4UGGA

Structure of bacillus subtilis nitric oxide synthase in complex with (r)-6-(2-amino-2-(3-(2-(6-amino-4-methylpyridin-2-yl)ethyl)phenyl) ethyl)-4-methylpyridin-2-amine
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
362
structure length
362
Chain Sequence
EEKEILWNEAKAFIAACYQELGKAAEVKDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPPEEKGEKQVEIWNHQLIRYAGYESDGERIGDPASCSLTAACEELGWRGERTDFDLLPLIFRMKGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQAEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDKPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NITRIC OXIDE SYNTHASE OXYGENASE
publication title Inhibitor Bound Crystal Structures of Bacterial Nitric Oxide Synthase.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 122
structure length 362
sequence length 362
ec nomenclature ec 1.14.14.47: Nitric-oxide synthase (flavodoxin).
pdb deposition date 2015-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02898 NO_synthase Nitric oxide synthase, oxygenase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.340.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase; Chain A, domain 1 Nitric Oxide Synthase; Chain A, domain 1 4uggA01
3.90.440.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase;Heme Domain; Chain A, domain 2 Nitric Oxide Synthase;Heme Domain;Chain A domain 2 4uggA02
3.90.1230.10 Alpha Beta Alpha-Beta Complex Bovine Endothelial Nitric Oxide Synthase Heme Domain; Chain: A,domain 3 Nitric Oxide Synthase; Chain A, domain 3 4uggA03
4UH4A 1I83A 3NLDA 5FVRA 4D39A 4K5JA 4KCQA 1DMJA 5G6QA 1RS7A 1M7VA 3JX0A 3JWUA 3DQSA 1DF1A 4UGPA 4CUNA 3B3OA 4UH6A 1QOMA 1M9TA 5G69A 4UH0A 4D3UA 4D37A 1M9MA 3RQPA 3N65A 3N6EA 1FOOA 4UGSA 1RS9A 4UGQA 4CU0A 4UG7A 4D3IA 4KCLA 2FLQA 3FC5A 4UH7A 5G6CA 4JSHA 4KCKA 3NQSA 5ADBA 1M8DA 2AN2A 3N67A 4UGXA 2ORTA 5FVZA 1RS8A 5ADJA 1ZZSA 1QW4A 1M8IA 4NOSA 4IMXA 3UFPA 3N66A 3N6FA 3N6AA 1JWJA 3B3NA 3JX2A 4UPRA 4CWYA 1DMIA 4CVGA 4UG6A 3JWTA 5ADIA 3NLUA 5G6OA 4CWVA 4CAMA 1ED6A 4CWZA 3JT3A 3E7SA 1VAGA 4UGFA 4FVXA 3E6LA 4D2YA 5ADAA 4D30A 4JSLA 1NOCA 3Q9AA 5G6GA 1RS6A 5G0NA 1ZZRA 3NLMA 1DWVA 3N5PA 4JSEA 5G6AA 4UGJA 4UGUA 5G6PA 3NLZA 4UPNA 1M9RA 4CTUA 4CTYA 4CU1B 3PNFA 3NLWA 3N5ZA 4CTTA 4CX0A 4UGRA 9NSEA 4UH9A 3EBFA 5FJ2A 3EBDA 4FW0A 4UGAA 5G6IA 2AN0A 3DWJA 3SVQA 1D1WA 3E65A 4UGVA 3NLHA 1DWWA 3N5SA 4V3VA 5G6EA 5ADFA 4KCSA 2G6NA 2ORQA 4D3NA 3N6DA 4UH1A 4CTQA 4D32A 4UPOA 4UGEA 4UGOA 4CTVA 4UGCA 4EUXA 5AD8A 4KCPA 3UFOA 4CWXA 4FVWA 3E68A 4CFTB 7NSEA 1ZZTA 3NNZA 1QWCA 3DQRA 5FVXA 4K5DA 4D3VA 3JX6A 2NOSA 3JWVA 4K5HA 4UGLA 3N5WA 1DM8A 1NSEA 4CTPA 3NLEA 3NLNA 3UFSA 3UFUA 5FVQA 3NLRA 4D3AA 3UFWA 4UH5A 1P6LA 4GQEA 3JWSA 5AGMA 1DM7A 4UPMA 3NLJA 3RQKA 4CX6A 3NLQA 5AD6A 5ADKA 5ADDA 5G6LA 3B3PA 4CAPA 3E6NA 4D3OA 3JX1A 1FOJA 3NLVA 5FVWA 4LUWA 4CANA 3PNEA 3EJ8A 4UG8A 1DM6A 4KCIA 4D31A 1P6KA 2NSIA 1QW6A 4D1NA 3NLIA 4CWWA 4UGBA 4K5IA 3HSPA 3JT7A 5G68A 4UH2A 1LZZA 2ORRA 5AGPA 3JT8A 5FVVA 3NM0A 4K5GA 3N68A 3JX5A 4K5KA 4UGYA 4UPQA 4NSEA 4CTWA 5ADGA 5G6MA 5AD7A 4D3KA 5G0OA 4CTXA 3JWWA 1DD7A 4UQSA 3N63A 3SVPA 2G6MA 6NSEA 4D7OA 3JX4A 4UQRA 4UPPA 5ADLA 3N64A 4V3ZA 3NODA 4UGTA 1MMVA 2G6LA 2G6JA 1FOPA 5FJ3A 5FVSA 4UHAA 5FVUA 4D36A 4CUMA 1NODA 3N5XA 1M00A 1Q2OA 4KCNA 3N61A 1R35A 2G6HA 4JSJA 1D0OA 1P6JA 4UGGA 3N62A 4V3XA 1M8EA 4V3UA 4CDTA 4CX2A 4D7JA 3E6OA 4JSIA 2FBZX 1FOIA 3PNGA 3NOSA 4JSMA 3TYOA 4C39A 4D3MA 4IMWA 4CULA 4CAQA 1M9KA 5G6BA 3N6CA 1N2NA 1NSIA 4D1OA 5ADCA 4D3BA 3HSNA 3JT9A 4D38A 4UPTA 1MJTA 3TYMA 2NODA 4CX3A 3EAHA 2BHJA 2AMOA 3RQJA 4UPSA 3N5TA 4KCOA 1K2RA 1P6HA 3B3MA 3RQOA 3NW2A 4V3WA 3JWXA 3UFTA 3PNHA 4K5FA 5FVOA 3NLOA 3UFQA 4JSFA 5ADMA 4D33A 4CX4A 4UH8A 4UH3A 3UFVA 1FOLA 4CAOA 4FVYA 2NSEA 3JT5A 3NLFA 4KCJA 5G65A 3NLPA 4KCHA 4UGHA 3N5VA 5AGNA 4D3TA 5FVTA 4UGIA 5AGKA 1M7ZA 5ADEA 3JTAA 4LWAA 1DMKA 4CU1A 5G6DA 4UGDA 5AGOA 5ADNA 2OROA 2HX4A 1NOSA 3JT6A 5G66A 3HSOA 4CTRA 3NLTA 4UGWA 4D1PA 5G0PA 4KCMA 4JSKA 3N6BA 1K2UA 1LZXA 1ZVLA 3JWYA 5G6NA 1D1VA 4CARA 3TYLA 5FVPA 1P6NA 4CX7A 4D3JA 2FC2A 1K2SA 4UG5A 4D7HA 4D34A 1D1YA 1D1XA 1P6MA 3E7TA 3N60A 3RQNA 4UCHA 3N5QA 5NSEA 4CFTA 1K2TA 3TYNA 3NLXA 5AD5A 3DQTA 3EAIA 3UFRA 4UGNA 4KCRA 3N5RA 3Q99A 4JSGA 3E6TA 4D2ZA 1MMWA 1VAFA 3N6GA 1QW5A 8NSEA 2HX3A 4CX5A 4IMSA 3E7MA 1OM4A 5AGLA 1ED4A 4CTZA 3NSEA 4IMTA 4D7IA 4K5EA 4UGKA 1M8HA 4JS9A 5FVYA 1ZZQA 3JWZA 3E7IA 1M9JA 4UGZA 2G6IA 1P6IA 1D0CA 3NLYA 5G6KA 3E67A 4UG9A 3JX3A 2ORSA 4V3YA 5G6FA 3NLGA 3N69A 1ZZUA 5G6JA 4LUXA 4LWBA 3RQMA 2HX2A 3NLKA 2G6KA 1OM5A 2Y37A 3E7SB 5G67A 2ORPA 1ED5A 4UGMA 3NNYA 1DWXA 5AD4A 4CX1A 1M9QA 3RQLA 1ZVIA 3E7GA 2G6OA 3JT4A 3N2RA 3N5YA 1JWKA 5AD9A 4D35A 4C3AA 4IMUA 5G6HA 4FVZA 2FC1A 5FW0A
chains in the Genus database with same CATH superfamily
4UH4A 1I83A 3NLDA 5FVRA 4D39A 4K5JA 4KCQA 1DMJA 5G6QA 1RS7A 1M7VA 3JX0A 3JWUA 3DQSA 1DF1A 4UGPA 4CUNA 3B3OA 4UH6A 1QOMA 1M9TA 5G69A 4UH0A 4D3UA 4D37A 1M9MA 3RQPA 3N65A 3N6EA 1FOOA 4UGSA 1RS9A 4UGQA 4CU0A 4UG7A 4D3IA 4KCLA 2FLQA 3FC5A 4UH7A 5G6CA 4JSHA 4KCKA 3NQSA 5ADBA 1M8DA 2AN2A 3N67A 4UGXA 2ORTA 5FVZA 1RS8A 5ADJA 1ZZSA 1QW4A 1M8IA 4NOSA 4IMXA 3UFPA 3N66A 3N6FA 3N6AA 1JWJA 3B3NA 3JX2A 4UPRA 4CWYA 1DMIA 4CVGA 4UG6A 3JWTA 5ADIA 3NLUA 5G6OA 4CWVA 4CAMA 1ED6A 4CWZA 3JT3A 3E7SA 1VAGA 4UGFA 4FVXA 3E6LA 4D2YA 5ADAA 4D30A 4JSLA 1NOCA 3Q9AA 5G6GA 1RS6A 5G0NA 1ZZRA 3NLMA 1DWVA 3N5PA 4JSEA 5G6AA 4UGJA 4UGUA 5G6PA 3NLZA 4UPNA 1M9RA 4CTUA 4CTYA 4CU1B 3PNFA 3NLWA 3N5ZA 4CTTA 4CX0A 4UGRA 9NSEA 4UH9A 3EBFA 5FJ2A 3EBDA 4FW0A 4UGAA 5G6IA 2AN0A 3DWJA 3SVQA 1D1WA 3E65A 4UGVA 3NLHA 1DWWA 3N5SA 4V3VA 5G6EA 5ADFA 4KCSA 2G6NA 2ORQA 4D3NA 3N6DA 4UH1A 4CTQA 4D32A 4UPOA 4UGEA 4UGOA 4CTVA 4UGCA 4EUXA 5AD8A 4KCPA 3UFOA 4CWXA 4FVWA 3E68A 4CFTB 7NSEA 1ZZTA 3NNZA 1QWCA 3DQRA 5FVXA 4K5DA 4D3VA 3JX6A 2NOSA 3JWVA 4K5HA 4UGLA 3N5WA 1DM8A 1NSEA 4CTPA 3NLEA 3NLNA 3UFSA 3UFUA 5FVQA 3NLRA 4D3AA 3UFWA 4UH5A 1P6LA 4GQEA 3JWSA 5AGMA 1DM7A 4UPMA 3NLJA 3RQKA 4CX6A 3NLQA 5AD6A 5ADKA 5ADDA 5G6LA 3B3PA 4CAPA 3E6NA 4D3OA 3JX1A 1FOJA 3NLVA 5FVWA 4LUWA 4CANA 3PNEA 3EJ8A 4UG8A 1DM6A 4KCIA 4D31A 1P6KA 2NSIA 1QW6A 4D1NA 3NLIA 4CWWA 4UGBA 4K5IA 3HSPA 3JT7A 5G68A 4UH2A 1LZZA 2ORRA 5AGPA 3JT8A 5FVVA 3NM0A 4K5GA 3N68A 3JX5A 4K5KA 4UGYA 4UPQA 4NSEA 4CTWA 5ADGA 5G6MA 5AD7A 4D3KA 5G0OA 4CTXA 3JWWA 1DD7A 4UQSA 3N63A 3SVPA 2G6MA 6NSEA 4D7OA 3JX4A 4UQRA 4UPPA 5ADLA 3N64A 4V3ZA 3NODA 4UGTA 1MMVA 2G6LA 2G6JA 1FOPA 5FJ3A 5FVSA 4UHAA 5FVUA 4D36A 4CUMA 1NODA 3N5XA 1M00A 1Q2OA 4KCNA 3N61A 1R35A 2G6HA 4JSJA 1D0OA 1P6JA 4UGGA 3N62A 4V3XA 1M8EA 4V3UA 4CDTA 4CX2A 4D7JA 3E6OA 4JSIA 2FBZX 1FOIA 3PNGA 3NOSA 4JSMA 3TYOA 4C39A 4D3MA 4IMWA 4CULA 4CAQA 1M9KA 5G6BA 3N6CA 1N2NA 1NSIA 4D1OA 5ADCA 4D3BA 3HSNA 3JT9A 4D38A 4UPTA 1MJTA 3TYMA 2NODA 4CX3A 3EAHA 2BHJA 2AMOA 3RQJA 4UPSA 3N5TA 4KCOA 1K2RA 1P6HA 3B3MA 3RQOA 3NW2A 4V3WA 3JWXA 3UFTA 3PNHA 4K5FA 5FVOA 3NLOA 3UFQA 4JSFA 5ADMA 4D33A 4CX4A 4UH8A 4UH3A 3UFVA 1FOLA 4CAOA 4FVYA 2NSEA 3JT5A 3NLFA 4KCJA 5G65A 3NLPA 4KCHA 4UGHA 3N5VA 5AGNA 4D3TA 5FVTA 4UGIA 5AGKA 1M7ZA 5ADEA 3JTAA 4LWAA 1DMKA 4CU1A 5G6DA 4UGDA 5AGOA 5ADNA 2OROA 2HX4A 1NOSA 3JT6A 5G66A 3HSOA 4CTRA 3NLTA 4UGWA 4D1PA 5G0PA 4KCMA 4JSKA 3N6BA 1K2UA 1LZXA 1ZVLA 3JWYA 5G6NA 1D1VA 4CARA 3TYLA 5FVPA 1P6NA 4CX7A 4D3JA 2FC2A 1K2SA 4UG5A 4D7HA 4D34A 1D1YA 1D1XA 1P6MA 3E7TA 3N60A 3RQNA 4UCHA 3N5QA 5NSEA 4CFTA 1K2TA 3TYNA 3NLXA 5AD5A 3DQTA 3EAIA 3UFRA 4UGNA 4KCRA 3N5RA 3Q99A 4JSGA 3E6TA 4D2ZA 1MMWA 1VAFA 3N6GA 1QW5A 8NSEA 2HX3A 4CX5A 4IMSA 3E7MA 1OM4A 5AGLA 1ED4A 4CTZA 3NSEA 4IMTA 4D7IA 4K5EA 4UGKA 1M8HA 4JS9A 5FVYA 1ZZQA 3JWZA 3E7IA 1M9JA 4UGZA 2G6IA 1P6IA 1D0CA 3NLYA 5G6KA 3E67A 4UG9A 3JX3A 2ORSA 4V3YA 5G6FA 3NLGA 3N69A 1ZZUA 5G6JA 4LUXA 4LWBA 3RQMA 2HX2A 3NLKA 2G6KA 1OM5A 2Y37A 3E7SB 5G67A 2ORPA 1ED5A 4UGMA 3NNYA 1DWXA 5AD4A 4CX1A 1M9QA 3RQLA 1ZVIA 3E7GA 2G6OA 3JT4A 3N2RA 3N5YA 1JWKA 5AD9A 4D35A 4C3AA 4IMUA 5G6HA 4FVZA 2FC1A 5FW0A
chains in the Genus database with same CATH topology
4UH4A 1I83A 3NLDA 5FVRA 4D39A 4K5JA 4KCQA 1DMJA 5G6QA 1RS7A 1M7VA 3JX0A 3JWUA 3DQSA 1DF1A 4UGPA 4CUNA 3B3OA 4UH6A 1QOMA 1M9TA 5G69A 4UH0A 4D3UA 4D37A 1M9MA 3RQPA 3N65A 3N6EA 1FOOA 4UGSA 1RS9A 4UGQA 4CU0A 4UG7A 4D3IA 4KCLA 2FLQA 3FC5A 4UH7A 5G6CA 4JSHA 4KCKA 3NQSA 5ADBA 1M8DA 2AN2A 3N67A 4UGXA 2ORTA 5FVZA 1RS8A 5ADJA 1ZZSA 1QW4A 1M8IA 4NOSA 4IMXA 3UFPA 3N66A 3N6FA 3N6AA 1JWJA 3B3NA 3JX2A 4UPRA 4CWYA 1DMIA 4CVGA 4UG6A 3JWTA 5ADIA 3NLUA 5G6OA 4CWVA 4CAMA 1ED6A 4CWZA 3JT3A 3E7SA 1VAGA 4UGFA 4FVXA 3E6LA 4D2YA 5ADAA 4D30A 4JSLA 1NOCA 3Q9AA 5G6GA 1RS6A 5G0NA 1ZZRA 3NLMA 1DWVA 3N5PA 4JSEA 5G6AA 4UGJA 4UGUA 5G6PA 3NLZA 4UPNA 1M9RA 4CTUA 4CTYA 4CU1B 3PNFA 3NLWA 3N5ZA 4CTTA 4CX0A 4UGRA 9NSEA 4UH9A 3EBFA 5FJ2A 3EBDA 4FW0A 4UGAA 5G6IA 2AN0A 3DWJA 3SVQA 1D1WA 3E65A 4UGVA 3NLHA 1DWWA 3N5SA 4V3VA 5G6EA 5ADFA 4KCSA 2G6NA 2ORQA 4D3NA 3N6DA 4UH1A 4CTQA 4D32A 4UPOA 4UGEA 4UGOA 4CTVA 4UGCA 4EUXA 5AD8A 4KCPA 3UFOA 4CWXA 4FVWA 3E68A 4CFTB 7NSEA 1ZZTA 3NNZA 1QWCA 3DQRA 5FVXA 4K5DA 4D3VA 3JX6A 2NOSA 3JWVA 4K5HA 4UGLA 3N5WA 1DM8A 1NSEA 4CTPA 3NLEA 3NLNA 3UFSA 3UFUA 5FVQA 3NLRA 4D3AA 3UFWA 4UH5A 1P6LA 4GQEA 3JWSA 5AGMA 1DM7A 4UPMA 3NLJA 3RQKA 4CX6A 3NLQA 5AD6A 5ADKA 5ADDA 5G6LA 3B3PA 4CAPA 3E6NA 4D3OA 3JX1A 1FOJA 3NLVA 5FVWA 4LUWA 4CANA 3PNEA 3EJ8A 4UG8A 1DM6A 4KCIA 4D31A 1P6KA 2NSIA 1QW6A 4D1NA 3NLIA 4CWWA 4UGBA 4K5IA 3HSPA 3JT7A 5G68A 4UH2A 1LZZA 2ORRA 5AGPA 3JT8A 5FVVA 3NM0A 4K5GA 3N68A 3JX5A 4K5KA 4UGYA 4UPQA 4NSEA 4CTWA 5ADGA 5G6MA 5AD7A 4D3KA 5G0OA 4CTXA 3JWWA 1DD7A 4UQSA 3N63A 3SVPA 2G6MA 6NSEA 4D7OA 3JX4A 4UQRA 4UPPA 5ADLA 3N64A 4V3ZA 3NODA 4UGTA 1MMVA 2G6LA 2G6JA 1FOPA 5FJ3A 5FVSA 4UHAA 5FVUA 4D36A 4CUMA 1NODA 3N5XA 1M00A 1Q2OA 4KCNA 3N61A 1R35A 2G6HA 4JSJA 1D0OA 1P6JA 4UGGA 3N62A 4V3XA 1M8EA 4V3UA 4CDTA 4CX2A 4D7JA 3E6OA 4JSIA 2FBZX 1FOIA 3PNGA 3NOSA 4JSMA 3TYOA 4C39A 4D3MA 4IMWA 4CULA 4CAQA 1M9KA 5G6BA 3N6CA 1N2NA 1NSIA 4D1OA 5ADCA 4D3BA 3HSNA 3JT9A 4D38A 4UPTA 1MJTA 3TYMA 2NODA 4CX3A 3EAHA 2BHJA 2AMOA 3RQJA 4UPSA 3N5TA 4KCOA 1K2RA 1P6HA 3B3MA 3RQOA 3NW2A 4V3WA 3JWXA 3UFTA 3PNHA 4K5FA 5FVOA 3NLOA 3UFQA 4JSFA 5ADMA 4D33A 4CX4A 4UH8A 4UH3A 3UFVA 1FOLA 4CAOA 4FVYA 2NSEA 3JT5A 3NLFA 4KCJA 5G65A 3NLPA 4KCHA 4UGHA 3N5VA 5AGNA 4D3TA 5FVTA 4UGIA 5AGKA 1M7ZA 5ADEA 3JTAA 4LWAA 1DMKA 4CU1A 5G6DA 4UGDA 5AGOA 5ADNA 2OROA 2HX4A 1NOSA 3JT6A 5G66A 3HSOA 4CTRA 3NLTA 4UGWA 4D1PA 5G0PA 4KCMA 4JSKA 3N6BA 1K2UA 1LZXA 1ZVLA 3JWYA 5G6NA 1D1VA 4CARA 3TYLA 5FVPA 1P6NA 4CX7A 4D3JA 2FC2A 1K2SA 4UG5A 4D7HA 4D34A 1D1YA 1D1XA 1P6MA 3E7TA 3N60A 3RQNA 4UCHA 3N5QA 5NSEA 4CFTA 1K2TA 3TYNA 3NLXA 5AD5A 3DQTA 3EAIA 3UFRA 4UGNA 4KCRA 3N5RA 3Q99A 4JSGA 3E6TA 4D2ZA 1MMWA 1VAFA 3N6GA 1QW5A 8NSEA 2HX3A 4CX5A 4IMSA 3E7MA 1OM4A 5AGLA 1ED4A 4CTZA 3NSEA 4IMTA 4D7IA 4K5EA 4UGKA 1M8HA 4JS9A 5FVYA 1ZZQA 3JWZA 3E7IA 1M9JA 4UGZA 2G6IA 1P6IA 1D0CA 3NLYA 5G6KA 3E67A 4UG9A 3JX3A 2ORSA 4V3YA 5G6FA 3NLGA 3N69A 1ZZUA 5G6JA 4LUXA 4LWBA 3RQMA 2HX2A 3NLKA 2G6KA 1OM5A 2Y37A 3E7SB 5G67A 2ORPA 1ED5A 4UGMA 3NNYA 1DWXA 5AD4A 4CX1A 1M9QA 3RQLA 1ZVIA 3E7GA 2G6OA 3JT4A 3N2RA 3N5YA 1JWKA 5AD9A 4D35A 4C3AA 4IMUA 5G6HA 4FVZA 2FC1A 5FW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UH4 A;  1I83 A;  3NLD A;  5FVR A;  4D39 A;  4K5J A;  4KCQ A;  1DMJ A;  5G6Q A;  1RS7 A;  1M7V A;  3JX0 A;  3JWU A;  3DQS A;  1DF1 A;  4UGP A;  4CUN A;  3B3O A;  4UH6 A;  1QOM A;  1M9T A;  5G69 A;  4UH0 A;  4D3U A;  4D37 A;  1M9M A;  3RQP A;  3N65 A;  3N6E A;  1FOO A;  4UGS A;  1RS9 A;  4UGQ A;  4CU0 A;  4UG7 A;  4D3I A;  4KCL A;  2FLQ A;  3FC5 A;  4UH7 A;  5G6C A;  4JSH A;  4KCK A;  3NQS A;  5ADB A;  1M8D A;  2AN2 A;  3N67 A;  4UGX A;  2ORT A;  5FVZ A;  1RS8 A;  5ADJ A;  1ZZS A;  1QW4 A;  1M8I A;  4NOS A;  4IMX A;  3UFP A;  3N66 A;  3N6F A;  3N6A A;  1JWJ A;  3B3N A;  3JX2 A;  4UPR A;  4CWY A;  1DMI A;  4CVG A;  4UG6 A;  3JWT A;  5ADI A;  3NLU A;  5G6O A;  4CWV A;  4CAM A;  1ED6 A;  4CWZ A;  3JT3 A;  3E7S A;  1VAG A;  4UGF A;  4FVX A;  3E6L A;  4D2Y A;  5ADA A;  4D30 A;  4JSL A;  1NOC A;  3Q9A A;  5G6G A;  1RS6 A;  5G0N A;  1ZZR A;  3NLM A;  1DWV A;  3N5P A;  4JSE A;  5G6A A;  4UGJ A;  4UGU A;  5G6P A;  3NLZ A;  4UPN A;  1M9R A;  4CTU A;  4CTY A;  4CU1 B;  3PNF A;  3NLW A;  3N5Z A;  4CTT A;  4CX0 A;  4UGR A;  9NSE A;  4UH9 A;  3EBF A;  5FJ2 A;  3EBD A;  4FW0 A;  4UGA A;  5G6I A;  2AN0 A;  3DWJ A;  3SVQ A;  1D1W A;  3E65 A;  4UGV A;  3NLH A;  1DWW A;  3N5S A;  4V3V A;  5G6E A;  5ADF A;  4KCS A;  2G6N A;  2ORQ A;  4D3N A;  3N6D A;  4UH1 A;  4CTQ A;  4D32 A;  4UPO A;  4UGE A;  4UGO A;  4CTV A;  4UGC A;  4EUX A;  5AD8 A;  4KCP A;  3UFO A;  4CWX A;  4FVW A;  3E68 A;  4CFT B;  7NSE A;  1ZZT A;  3NNZ A;  1QWC A;  3DQR A;  5FVX A;  4K5D A;  4D3V A;  3JX6 A;  2NOS A;  3JWV A;  4K5H A;  4UGL A;  3N5W A;  1DM8 A;  1NSE A;  4CTP A;  3NLE A;  3NLN A;  3UFS A;  3UFU A;  5FVQ A;  3NLR A;  4D3A A;  3UFW A;  4UH5 A;  1P6L A;  4GQE A;  3JWS A;  5AGM A;  1DM7 A;  4UPM A;  3NLJ A;  3RQK A;  4CX6 A;  3NLQ A;  5AD6 A;  5ADK A;  5ADD A;  5G6L A;  3B3P A;  4CAP A;  3E6N A;  4D3O A;  3JX1 A;  1FOJ A;  3NLV A;  5FVW A;  4LUW A;  4CAN A;  3PNE A;  3EJ8 A;  4UG8 A;  1DM6 A;  4KCI A;  4D31 A;  1P6K A;  2NSI A;  1QW6 A;  4D1N A;  3NLI A;  4CWW A;  4UGB A;  4K5I A;  3HSP A;  3JT7 A;  5G68 A;  4UH2 A;  1LZZ A;  2ORR A;  5AGP A;  3JT8 A;  5FVV A;  3NM0 A;  4K5G A;  3N68 A;  3JX5 A;  4K5K A;  4UGY A;  4UPQ A;  4NSE A;  4CTW A;  5ADG A;  5G6M A;  5AD7 A;  4D3K A;  5G0O A;  4CTX A;  3JWW A;  1DD7 A;  4UQS A;  3N63 A;  3SVP A;  2G6M A;  6NSE A;  4D7O A;  3JX4 A;  4UQR A;  4UPP A;  5ADL A;  3N64 A;  4V3Z A;  3NOD A;  4UGT A;  1MMV A;  2G6L A;  2G6J A;  1FOP A;  5FJ3 A;  5FVS A;  4UHA A;  5FVU A;  4D36 A;  4CUM A;  1NOD A;  3N5X A;  1M00 A;  1Q2O A;  4KCN A;  3N61 A;  1R35 A;  2G6H A;  4JSJ A;  1D0O A;  1P6J A;  4UGG A;  3N62 A;  4V3X A;  1M8E A;  4V3U A;  4CDT A;  4CX2 A;  4D7J A;  3E6O A;  4JSI A;  2FBZ X;  1FOI A;  3PNG A;  3NOS A;  4JSM A;  3TYO A;  4C39 A;  4D3M A;  4IMW A;  4CUL A;  4CAQ A;  1M9K A;  5G6B A;  3N6C A;  1N2N A;  1NSI A;  4D1O A;  5ADC A;  4D3B A;  3HSN A;  3JT9 A;  4D38 A;  4UPT A;  1MJT A;  3TYM A;  2NOD A;  4CX3 A;  3EAH A;  2BHJ A;  2AMO A;  3RQJ A;  4UPS A;  3N5T A;  4KCO A;  1K2R A;  1P6H A;  3B3M A;  3RQO A;  3NW2 A;  4V3W A;  3JWX A;  3UFT A;  3PNH A;  4K5F A;  5FVO A;  3NLO A;  3UFQ A;  4JSF A;  5ADM A;  4D33 A;  4CX4 A;  4UH8 A;  4UH3 A;  3UFV A;  1FOL A;  4CAO A;  4FVY A;  2NSE A;  3JT5 A;  3NLF A;  4KCJ A;  5G65 A;  3NLP A;  4KCH A;  4UGH A;  3N5V A;  5AGN A;  4D3T A;  5FVT A;  4UGI A;  5AGK A;  1M7Z A;  5ADE A;  3JTA A;  4LWA A;  1DMK A;  4CU1 A;  5G6D A;  4UGD A;  5AGO A;  5ADN A;  2ORO A;  2HX4 A;  1NOS A;  3JT6 A;  5G66 A;  3HSO A;  4CTR A;  3NLT A;  4UGW A;  4D1P A;  5G0P A;  4KCM A;  4JSK A;  3N6B A;  1K2U A;  1LZX A;  1ZVL A;  3JWY A;  5G6N A;  1D1V A;  4CAR A;  3TYL A;  5FVP A;  1P6N A;  4CX7 A;  4D3J A;  2FC2 A;  1K2S A;  4UG5 A;  4D7H A;  4D34 A;  1D1Y A;  1D1X A;  1P6M A;  3E7T A;  3N60 A;  3RQN A;  4UCH A;  3N5Q A;  5NSE A;  4CFT A;  1K2T A;  3TYN A;  3NLX A;  5AD5 A;  3DQT A;  3EAI A;  3UFR A;  4UGN A;  4KCR A;  3N5R A;  3Q99 A;  4JSG A;  3E6T A;  4D2Z A;  1MMW A;  1VAF A;  3N6G A;  1QW5 A;  8NSE A;  2HX3 A;  4CX5 A;  4IMS A;  3E7M A;  1OM4 A;  5AGL A;  1ED4 A;  4CTZ A;  3NSE A;  4IMT A;  4D7I A;  4K5E A;  4UGK A;  1M8H A;  4JS9 A;  5FVY A;  1ZZQ A;  3JWZ A;  3E7I A;  1M9J A;  4UGZ A;  2G6I A;  1P6I A;  1D0C A;  3NLY A;  5G6K A;  3E67 A;  4UG9 A;  3JX3 A;  2ORS A;  4V3Y A;  5G6F A;  3NLG A;  3N69 A;  1ZZU A;  5G6J A;  4LUX A;  4LWB A;  3RQM A;  2HX2 A;  3NLK A;  2G6K A;  1OM5 A;  2Y37 A;  3E7S B;  5G67 A;  2ORP A;  1ED5 A;  4UGM A;  3NNY A;  1DWX A;  5AD4 A;  4CX1 A;  1M9Q A;  3RQL A;  1ZVI A;  3E7G A;  2G6O A;  3JT4 A;  3N2R A;  3N5Y A;  1JWK A;  5AD9 A;  4D35 A;  4C3A A;  4IMU A;  5G6H A;  4FVZ A;  2FC1 A;  5FW0 A; 
#chains in the Genus database with same CATH topology
 4UH4 A;  1I83 A;  3NLD A;  5FVR A;  4D39 A;  4K5J A;  4KCQ A;  1DMJ A;  5G6Q A;  1RS7 A;  1M7V A;  3JX0 A;  3JWU A;  3DQS A;  1DF1 A;  4UGP A;  4CUN A;  3B3O A;  4UH6 A;  1QOM A;  1M9T A;  5G69 A;  4UH0 A;  4D3U A;  4D37 A;  1M9M A;  3RQP A;  3N65 A;  3N6E A;  1FOO A;  4UGS A;  1RS9 A;  4UGQ A;  4CU0 A;  4UG7 A;  4D3I A;  4KCL A;  2FLQ A;  3FC5 A;  4UH7 A;  5G6C A;  4JSH A;  4KCK A;  3NQS A;  5ADB A;  1M8D A;  2AN2 A;  3N67 A;  4UGX A;  2ORT A;  5FVZ A;  1RS8 A;  5ADJ A;  1ZZS A;  1QW4 A;  1M8I A;  4NOS A;  4IMX A;  3UFP A;  3N66 A;  3N6F A;  3N6A A;  1JWJ A;  3B3N A;  3JX2 A;  4UPR A;  4CWY A;  1DMI A;  4CVG A;  4UG6 A;  3JWT A;  5ADI A;  3NLU A;  5G6O A;  4CWV A;  4CAM A;  1ED6 A;  4CWZ A;  3JT3 A;  3E7S A;  1VAG A;  4UGF A;  4FVX A;  3E6L A;  4D2Y A;  5ADA A;  4D30 A;  4JSL A;  1NOC A;  3Q9A A;  5G6G A;  1RS6 A;  5G0N A;  1ZZR A;  3NLM A;  1DWV A;  3N5P A;  4JSE A;  5G6A A;  4UGJ A;  4UGU A;  5G6P A;  3NLZ A;  4UPN A;  1M9R A;  4CTU A;  4CTY A;  4CU1 B;  3PNF A;  3NLW A;  3N5Z A;  4CTT A;  4CX0 A;  4UGR A;  9NSE A;  4UH9 A;  3EBF A;  5FJ2 A;  3EBD A;  4FW0 A;  4UGA A;  5G6I A;  2AN0 A;  3DWJ A;  3SVQ A;  1D1W A;  3E65 A;  4UGV A;  3NLH A;  1DWW A;  3N5S A;  4V3V A;  5G6E A;  5ADF A;  4KCS A;  2G6N A;  2ORQ A;  4D3N A;  3N6D A;  4UH1 A;  4CTQ A;  4D32 A;  4UPO A;  4UGE A;  4UGO A;  4CTV A;  4UGC A;  4EUX A;  5AD8 A;  4KCP A;  3UFO A;  4CWX A;  4FVW A;  3E68 A;  4CFT B;  7NSE A;  1ZZT A;  3NNZ A;  1QWC A;  3DQR A;  5FVX A;  4K5D A;  4D3V A;  3JX6 A;  2NOS A;  3JWV A;  4K5H A;  4UGL A;  3N5W A;  1DM8 A;  1NSE A;  4CTP A;  3NLE A;  3NLN A;  3UFS A;  3UFU A;  5FVQ A;  3NLR A;  4D3A A;  3UFW A;  4UH5 A;  1P6L A;  4GQE A;  3JWS A;  5AGM A;  1DM7 A;  4UPM A;  3NLJ A;  3RQK A;  4CX6 A;  3NLQ A;  5AD6 A;  5ADK A;  5ADD A;  5G6L A;  3B3P A;  4CAP A;  3E6N A;  4D3O A;  3JX1 A;  1FOJ A;  3NLV A;  5FVW A;  4LUW A;  4CAN A;  3PNE A;  3EJ8 A;  4UG8 A;  1DM6 A;  4KCI A;  4D31 A;  1P6K A;  2NSI A;  1QW6 A;  4D1N A;  3NLI A;  4CWW A;  4UGB A;  4K5I A;  3HSP A;  3JT7 A;  5G68 A;  4UH2 A;  1LZZ A;  2ORR A;  5AGP A;  3JT8 A;  5FVV A;  3NM0 A;  4K5G A;  3N68 A;  3JX5 A;  4K5K A;  4UGY A;  4UPQ A;  4NSE A;  4CTW A;  5ADG A;  5G6M A;  5AD7 A;  4D3K A;  5G0O A;  4CTX A;  3JWW A;  1DD7 A;  4UQS A;  3N63 A;  3SVP A;  2G6M A;  6NSE A;  4D7O A;  3JX4 A;  4UQR A;  4UPP A;  5ADL A;  3N64 A;  4V3Z A;  3NOD A;  4UGT A;  1MMV A;  2G6L A;  2G6J A;  1FOP A;  5FJ3 A;  5FVS A;  4UHA A;  5FVU A;  4D36 A;  4CUM A;  1NOD A;  3N5X A;  1M00 A;  1Q2O A;  4KCN A;  3N61 A;  1R35 A;  2G6H A;  4JSJ A;  1D0O A;  1P6J A;  4UGG A;  3N62 A;  4V3X A;  1M8E A;  4V3U A;  4CDT A;  4CX2 A;  4D7J A;  3E6O A;  4JSI A;  2FBZ X;  1FOI A;  3PNG A;  3NOS A;  4JSM A;  3TYO A;  4C39 A;  4D3M A;  4IMW A;  4CUL A;  4CAQ A;  1M9K A;  5G6B A;  3N6C A;  1N2N A;  1NSI A;  4D1O A;  5ADC A;  4D3B A;  3HSN A;  3JT9 A;  4D38 A;  4UPT A;  1MJT A;  3TYM A;  2NOD A;  4CX3 A;  3EAH A;  2BHJ A;  2AMO A;  3RQJ A;  4UPS A;  3N5T A;  4KCO A;  1K2R A;  1P6H A;  3B3M A;  3RQO A;  3NW2 A;  4V3W A;  3JWX A;  3UFT A;  3PNH A;  4K5F A;  5FVO A;  3NLO A;  3UFQ A;  4JSF A;  5ADM A;  4D33 A;  4CX4 A;  4UH8 A;  4UH3 A;  3UFV A;  1FOL A;  4CAO A;  4FVY A;  2NSE A;  3JT5 A;  3NLF A;  4KCJ A;  5G65 A;  3NLP A;  4KCH A;  4UGH A;  3N5V A;  5AGN A;  4D3T A;  5FVT A;  4UGI A;  5AGK A;  1M7Z A;  5ADE A;  3JTA A;  4LWA A;  1DMK A;  4CU1 A;  5G6D A;  4UGD A;  5AGO A;  5ADN A;  2ORO A;  2HX4 A;  1NOS A;  3JT6 A;  5G66 A;  3HSO A;  4CTR A;  3NLT A;  4UGW A;  4D1P A;  5G0P A;  4KCM A;  4JSK A;  3N6B A;  1K2U A;  1LZX A;  1ZVL A;  3JWY A;  5G6N A;  1D1V A;  4CAR A;  3TYL A;  5FVP A;  1P6N A;  4CX7 A;  4D3J A;  2FC2 A;  1K2S A;  4UG5 A;  4D7H A;  4D34 A;  1D1Y A;  1D1X A;  1P6M A;  3E7T A;  3N60 A;  3RQN A;  4UCH A;  3N5Q A;  5NSE A;  4CFT A;  1K2T A;  3TYN A;  3NLX A;  5AD5 A;  3DQT A;  3EAI A;  3UFR A;  4UGN A;  4KCR A;  3N5R A;  3Q99 A;  4JSG A;  3E6T A;  4D2Z A;  1MMW A;  1VAF A;  3N6G A;  1QW5 A;  8NSE A;  2HX3 A;  4CX5 A;  4IMS A;  3E7M A;  1OM4 A;  5AGL A;  1ED4 A;  4CTZ A;  3NSE A;  4IMT A;  4D7I A;  4K5E A;  4UGK A;  1M8H A;  4JS9 A;  5FVY A;  1ZZQ A;  3JWZ A;  3E7I A;  1M9J A;  4UGZ A;  2G6I A;  1P6I A;  1D0C A;  3NLY A;  5G6K A;  3E67 A;  4UG9 A;  3JX3 A;  2ORS A;  4V3Y A;  5G6F A;  3NLG A;  3N69 A;  1ZZU A;  5G6J A;  4LUX A;  4LWB A;  3RQM A;  2HX2 A;  3NLK A;  2G6K A;  1OM5 A;  2Y37 A;  3E7S B;  5G67 A;  2ORP A;  1ED5 A;  4UGM A;  3NNY A;  1DWX A;  5AD4 A;  4CX1 A;  1M9Q A;  3RQL A;  1ZVI A;  3E7G A;  2G6O A;  3JT4 A;  3N2R A;  3N5Y A;  1JWK A;  5AD9 A;  4D35 A;  4C3A A;  4IMU A;  5G6H A;  4FVZ A;  2FC1 A;  5FW0 A; 
#chains in the Genus database with same CATH homology
 4UH4 A;  1I83 A;  3NLD A;  5FVR A;  4D39 A;  4K5J A;  4KCQ A;  1DMJ A;  5G6Q A;  1RS7 A;  1M7V A;  3JX0 A;  3JWU A;  3DQS A;  1DF1 A;  4UGP A;  4CUN A;  3B3O A;  4UH6 A;  1QOM A;  1M9T A;  5G69 A;  4UH0 A;  4D3U A;  4D37 A;  1M9M A;  3RQP A;  3N65 A;  3N6E A;  1FOO A;  4UGS A;  1RS9 A;  4UGQ A;  4CU0 A;  4UG7 A;  4D3I A;  4KCL A;  2FLQ A;  3FC5 A;  4UH7 A;  5G6C A;  4JSH A;  4KCK A;  3NQS A;  5ADB A;  1M8D A;  2AN2 A;  3N67 A;  4UGX A;  2ORT A;  5FVZ A;  1RS8 A;  5ADJ A;  1ZZS A;  1QW4 A;  1M8I A;  4NOS A;  4IMX A;  3UFP A;  3N66 A;  3N6F A;  3N6A A;  1JWJ A;  3B3N A;  3JX2 A;  4UPR A;  4CWY A;  1DMI A;  4CVG A;  4UG6 A;  3JWT A;  5ADI A;  3NLU A;  5G6O A;  4CWV A;  4CAM A;  1ED6 A;  4CWZ A;  3JT3 A;  3E7S A;  1VAG A;  4UGF A;  4FVX A;  3E6L A;  4D2Y A;  5ADA A;  4D30 A;  4JSL A;  1NOC A;  3Q9A A;  5G6G A;  1RS6 A;  5G0N A;  1ZZR A;  3NLM A;  1DWV A;  3N5P A;  4JSE A;  5G6A A;  4UGJ A;  4UGU A;  5G6P A;  3NLZ A;  4UPN A;  1M9R A;  4CTU A;  4CTY A;  4CU1 B;  3PNF A;  3NLW A;  3N5Z A;  4CTT A;  4CX0 A;  4UGR A;  9NSE A;  4UH9 A;  3EBF A;  5FJ2 A;  3EBD A;  4FW0 A;  4UGA A;  5G6I A;  2AN0 A;  3DWJ A;  3SVQ A;  1D1W A;  3E65 A;  4UGV A;  3NLH A;  1DWW A;  3N5S A;  4V3V A;  5G6E A;  5ADF A;  4KCS A;  2G6N A;  2ORQ A;  4D3N A;  3N6D A;  4UH1 A;  4CTQ A;  4D32 A;  4UPO A;  4UGE A;  4UGO A;  4CTV A;  4UGC A;  4EUX A;  5AD8 A;  4KCP A;  3UFO A;  4CWX A;  4FVW A;  3E68 A;  4CFT B;  7NSE A;  1ZZT A;  3NNZ A;  1QWC A;  3DQR A;  5FVX A;  4K5D A;  4D3V A;  3JX6 A;  2NOS A;  3JWV A;  4K5H A;  4UGL A;  3N5W A;  1DM8 A;  1NSE A;  4CTP A;  3NLE A;  3NLN A;  3UFS A;  3UFU A;  5FVQ A;  3NLR A;  4D3A A;  3UFW A;  4UH5 A;  1P6L A;  4GQE A;  3JWS A;  5AGM A;  1DM7 A;  4UPM A;  3NLJ A;  3RQK A;  4CX6 A;  3NLQ A;  5AD6 A;  5ADK A;  5ADD A;  5G6L A;  3B3P A;  4CAP A;  3E6N A;  4D3O A;  3JX1 A;  1FOJ A;  3NLV A;  5FVW A;  4LUW A;  4CAN A;  3PNE A;  3EJ8 A;  4UG8 A;  1DM6 A;  4KCI A;  4D31 A;  1P6K A;  2NSI A;  1QW6 A;  4D1N A;  3NLI A;  4CWW A;  4UGB A;  4K5I A;  3HSP A;  3JT7 A;  5G68 A;  4UH2 A;  1LZZ A;  2ORR A;  5AGP A;  3JT8 A;  5FVV A;  3NM0 A;  4K5G A;  3N68 A;  3JX5 A;  4K5K A;  4UGY A;  4UPQ A;  4NSE A;  4CTW A;  5ADG A;  5G6M A;  5AD7 A;  4D3K A;  5G0O A;  4CTX A;  3JWW A;  1DD7 A;  4UQS A;  3N63 A;  3SVP A;  2G6M A;  6NSE A;  4D7O A;  3JX4 A;  4UQR A;  4UPP A;  5ADL A;  3N64 A;  4V3Z A;  3NOD A;  4UGT A;  1MMV A;  2G6L A;  2G6J A;  1FOP A;  5FJ3 A;  5FVS A;  4UHA A;  5FVU A;  4D36 A;  4CUM A;  1NOD A;  3N5X A;  1M00 A;  1Q2O A;  4KCN A;  3N61 A;  1R35 A;  2G6H A;  4JSJ A;  1D0O A;  1P6J A;  4UGG A;  3N62 A;  4V3X A;  1M8E A;  4V3U A;  4CDT A;  4CX2 A;  4D7J A;  3E6O A;  4JSI A;  2FBZ X;  1FOI A;  3PNG A;  3NOS A;  4JSM A;  3TYO A;  4C39 A;  4D3M A;  4IMW A;  4CUL A;  4CAQ A;  1M9K A;  5G6B A;  3N6C A;  1N2N A;  1NSI A;  4D1O A;  5ADC A;  4D3B A;  3HSN A;  3JT9 A;  4D38 A;  4UPT A;  1MJT A;  3TYM A;  2NOD A;  4CX3 A;  3EAH A;  2BHJ A;  2AMO A;  3RQJ A;  4UPS A;  3N5T A;  4KCO A;  1K2R A;  1P6H A;  3B3M A;  3RQO A;  3NW2 A;  4V3W A;  3JWX A;  3UFT A;  3PNH A;  4K5F A;  5FVO A;  3NLO A;  3UFQ A;  4JSF A;  5ADM A;  4D33 A;  4CX4 A;  4UH8 A;  4UH3 A;  3UFV A;  1FOL A;  4CAO A;  4FVY A;  2NSE A;  3JT5 A;  3NLF A;  4KCJ A;  5G65 A;  3NLP A;  4KCH A;  4UGH A;  3N5V A;  5AGN A;  4D3T A;  5FVT A;  4UGI A;  5AGK A;  1M7Z A;  5ADE A;  3JTA A;  4LWA A;  1DMK A;  4CU1 A;  5G6D A;  4UGD A;  5AGO A;  5ADN A;  2ORO A;  2HX4 A;  1NOS A;  3JT6 A;  5G66 A;  3HSO A;  4CTR A;  3NLT A;  4UGW A;  4D1P A;  5G0P A;  4KCM A;  4JSK A;  3N6B A;  1K2U A;  1LZX A;  1ZVL A;  3JWY A;  5G6N A;  1D1V A;  4CAR A;  3TYL A;  5FVP A;  1P6N A;  4CX7 A;  4D3J A;  2FC2 A;  1K2S A;  4UG5 A;  4D7H A;  4D34 A;  1D1Y A;  1D1X A;  1P6M A;  3E7T A;  3N60 A;  3RQN A;  4UCH A;  3N5Q A;  5NSE A;  4CFT A;  1K2T A;  3TYN A;  3NLX A;  5AD5 A;  3DQT A;  3EAI A;  3UFR A;  4UGN A;  4KCR A;  3N5R A;  3Q99 A;  4JSG A;  3E6T A;  4D2Z A;  1MMW A;  1VAF A;  3N6G A;  1QW5 A;  8NSE A;  2HX3 A;  4CX5 A;  4IMS A;  3E7M A;  1OM4 A;  5AGL A;  1ED4 A;  4CTZ A;  3NSE A;  4IMT A;  4D7I A;  4K5E A;  4UGK A;  1M8H A;  4JS9 A;  5FVY A;  1ZZQ A;  3JWZ A;  3E7I A;  1M9J A;  4UGZ A;  2G6I A;  1P6I A;  1D0C A;  3NLY A;  5G6K A;  3E67 A;  4UG9 A;  3JX3 A;  2ORS A;  4V3Y A;  5G6F A;  3NLG A;  3N69 A;  1ZZU A;  5G6J A;  4LUX A;  4LWB A;  3RQM A;  2HX2 A;  3NLK A;  2G6K A;  1OM5 A;  2Y37 A;  3E7S B;  5G67 A;  2ORP A;  1ED5 A;  4UGM A;  3NNY A;  1DWX A;  5AD4 A;  4CX1 A;  1M9Q A;  3RQL A;  1ZVI A;  3E7G A;  2G6O A;  3JT4 A;  3N2R A;  3N5Y A;  1JWK A;  5AD9 A;  4D35 A;  4C3A A;  4IMU A;  5G6H A;  4FVZ A;  2FC1 A;  5FW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...