA 1NODA 4KCHA 3NLOA 4D2ZA 4CTWA 4D37A 4CTXA 3JX6A 5AGOA 5ADLA 2AN0A 5FVVA 4C3AA 3TYMA 3E6NA 2FBZX 4CTQA 5G0OA 4K5HA 5ADMA 3NLUA 1P6LA 1M9KA 5G6LA 4V3YA 5AD4A 3JWVA 5FW0A 1K2RA 3N63A 3UFOA 3E7IA 1K2TA 1P6JA 4LUWA 4V3XA 3NW2A 3PNGA 4V3VA 4D38A 3N2RA 3NM0A 4LWAA 2NODA 3E7SA 3RQJA 4JSMA 1DMJA 1NSEA 1RS6A 3NLPA 3NLMA 3JT7A 4UGEA 3NLVA 3NOSA 4UPPA 2FLQA 3UFRA 5ADCA 4CVGA 8NSEA 4EUXA 2G6IA 4CAQA 3JWXA 3JX4A 3RQPA 4IMUA 1FOJA 2HX4A 4UPNA 3EAIA 4UPRA 5ADAA 4CX0A 1M9QA 3B3PA 5FVRA 3JWUA 4NOSA 3E68A 4D3UA 2G6MA 4D36A 1M8IA 2BHJA 1RS7A 5G6HA 3JT5A 5G68A 3N5SA 3N60A 3RQKA 1DWVA 3NLRA 3E67A 3DQTA 2G6JA 1FOPA 3N5PA 3N65A 1N2NA 4CU1A 1NOSA 4D1NA 1M8EA 5G6AA 4IMSA 3B3NA 4UGPA 6NSEA 4K5KA 4JSEA 1D0OA 4FVXA 4CX1A 1QW6A 1LZXA 3B3OA 5G6QA 4UGAA 9NSEA 4IMTA 4KCLA 3N6AA 4UH5A 4LWBA 3NLGA 4CTUA 4D39A 4JSIA 3JWYA 3RQLA 2AN2A 3N6BA 1DF1A 4UGCA 4CTVA 4D3KA 4UH8A 4KCRA 4UH1A 4KCSA 5AGKA 4CULA 3HSPA 5FVYA 2HX2A 4UH9A 5FVXA 3N66A 4K5DA 5AGMA 4CU0A 3N62A 4UHAA 2FC2A 4D34A 3NLFA 4CWWA 1I83A 1MMVA 4CANA 1P6MA 4UQRA 5G6KA 5AD6A 1LZZA 4CX4A 5G67A 4D35A 3NLTA 1D1XA 3E7SB 4FW0A 4CX3A 5ADEA 4UCHA 3PNFA 5G6EA 3NODA 5ADKA 1R35A 4CWYA 3FC5A 3N5VA 3N69A 4CAMA 3E7TA 4D31A 4UQSA 3UFWA 3N5QA 3N61A 1M8HA 4CX7A 4C39A 3JX2A 1JWJA 1DWWA 5FVSA 5AD8A 1QW4A 3Q9AA 1FOLA 4D3TA 3DQSA 1ED5A 1ZZUA 2NSEA 3JWTA 4IMWA 4D1OA 3NLYA 1RS8A 4D3IA 3UFSA 4UGTA 4UG6A 5G6MA 3EAHA 4FVZA 4CU1B 5ADNA 5ADGA 1D1WA 4CTTA 4CX2A 3EBDA 5G6FA 4UH0A 4UGUA 4CTPA 4JSHA 4UPSA 5AD5A 4V3WA 3N5YA 1NSIA 4UH3A 4UG5A 2NSIA 3Q99A 3PNEA 4UGZA 3UFUA 1DMKA 2ORTA 3JWSA 1DD7A 2ORRA 4V3ZA 3NNZA 4UGNA 4JSKA 1DM7A 5FVZA 3E6TA 4D3NA 4D3BA 5G6OA 7NSEA 5G65A 4JSLA 4UGIA 3NLKA 2G6HA 4UPOA 3E6OA 3TYLA 3N6CA 4UGFA 1P6HA 1M9TA 3JX3A 4UGVA 3RQMA 1M7ZA 4KCJA 5ADFA 3N5TA 4UGYA 1DWXA 1DM8A 3N64A 1P6KA 4UGSA 3SVQA 3JT6A 1FOIA 4UGOA 3E6LA 4D7HA 4CFTA 1ZZTA 4K5IA 4UGKA 4LUXA 4JSFA 3JTAA 3JT4A 4JSJA 2HX3A 5G69A 3NLZA 1P6IA 4IMXA 1MJTA 3NNYA 1MMWA 5G6JA 3JT9A 3E7MA 4UH4A 1ZZSA 5AGLA 3N6FA 1DM6A 5NSEA 5G6BA 3HSOA 2FC1A 2G6LA 4KCPA 4D32A 1M8DA 4CWVA 1M9MA 3NLIA 1M9JA 1QW5A 4CWXA 4D3OA 1VAGA 5AGPA 1Q2OA 2G6OA 1ZZQA 4UGHA 5FJ2A 5ADJA 4KCNA 4UG9A 4D30A 3NLXA 4UGDA 2ORSA 3RQOA 3N5WA 3DWJA 1M9RA 2G6KA 3JX5A 5ADIA 3NLWA 4D3VA 3NLDA 4FVWA 2G6NA 1NOCA 4KCQA 4UG7A 4UGGA 2ORPA 3E65A
chains in the Genus database with same CATH superfamily
2NOSA 4KCIA 5FVQA 1QOMA 5G6CA 4CTZA 3JWWA 4CX5A 4UGBA 3UFQA 5FVWA 2AMOA 3SVPA 1OM5A 5G6PA 3TYOA 3B3MA 5ADBA 3N6GA 3HSNA 4CWZA 3UFTA 5AD9A 4K5GA 1JWKA 3N68A 3N6DA 1M00A 1K2SA 3TYNA 5FJ3A 4CARA 3NSEA 4CX6A 3JT3A 4UGMA 1K2UA 4GQEA 2ORQA 4UG8A 3EJ8A 3UFVA 4KCOA 3JX1A 3NLEA 4KCMA 4UGJA 4D7OA 5G0NA 1D0CA 4D33A 5AGNA 4UGXA 1D1YA 4UGWA 3N67A 4JS9A 3NLQA 2Y37A 4D3JA 3EBFA 3N5ZA 3NLNA 4CTYA 4CDTA 3N5RA 1ED6A 4CUNA 3E7GA 5G6GA 3N5XA 4D3AA 5FVUA 4FVYA 4CFTB 4D7JA 3NQSA 4CTRA 1OM4A 3DQRA 4UGRA 4D2YA 4V3UA 4UPMA 4K5JA 4KCKA 4UH7A 5G6IA 4D1PA 3NLHA 1D1VA 1ZVIA 1RS9A 4CUMA 1P6NA 2OROA 3RQNA 1FOOA 5G6NA 4D3MA 5G0PA 5AD7A 4UPQA 4UH2A 5FVTA 1QWCA 3UFPA 4NSEA 4UPTA 4UGQA 5G6DA 4K5EA 4CAOA 4D7IA 4UH6A 1ED4A 5ADDA 5FVPA 3JT8A 1DMIA 3JWZA 3JX0A 4CAPA 1ZZRA 5G66A 3PNHA 1M7VA 1ZVLA 1VAFA 3N6EA 3NLJA 4JSGA 5FVOA 4UGLA 4K5FA 1NODA 4KCHA 3NLOA 4D2ZA 4CTWA 4D37A 4CTXA 3JX6A 5AGOA 5ADLA 2AN0A 5FVVA 4C3AA 3TYMA 3E6NA 2FBZX 4CTQA 5G0OA 4K5HA 5ADMA 3NLUA 1P6LA 1M9KA 5G6LA 4V3YA 5AD4A 3JWVA 5FW0A 1K2RA 3N63A 3UFOA 3E7IA 1K2TA 1P6JA 4LUWA 4V3XA 3NW2A 3PNGA 4V3VA 4D38A 3N2RA 3NM0A 4LWAA 2NODA 3E7SA 3RQJA 4JSMA 1DMJA 1NSEA 1RS6A 3NLPA 3NLMA 3JT7A 4UGEA 3NLVA 3NOSA 4UPPA 2FLQA 3UFRA 5ADCA 4CVGA 8NSEA 4EUXA 2G6IA 4CAQA 3JWXA 3JX4A 3RQPA 4IMUA 1FOJA 2HX4A 4UPNA 3EAIA 4UPRA 5ADAA 4CX0A 1M9QA 3B3PA 5FVRA 3JWUA 4NOSA 3E68A 4D3UA 2G6MA 4D36A 1M8IA 2BHJA 1RS7A 5G6HA 3JT5A 5G68A 3N5SA 3N60A 3RQKA 1DWVA 3NLRA 3E67A 3DQTA 2G6JA 1FOPA 3N5PA 3N65A 1N2NA 4CU1A 1NOSA 4D1NA 1M8EA 5G6AA 4IMSA 3B3NA 4UGPA 6NSEA 4K5KA 4JSEA 1D0OA 4FVXA 4CX1A 1QW6A 1LZXA 3B3OA 5G6QA 4UGAA 9NSEA 4IMTA 4KCLA 3N6AA 4UH5A 4LWBA 3NLGA 4CTUA 4D39A 4JSIA 3JWYA 3RQLA 2AN2A 3N6BA 1DF1A 4UGCA 4CTVA 4D3KA 4UH8A 4KCRA 4UH1A 4KCSA 5AGKA 4CULA 3HSPA 5FVYA 2HX2A 4UH9A 5FVXA 3N66A 4K5DA 5AGMA 4CU0A 3N62A 4UHAA 2FC2A 4D34A 3NLFA 4CWWA 1I83A 1MMVA 4CANA 1P6MA 4UQRA 5G6KA 5AD6A 1LZZA 4CX4A 5G67A 4D35A 3NLTA 1D1XA 3E7SB 4FW0A 4CX3A 5ADEA 4UCHA 3PNFA 5G6EA 3NODA 5ADKA 1R35A 4CWYA 3FC5A 3N5VA 3N69A 4CAMA 3E7TA 4D31A 4UQSA 3UFWA 3N5QA 3N61A 1M8HA 4CX7A 4C39A 3JX2A 1JWJA 1DWWA 5FVSA 5AD8A 1QW4A 3Q9AA 1FOLA 4D3TA 3DQSA 1ED5A 1ZZUA 2NSEA 3JWTA 4IMWA 4D1OA 3NLYA 1RS8A 4D3IA 3UFSA 4UGTA 4UG6A 5G6MA 3EAHA 4FVZA 4CU1B 5ADNA 5ADGA 1D1WA 4CTTA 4CX2A 3EBDA 5G6FA 4UH0A 4UGUA 4CTPA 4JSHA 4UPSA 5AD5A 4V3WA 3N5YA 1NSIA 4UH3A 4UG5A 2NSIA 3Q99A 3PNEA 4UGZA 3UFUA 1DMKA 2ORTA 3JWSA 1DD7A 2ORRA 4V3ZA 3NNZA 4UGNA 4JSKA 1DM7A 5FVZA 3E6TA 4D3NA 4D3BA 5G6OA 7NSEA 5G65A 4JSLA 4UGIA 3NLKA 2G6HA 4UPOA 3E6OA 3TYLA 3N6CA 4UGFA 1P6HA 1M9TA 3JX3A 4UGVA 3RQMA 1M7ZA 4KCJA 5ADFA 3N5TA 4UGYA 1DWXA 1DM8A 3N64A 1P6KA 4UGSA 3SVQA 3JT6A 1FOIA 4UGOA 3E6LA 4D7HA 4CFTA 1ZZTA 4K5IA 4UGKA 4LUXA 4JSFA 3JTAA 3JT4A 4JSJA 2HX3A 5G69A 3NLZA 1P6IA 4IMXA 1MJTA 3NNYA 1MMWA 5G6JA 3JT9A 3E7MA 4UH4A 1ZZSA 5AGLA 3N6FA 1DM6A 5NSEA 5G6BA 3HSOA 2FC1A 2G6LA 4KCPA 4D32A 1M8DA 4CWVA 1M9MA 3NLIA 1M9JA 1QW5A 4CWXA 4D3OA 1VAGA 5AGPA 1Q2OA 2G6OA 1ZZQA 4UGHA 5FJ2A 5ADJA 4KCNA 4UG9A 4D30A 3NLXA 4UGDA 2ORSA 3RQOA 3N5WA 3DWJA 1M9RA 2G6KA 3JX5A 5ADIA 3NLWA 4D3VA 3NLDA 4FVWA 2G6NA 1NOCA 4KCQA 4UG7A 4UGGA 2ORPA 3E65A
chains in the Genus database with same CATH topology
2NOSA 4KCIA 5FVQA 1QOMA 5G6CA 4CTZA 3JWWA 4CX5A 4UGBA 3UFQA 5FVWA 2AMOA 3SVPA 1OM5A 5G6PA 3TYOA 3B3MA 5ADBA 3N6GA 3HSNA 4CWZA 3UFTA 5AD9A 4K5GA 1JWKA 3N68A 3N6DA 1M00A 1K2SA 3TYNA 5FJ3A 4CARA 3NSEA 4CX6A 3JT3A 4UGMA 1K2UA 4GQEA 2ORQA 4UG8A 3EJ8A 3UFVA 4KCOA 3JX1A 3NLEA 4KCMA 4UGJA 4D7OA 5G0NA 1D0CA 4D33A 5AGNA 4UGXA 1D1YA 4UGWA 3N67A 4JS9A 3NLQA 2Y37A 4D3JA 3EBFA 3N5ZA 3NLNA 4CTYA 4CDTA 3N5RA 1ED6A 4CUNA 3E7GA 5G6GA 3N5XA 4D3AA 5FVUA 4FVYA 4CFTB 4D7JA 3NQSA 4CTRA 1OM4A 3DQRA 4UGRA 4D2YA 4V3UA 4UPMA 4K5JA 4KCKA 4UH7A 5G6IA 4D1PA 3NLHA 1D1VA 1ZVIA 1RS9A 4CUMA 1P6NA 2OROA 3RQNA 1FOOA 5G6NA 4D3MA 5G0PA 5AD7A 4UPQA 4UH2A 5FVTA 1QWCA 3UFPA 4NSEA 4UPTA 4UGQA 5G6DA 4K5EA 4CAOA 4D7IA 4UH6A 1ED4A 5ADDA 5FVPA 3JT8A 1DMIA 3JWZA 3JX0A 4CAPA 1ZZRA 5G66A 3PNHA 1M7VA 1ZVLA 1VAFA 3N6EA 3NLJA 4JSGA 5FVOA 4UGLA 4K5FA 1NODA 4KCHA 3NLOA 4D2ZA 4CTWA 4D37A 4CTXA 3JX6A 5AGOA 5ADLA 2AN0A 5FVVA 4C3AA 3TYMA 3E6NA 2FBZX 4CTQA 5G0OA 4K5HA 5ADMA 3NLUA 1P6LA 1M9KA 5G6LA 4V3YA 5AD4A 3JWVA 5FW0A 1K2RA 3N63A 3UFOA 3E7IA 1K2TA 1P6JA 4LUWA 4V3XA 3NW2A 3PNGA 4V3VA 4D38A 3N2RA 3NM0A 4LWAA 2NODA 3E7SA 3RQJA 4JSMA 1DMJA 1NSEA 1RS6A 3NLPA 3NLMA 3JT7A 4UGEA 3NLVA 3NOSA 4UPPA 2FLQA 3UFRA 5ADCA 4CVGA 8NSEA 4EUXA 2G6IA 4CAQA 3JWXA 3JX4A 3RQPA 4IMUA 1FOJA 2HX4A 4UPNA 3EAIA 4UPRA 5ADAA 4CX0A 1M9QA 3B3PA 5FVRA 3JWUA 4NOSA 3E68A 4D3UA 2G6MA 4D36A 1M8IA 2BHJA 1RS7A 5G6HA 3JT5A 5G68A 3N5SA 3N60A 3RQKA 1DWVA 3NLRA 3E67A 3DQTA 2G6JA 1FOPA 3N5PA 3N65A 1N2NA 4CU1A 1NOSA 4D1NA 1M8EA 5G6AA 4IMSA 3B3NA 4UGPA 6NSEA 4K5KA 4JSEA 1D0OA 4FVXA 4CX1A 1QW6A 1LZXA 3B3OA 5G6QA 4UGAA 9NSEA 4IMTA 4KCLA 3N6AA 4UH5A 4LWBA 3NLGA 4CTUA 4D39A 4JSIA 3JWYA 3RQLA 2AN2A 3N6BA 1DF1A 4UGCA 4CTVA 4D3KA 4UH8A 4KCRA 4UH1A 4KCSA 5AGKA 4CULA 3HSPA 5FVYA 2HX2A 4UH9A 5FVXA 3N66A 4K5DA 5AGMA 4CU0A 3N62A 4UHAA 2FC2A 4D34A 3NLFA 4CWWA 1I83A 1MMVA 4CANA 1P6MA 4UQRA 5G6KA 5AD6A 1LZZA 4CX4A 5G67A 4D35A 3NLTA 1D1XA 3E7SB 4FW0A 4CX3A 5ADEA 4UCHA 3PNFA 5G6EA 3NODA 5ADKA 1R35A 4CWYA 3FC5A 3N5VA 3N69A 4CAMA 3E7TA 4D31A 4UQSA 3UFWA 3N5QA 3N61A 1M8HA 4CX7A 4C39A 3JX2A 1JWJA 1DWWA 5FVSA 5AD8A 1QW4A 3Q9AA 1FOLA 4D3TA 3DQSA 1ED5A 1ZZUA 2NSEA 3JWTA 4IMWA 4D1OA 3NLYA 1RS8A 4D3IA 3UFSA 4UGTA 4UG6A 5G6MA 3EAHA 4FVZA 4CU1B 5ADNA 5ADGA 1D1WA 4CTTA 4CX2A 3EBDA 5G6FA 4UH0A 4UGUA 4CTPA 4JSHA 4UPSA 5AD5A 4V3WA 3N5YA 1NSIA 4UH3A 4UG5A 2NSIA 3Q99A 3PNEA 4UGZA 3UFUA 1DMKA 2ORTA 3JWSA 1DD7A 2ORRA 4V3ZA 3NNZA 4UGNA 4JSKA 1DM7A 5FVZA 3E6TA 4D3NA 4D3BA 5G6OA 7NSEA 5G65A 4JSLA 4UGIA 3NLKA 2G6HA 4UPOA 3E6OA 3TYLA 3N6CA 4UGFA 1P6HA 1M9TA 3JX3A 4UGVA 3RQMA 1M7ZA 4KCJA 5ADFA 3N5TA 4UGYA 1DWXA 1DM8A 3N64A 1P6KA 4UGSA 3SVQA 3JT6A 1FOIA 4UGOA 3E6LA 4D7HA 4CFTA 1ZZTA 4K5IA 4UGKA 4LUXA 4JSFA 3JTAA 3JT4A 4JSJA 2HX3A 5G69A 3NLZA 1P6IA 4IMXA 1MJTA 3NNYA 1MMWA 5G6JA 3JT9A 3E7MA 4UH4A 1ZZSA 5AGLA 3N6FA 1DM6A 5NSEA 5G6BA 3HSOA 2FC1A 2G6LA 4KCPA 4D32A 1M8DA 4CWVA 1M9MA 3NLIA 1M9JA 1QW5A 4CWXA 4D3OA 1VAGA 5AGPA 1Q2OA 2G6OA 1ZZQA 4UGHA 5FJ2A 5ADJA 4KCNA 4UG9A 4D30A 3NLXA 4UGDA 2ORSA 3RQOA 3N5WA 3DWJA 1M9RA 2G6KA 3JX5A 5ADIA 3NLWA 4D3VA 3NLDA 4FVWA 2G6NA 1NOCA 4KCQA 4UG7A 4UGGA 2ORPA 3E65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NOS A;  4KCI A;  5FVQ A;  1QOM A;  5G6C A;  4CTZ A;  3JWW A;  4CX5 A;  4UGB A;  3UFQ A;  5FVW A;  2AMO A;  3SVP A;  1OM5 A;  5G6P A;  3TYO A;  3B3M A;  5ADB A;  3N6G A;  3HSN A;  4CWZ A;  3UFT A;  5AD9 A;  4K5G A;  1JWK A;  3N68 A;  3N6D A;  1M00 A;  1K2S A;  3TYN A;  5FJ3 A;  4CAR A;  3NSE A;  4CX6 A;  3JT3 A;  4UGM A;  1K2U A;  4GQE A;  2ORQ A;  4UG8 A;  3EJ8 A;  3UFV A;  4KCO A;  3JX1 A;  3NLE A;  4KCM A;  4UGJ A;  4D7O A;  5G0N A;  1D0C A;  4D33 A;  5AGN A;  4UGX A;  1D1Y A;  4UGW A;  3N67 A;  4JS9 A;  3NLQ A;  2Y37 A;  4D3J A;  3EBF A;  3N5Z A;  3NLN A;  4CTY A;  4CDT A;  3N5R A;  1ED6 A;  4CUN A;  3E7G A;  5G6G A;  3N5X A;  4D3A A;  5FVU A;  4FVY A;  4CFT B;  4D7J A;  3NQS A;  4CTR A;  1OM4 A;  3DQR A;  4UGR A;  4D2Y A;  4V3U A;  4UPM A;  4K5J A;  4KCK A;  4UH7 A;  5G6I A;  4D1P A;  3NLH A;  1D1V A;  1ZVI A;  1RS9 A;  4CUM A;  1P6N A;  2ORO A;  3RQN A;  1FOO A;  5G6N A;  4D3M A;  5G0P A;  5AD7 A;  4UPQ A;  4UH2 A;  5FVT A;  1QWC A;  3UFP A;  4NSE A;  4UPT A;  4UGQ A;  5G6D A;  4K5E A;  4CAO A;  4D7I A;  4UH6 A;  1ED4 A;  5ADD A;  5FVP A;  3JT8 A;  1DMI A;  3JWZ A;  3JX0 A;  4CAP A;  1ZZR A;  5G66 A;  3PNH A;  1M7V A;  1ZVL A;  1VAF A;  3N6E A;  3NLJ A;  4JSG A;  5FVO A;  4UGL A;  4K5F A;  1NOD A;  4KCH A;  3NLO A;  4D2Z A;  4CTW A;  4D37 A;  4CTX A;  3JX6 A;  5AGO A;  5ADL A;  2AN0 A;  5FVV A;  4C3A A;  3TYM A;  3E6N A;  2FBZ X;  4CTQ A;  5G0O A;  4K5H A;  5ADM A;  3NLU A;  1P6L A;  1M9K A;  5G6L A;  4V3Y A;  5AD4 A;  3JWV A;  5FW0 A;  1K2R A;  3N63 A;  3UFO A;  3E7I A;  1K2T A;  1P6J A;  4LUW A;  4V3X A;  3NW2 A;  3PNG A;  4V3V A;  4D38 A;  3N2R A;  3NM0 A;  4LWA A;  2NOD A;  3E7S A;  3RQJ A;  4JSM A;  1DMJ A;  1NSE A;  1RS6 A;  3NLP A;  3NLM A;  3JT7 A;  4UGE A;  3NLV A;  3NOS A;  4UPP A;  2FLQ A;  3UFR A;  5ADC A;  4CVG A;  8NSE A;  4EUX A;  2G6I A;  4CAQ A;  3JWX A;  3JX4 A;  3RQP A;  4IMU A;  1FOJ A;  2HX4 A;  4UPN A;  3EAI A;  4UPR A;  5ADA A;  4CX0 A;  1M9Q A;  3B3P A;  5FVR A;  3JWU A;  4NOS A;  3E68 A;  4D3U A;  2G6M A;  4D36 A;  1M8I A;  2BHJ A;  1RS7 A;  5G6H A;  3JT5 A;  5G68 A;  3N5S A;  3N60 A;  3RQK A;  1DWV A;  3NLR A;  3E67 A;  3DQT A;  2G6J A;  1FOP A;  3N5P A;  3N65 A;  1N2N A;  4CU1 A;  1NOS A;  4D1N A;  1M8E A;  5G6A A;  4IMS A;  3B3N A;  4UGP A;  6NSE A;  4K5K A;  4JSE A;  1D0O A;  4FVX A;  4CX1 A;  1QW6 A;  1LZX A;  3B3O A;  5G6Q A;  4UGA A;  9NSE A;  4IMT A;  4KCL A;  3N6A A;  4UH5 A;  4LWB A;  3NLG A;  4CTU A;  4D39 A;  4JSI A;  3JWY A;  3RQL A;  2AN2 A;  3N6B A;  1DF1 A;  4UGC A;  4CTV A;  4D3K A;  4UH8 A;  4KCR A;  4UH1 A;  4KCS A;  5AGK A;  4CUL A;  3HSP A;  5FVY A;  2HX2 A;  4UH9 A;  5FVX A;  3N66 A;  4K5D A;  5AGM A;  4CU0 A;  3N62 A;  4UHA A;  2FC2 A;  4D34 A;  3NLF A;  4CWW A;  1I83 A;  1MMV A;  4CAN A;  1P6M A;  4UQR A;  5G6K A;  5AD6 A;  1LZZ A;  4CX4 A;  5G67 A;  4D35 A;  3NLT A;  1D1X A;  3E7S B;  4FW0 A;  4CX3 A;  5ADE A;  4UCH A;  3PNF A;  5G6E A;  3NOD A;  5ADK A;  1R35 A;  4CWY A;  3FC5 A;  3N5V A;  3N69 A;  4CAM A;  3E7T A;  4D31 A;  4UQS A;  3UFW A;  3N5Q A;  3N61 A;  1M8H A;  4CX7 A;  4C39 A;  3JX2 A;  1JWJ A;  1DWW A;  5FVS A;  5AD8 A;  1QW4 A;  3Q9A A;  1FOL A;  4D3T A;  3DQS A;  1ED5 A;  1ZZU A;  2NSE A;  3JWT A;  4IMW A;  4D1O A;  3NLY A;  1RS8 A;  4D3I A;  3UFS A;  4UGT A;  4UG6 A;  5G6M A;  3EAH A;  4FVZ A;  4CU1 B;  5ADN A;  5ADG A;  1D1W A;  4CTT A;  4CX2 A;  3EBD A;  5G6F A;  4UH0 A;  4UGU A;  4CTP A;  4JSH A;  4UPS A;  5AD5 A;  4V3W A;  3N5Y A;  1NSI A;  4UH3 A;  4UG5 A;  2NSI A;  3Q99 A;  3PNE A;  4UGZ A;  3UFU A;  1DMK A;  2ORT A;  3JWS A;  1DD7 A;  2ORR A;  4V3Z A;  3NNZ A;  4UGN A;  4JSK A;  1DM7 A;  5FVZ A;  3E6T A;  4D3N A;  4D3B A;  5G6O A;  7NSE A;  5G65 A;  4JSL A;  4UGI A;  3NLK A;  2G6H A;  4UPO A;  3E6O A;  3TYL A;  3N6C A;  4UGF A;  1P6H A;  1M9T A;  3JX3 A;  4UGV A;  3RQM A;  1M7Z A;  4KCJ A;  5ADF A;  3N5T A;  4UGY A;  1DWX A;  1DM8 A;  3N64 A;  1P6K A;  4UGS A;  3SVQ A;  3JT6 A;  1FOI A;  4UGO A;  3E6L A;  4D7H A;  4CFT A;  1ZZT A;  4K5I A;  4UGK A;  4LUX A;  4JSF A;  3JTA A;  3JT4 A;  4JSJ A;  2HX3 A;  5G69 A;  3NLZ A;  1P6I A;  4IMX A;  1MJT A;  3NNY A;  1MMW A;  5G6J A;  3JT9 A;  3E7M A;  4UH4 A;  1ZZS A;  5AGL A;  3N6F A;  1DM6 A;  5NSE A;  5G6B A;  3HSO A;  2FC1 A;  2G6L A;  4KCP A;  4D32 A;  1M8D A;  4CWV A;  1M9M A;  3NLI A;  1M9J A;  1QW5 A;  4CWX A;  4D3O A;  1VAG A;  5AGP A;  1Q2O A;  2G6O A;  1ZZQ A;  4UGH A;  5FJ2 A;  5ADJ A;  4KCN A;  4UG9 A;  4D30 A;  3NLX A;  4UGD A;  2ORS A;  3RQO A;  3N5W A;  3DWJ A;  1M9R A;  2G6K A;  3JX5 A;  5ADI A;  3NLW A;  4D3V A;  3NLD A;  4FVW A;  2G6N A;  1NOC A;  4KCQ A;  4UG7 A;  4UGG A;  2ORP A;  3E65 A; 
#chains in the Genus database with same CATH topology
 2NOS A;  4KCI A;  5FVQ A;  1QOM A;  5G6C A;  4CTZ A;  3JWW A;  4CX5 A;  4UGB A;  3UFQ A;  5FVW A;  2AMO A;  3SVP A;  1OM5 A;  5G6P A;  3TYO A;  3B3M A;  5ADB A;  3N6G A;  3HSN A;  4CWZ A;  3UFT A;  5AD9 A;  4K5G A;  1JWK A;  3N68 A;  3N6D A;  1M00 A;  1K2S A;  3TYN A;  5FJ3 A;  4CAR A;  3NSE A;  4CX6 A;  3JT3 A;  4UGM A;  1K2U A;  4GQE A;  2ORQ A;  4UG8 A;  3EJ8 A;  3UFV A;  4KCO A;  3JX1 A;  3NLE A;  4KCM A;  4UGJ A;  4D7O A;  5G0N A;  1D0C A;  4D33 A;  5AGN A;  4UGX A;  1D1Y A;  4UGW A;  3N67 A;  4JS9 A;  3NLQ A;  2Y37 A;  4D3J A;  3EBF A;  3N5Z A;  3NLN A;  4CTY A;  4CDT A;  3N5R A;  1ED6 A;  4CUN A;  3E7G A;  5G6G A;  3N5X A;  4D3A A;  5FVU A;  4FVY A;  4CFT B;  4D7J A;  3NQS A;  4CTR A;  1OM4 A;  3DQR A;  4UGR A;  4D2Y A;  4V3U A;  4UPM A;  4K5J A;  4KCK A;  4UH7 A;  5G6I A;  4D1P A;  3NLH A;  1D1V A;  1ZVI A;  1RS9 A;  4CUM A;  1P6N A;  2ORO A;  3RQN A;  1FOO A;  5G6N A;  4D3M A;  5G0P A;  5AD7 A;  4UPQ A;  4UH2 A;  5FVT A;  1QWC A;  3UFP A;  4NSE A;  4UPT A;  4UGQ A;  5G6D A;  4K5E A;  4CAO A;  4D7I A;  4UH6 A;  1ED4 A;  5ADD A;  5FVP A;  3JT8 A;  1DMI A;  3JWZ A;  3JX0 A;  4CAP A;  1ZZR A;  5G66 A;  3PNH A;  1M7V A;  1ZVL A;  1VAF A;  3N6E A;  3NLJ A;  4JSG A;  5FVO A;  4UGL A;  4K5F A;  1NOD A;  4KCH A;  3NLO A;  4D2Z A;  4CTW A;  4D37 A;  4CTX A;  3JX6 A;  5AGO A;  5ADL A;  2AN0 A;  5FVV A;  4C3A A;  3TYM A;  3E6N A;  2FBZ X;  4CTQ A;  5G0O A;  4K5H A;  5ADM A;  3NLU A;  1P6L A;  1M9K A;  5G6L A;  4V3Y A;  5AD4 A;  3JWV A;  5FW0 A;  1K2R A;  3N63 A;  3UFO A;  3E7I A;  1K2T A;  1P6J A;  4LUW A;  4V3X A;  3NW2 A;  3PNG A;  4V3V A;  4D38 A;  3N2R A;  3NM0 A;  4LWA A;  2NOD A;  3E7S A;  3RQJ A;  4JSM A;  1DMJ A;  1NSE A;  1RS6 A;  3NLP A;  3NLM A;  3JT7 A;  4UGE A;  3NLV A;  3NOS A;  4UPP A;  2FLQ A;  3UFR A;  5ADC A;  4CVG A;  8NSE A;  4EUX A;  2G6I A;  4CAQ A;  3JWX A;  3JX4 A;  3RQP A;  4IMU A;  1FOJ A;  2HX4 A;  4UPN A;  3EAI A;  4UPR A;  5ADA A;  4CX0 A;  1M9Q A;  3B3P A;  5FVR A;  3JWU A;  4NOS A;  3E68 A;  4D3U A;  2G6M A;  4D36 A;  1M8I A;  2BHJ A;  1RS7 A;  5G6H A;  3JT5 A;  5G68 A;  3N5S A;  3N60 A;  3RQK A;  1DWV A;  3NLR A;  3E67 A;  3DQT A;  2G6J A;  1FOP A;  3N5P A;  3N65 A;  1N2N A;  4CU1 A;  1NOS A;  4D1N A;  1M8E A;  5G6A A;  4IMS A;  3B3N A;  4UGP A;  6NSE A;  4K5K A;  4JSE A;  1D0O A;  4FVX A;  4CX1 A;  1QW6 A;  1LZX A;  3B3O A;  5G6Q A;  4UGA A;  9NSE A;  4IMT A;  4KCL A;  3N6A A;  4UH5 A;  4LWB A;  3NLG A;  4CTU A;  4D39 A;  4JSI A;  3JWY A;  3RQL A;  2AN2 A;  3N6B A;  1DF1 A;  4UGC A;  4CTV A;  4D3K A;  4UH8 A;  4KCR A;  4UH1 A;  4KCS A;  5AGK A;  4CUL A;  3HSP A;  5FVY A;  2HX2 A;  4UH9 A;  5FVX A;  3N66 A;  4K5D A;  5AGM A;  4CU0 A;  3N62 A;  4UHA A;  2FC2 A;  4D34 A;  3NLF A;  4CWW A;  1I83 A;  1MMV A;  4CAN A;  1P6M A;  4UQR A;  5G6K A;  5AD6 A;  1LZZ A;  4CX4 A;  5G67 A;  4D35 A;  3NLT A;  1D1X A;  3E7S B;  4FW0 A;  4CX3 A;  5ADE A;  4UCH A;  3PNF A;  5G6E A;  3NOD A;  5ADK A;  1R35 A;  4CWY A;  3FC5 A;  3N5V A;  3N69 A;  4CAM A;  3E7T A;  4D31 A;  4UQS A;  3UFW A;  3N5Q A;  3N61 A;  1M8H A;  4CX7 A;  4C39 A;  3JX2 A;  1JWJ A;  1DWW A;  5FVS A;  5AD8 A;  1QW4 A;  3Q9A A;  1FOL A;  4D3T A;  3DQS A;  1ED5 A;  1ZZU A;  2NSE A;  3JWT A;  4IMW A;  4D1O A;  3NLY A;  1RS8 A;  4D3I A;  3UFS A;  4UGT A;  4UG6 A;  5G6M A;  3EAH A;  4FVZ A;  4CU1 B;  5ADN A;  5ADG A;  1D1W A;  4CTT A;  4CX2 A;  3EBD A;  5G6F A;  4UH0 A;  4UGU A;  4CTP A;  4JSH A;  4UPS A;  5AD5 A;  4V3W A;  3N5Y A;  1NSI A;  4UH3 A;  4UG5 A;  2NSI A;  3Q99 A;  3PNE A;  4UGZ A;  3UFU A;  1DMK A;  2ORT A;  3JWS A;  1DD7 A;  2ORR A;  4V3Z A;  3NNZ A;  4UGN A;  4JSK A;  1DM7 A;  5FVZ A;  3E6T A;  4D3N A;  4D3B A;  5G6O A;  7NSE A;  5G65 A;  4JSL A;  4UGI A;  3NLK A;  2G6H A;  4UPO A;  3E6O A;  3TYL A;  3N6C A;  4UGF A;  1P6H A;  1M9T A;  3JX3 A;  4UGV A;  3RQM A;  1M7Z A;  4KCJ A;  5ADF A;  3N5T A;  4UGY A;  1DWX A;  1DM8 A;  3N64 A;  1P6K A;  4UGS A;  3SVQ A;  3JT6 A;  1FOI A;  4UGO A;  3E6L A;  4D7H A;  4CFT A;  1ZZT A;  4K5I A;  4UGK A;  4LUX A;  4JSF A;  3JTA A;  3JT4 A;  4JSJ A;  2HX3 A;  5G69 A;  3NLZ A;  1P6I A;  4IMX A;  1MJT A;  3NNY A;  1MMW A;  5G6J A;  3JT9 A;  3E7M A;  4UH4 A;  1ZZS A;  5AGL A;  3N6F A;  1DM6 A;  5NSE A;  5G6B A;  3HSO A;  2FC1 A;  2G6L A;  4KCP A;  4D32 A;  1M8D A;  4CWV A;  1M9M A;  3NLI A;  1M9J A;  1QW5 A;  4CWX A;  4D3O A;  1VAG A;  5AGP A;  1Q2O A;  2G6O A;  1ZZQ A;  4UGH A;  5FJ2 A;  5ADJ A;  4KCN A;  4UG9 A;  4D30 A;  3NLX A;  4UGD A;  2ORS A;  3RQO A;  3N5W A;  3DWJ A;  1M9R A;  2G6K A;  3JX5 A;  5ADI A;  3NLW A;  4D3V A;  3NLD A;  4FVW A;  2G6N A;  1NOC A;  4KCQ A;  4UG7 A;  4UGG A;  2ORP A;  3E65 A; 
#chains in the Genus database with same CATH homology
 2NOS A;  4KCI A;  5FVQ A;  1QOM A;  5G6C A;  4CTZ A;  3JWW A;  4CX5 A;  4UGB A;  3UFQ A;  5FVW A;  2AMO A;  3SVP A;  1OM5 A;  5G6P A;  3TYO A;  3B3M A;  5ADB A;  3N6G A;  3HSN A;  4CWZ A;  3UFT A;  5AD9 A;  4K5G A;  1JWK A;  3N68 A;  3N6D A;  1M00 A;  1K2S A;  3TYN A;  5FJ3 A;  4CAR A;  3NSE A;  4CX6 A;  3JT3 A;  4UGM A;  1K2U A;  4GQE A;  2ORQ A;  4UG8 A;  3EJ8 A;  3UFV A;  4KCO A;  3JX1 A;  3NLE A;  4KCM A;  4UGJ A;  4D7O A;  5G0N A;  1D0C A;  4D33 A;  5AGN A;  4UGX A;  1D1Y A;  4UGW A;  3N67 A;  4JS9 A;  3NLQ A;  2Y37 A;  4D3J A;  3EBF A;  3N5Z A;  3NLN A;  4CTY A;  4CDT A;  3N5R A;  1ED6 A;  4CUN A;  3E7G A;  5G6G A;  3N5X A;  4D3A A;  5FVU A;  4FVY A;  4CFT B;  4D7J A;  3NQS A;  4CTR A;  1OM4 A;  3DQR A;  4UGR A;  4D2Y A;  4V3U A;  4UPM A;  4K5J A;  4KCK A;  4UH7 A;  5G6I A;  4D1P A;  3NLH A;  1D1V A;  1ZVI A;  1RS9 A;  4CUM A;  1P6N A;  2ORO A;  3RQN A;  1FOO A;  5G6N A;  4D3M A;  5G0P A;  5AD7 A;  4UPQ A;  4UH2 A;  5FVT A;  1QWC A;  3UFP A;  4NSE A;  4UPT A;  4UGQ A;  5G6D A;  4K5E A;  4CAO A;  4D7I A;  4UH6 A;  1ED4 A;  5ADD A;  5FVP A;  3JT8 A;  1DMI A;  3JWZ A;  3JX0 A;  4CAP A;  1ZZR A;  5G66 A;  3PNH A;  1M7V A;  1ZVL A;  1VAF A;  3N6E A;  3NLJ A;  4JSG A;  5FVO A;  4UGL A;  4K5F A;  1NOD A;  4KCH A;  3NLO A;  4D2Z A;  4CTW A;  4D37 A;  4CTX A;  3JX6 A;  5AGO A;  5ADL A;  2AN0 A;  5FVV A;  4C3A A;  3TYM A;  3E6N A;  2FBZ X;  4CTQ A;  5G0O A;  4K5H A;  5ADM A;  3NLU A;  1P6L A;  1M9K A;  5G6L A;  4V3Y A;  5AD4 A;  3JWV A;  5FW0 A;  1K2R A;  3N63 A;  3UFO A;  3E7I A;  1K2T A;  1P6J A;  4LUW A;  4V3X A;  3NW2 A;  3PNG A;  4V3V A;  4D38 A;  3N2R A;  3NM0 A;  4LWA A;  2NOD A;  3E7S A;  3RQJ A;  4JSM A;  1DMJ A;  1NSE A;  1RS6 A;  3NLP A;  3NLM A;  3JT7 A;  4UGE A;  3NLV A;  3NOS A;  4UPP A;  2FLQ A;  3UFR A;  5ADC A;  4CVG A;  8NSE A;  4EUX A;  2G6I A;  4CAQ A;  3JWX A;  3JX4 A;  3RQP A;  4IMU A;  1FOJ A;  2HX4 A;  4UPN A;  3EAI A;  4UPR A;  5ADA A;  4CX0 A;  1M9Q A;  3B3P A;  5FVR A;  3JWU A;  4NOS A;  3E68 A;  4D3U A;  2G6M A;  4D36 A;  1M8I A;  2BHJ A;  1RS7 A;  5G6H A;  3JT5 A;  5G68 A;  3N5S A;  3N60 A;  3RQK A;  1DWV A;  3NLR A;  3E67 A;  3DQT A;  2G6J A;  1FOP A;  3N5P A;  3N65 A;  1N2N A;  4CU1 A;  1NOS A;  4D1N A;  1M8E A;  5G6A A;  4IMS A;  3B3N A;  4UGP A;  6NSE A;  4K5K A;  4JSE A;  1D0O A;  4FVX A;  4CX1 A;  1QW6 A;  1LZX A;  3B3O A;  5G6Q A;  4UGA A;  9NSE A;  4IMT A;  4KCL A;  3N6A A;  4UH5 A;  4LWB A;  3NLG A;  4CTU A;  4D39 A;  4JSI A;  3JWY A;  3RQL A;  2AN2 A;  3N6B A;  1DF1 A;  4UGC A;  4CTV A;  4D3K A;  4UH8 A;  4KCR A;  4UH1 A;  4KCS A;  5AGK A;  4CUL A;  3HSP A;  5FVY A;  2HX2 A;  4UH9 A;  5FVX A;  3N66 A;  4K5D A;  5AGM A;  4CU0 A;  3N62 A;  4UHA A;  2FC2 A;  4D34 A;  3NLF A;  4CWW A;  1I83 A;  1MMV A;  4CAN A;  1P6M A;  4UQR A;  5G6K A;  5AD6 A;  1LZZ A;  4CX4 A;  5G67 A;  4D35 A;  3NLT A;  1D1X A;  3E7S B;  4FW0 A;  4CX3 A;  5ADE A;  4UCH A;  3PNF A;  5G6E A;  3NOD A;  5ADK A;  1R35 A;  4CWY A;  3FC5 A;  3N5V A;  3N69 A;  4CAM A;  3E7T A;  4D31 A;  4UQS A;  3UFW A;  3N5Q A;  3N61 A;  1M8H A;  4CX7 A;  4C39 A;  3JX2 A;  1JWJ A;  1DWW A;  5FVS A;  5AD8 A;  1QW4 A;  3Q9A A;  1FOL A;  4D3T A;  3DQS A;  1ED5 A;  1ZZU A;  2NSE A;  3JWT A;  4IMW A;  4D1O A;  3NLY A;  1RS8 A;  4D3I A;  3UFS A;  4UGT A;  4UG6 A;  5G6M A;  3EAH A;  4FVZ A;  4CU1 B;  5ADN A;  5ADG A;  1D1W A;  4CTT A;  4CX2 A;  3EBD A;  5G6F A;  4UH0 A;  4UGU A;  4CTP A;  4JSH A;  4UPS A;  5AD5 A;  4V3W A;  3N5Y A;  1NSI A;  4UH3 A;  4UG5 A;  2NSI A;  3Q99 A;  3PNE A;  4UGZ A;  3UFU A;  1DMK A;  2ORT A;  3JWS A;  1DD7 A;  2ORR A;  4V3Z A;  3NNZ A;  4UGN A;  4JSK A;  1DM7 A;  5FVZ A;  3E6T A;  4D3N A;  4D3B A;  5G6O A;  7NSE A;  5G65 A;  4JSL A;  4UGI A;  3NLK A;  2G6H A;  4UPO A;  3E6O A;  3TYL A;  3N6C A;  4UGF A;  1P6H A;  1M9T A;  3JX3 A;  4UGV A;  3RQM A;  1M7Z A;  4KCJ A;  5ADF A;  3N5T A;  4UGY A;  1DWX A;  1DM8 A;  3N64 A;  1P6K A;  4UGS A;  3SVQ A;  3JT6 A;  1FOI A;  4UGO A;  3E6L A;  4D7H A;  4CFT A;  1ZZT A;  4K5I A;  4UGK A;  4LUX A;  4JSF A;  3JTA A;  3JT4 A;  4JSJ A;  2HX3 A;  5G69 A;  3NLZ A;  1P6I A;  4IMX A;  1MJT A;  3NNY A;  1MMW A;  5G6J A;  3JT9 A;  3E7M A;  4UH4 A;  1ZZS A;  5AGL A;  3N6F A;  1DM6 A;  5NSE A;  5G6B A;  3HSO A;  2FC1 A;  2G6L A;  4KCP A;  4D32 A;  1M8D A;  4CWV A;  1M9M A;  3NLI A;  1M9J A;  1QW5 A;  4CWX A;  4D3O A;  1VAG A;  5AGP A;  1Q2O A;  2G6O A;  1ZZQ A;  4UGH A;  5FJ2 A;  5ADJ A;  4KCN A;  4UG9 A;  4D30 A;  3NLX A;  4UGD A;  2ORS A;  3RQO A;  3N5W A;  3DWJ A;  1M9R A;  2G6K A;  3JX5 A;  5ADI A;  3NLW A;  4D3V A;  3NLD A;  4FVW A;  2G6N A;  1NOC A;  4KCQ A;  4UG7 A;  4UGG A;  2ORP A;  3E65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...