4UGOA

Structure of bacillus subtilis nitric oxide synthase in complex with n-(4-(2-(ethyl(3-(((e)-imino(thiophen-2-yl)methyl)amino)benzyl)amino) ethyl)phenyl)thiophene-2-carboximidamide
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
362
structure length
362
Chain Sequence
EEKEILWNEAKAFIAACYQELGKAAEVKDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPPEEKGEKQVEIWNHQLIRYAGYESDGERIGDPASCSLTAACEELGWRGERTDFDLLPLIFRMKGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQAEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDKPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NITRIC OXIDE SYNTHASE OXYGENASE
publication title Inhibitor Bound Crystal Structures of Bacterial Nitric Oxide Synthase.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 127
structure length 362
sequence length 362
ec nomenclature ec 1.14.14.47: Nitric-oxide synthase (flavodoxin).
pdb deposition date 2015-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02898 NO_synthase Nitric oxide synthase, oxygenase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.340.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase; Chain A, domain 1 Nitric Oxide Synthase; Chain A, domain 1 4ugoA01
3.90.440.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase;Heme Domain; Chain A, domain 2 Nitric Oxide Synthase;Heme Domain;Chain A domain 2 4ugoA02
3.90.1230.10 Alpha Beta Alpha-Beta Complex Bovine Endothelial Nitric Oxide Synthase Heme Domain; Chain: A,domain 3 Nitric Oxide Synthase; Chain A, domain 3 4ugoA03
1D1VA 2FBZX 3E7MA 4D30A 5G6PA 4CUMA 4CAMA 3NSEA 5G6LA 3NLZA 3DWJA 3RQOA 5FVSA 5AD4A 3JWUA 4D31A 4D1NA 4UGDA 4CTRA 3E7SA 3JWXA 1QOMA 2NSIA 3N2RA 4UGYA 5ADAA 5FVXA 4UPTA 4UGWA 4UGQA 5FVVA 3JT6A 4UGXA 4UGNA 4K5JA 4D1OA 3NQSA 2AN0A 4K5HA 5FVZA 5ADMA 4K5FA 1M00A 3UFVA 1K2SA 5G0NA 3DQSA 1OM4A 4D1PA 3UFUA 4V3VA 3HSPA 3JX4A 3JX2A 4CANA 3JX0A 4CX1A 5ADEA 4JSEA 2ORPA 1R35A 4UQRA 4JSMA 4FW0A 4CTTA 5AGPA 5G69A 4CULA 3N5XA 1ZZUA 3N6FA 4CARA 3N5RA 4UGFA 2HX2A 4K5DA 1ZZSA 5FVTA 4UCHA 4FVYA 3UFSA 3PNGA 2NOSA 4UPMA 1D0CA 1NOSA 1VAFA 3NLMA 4UGIA 5G66A 4IMWA 4CUNA 4UGJA 1M8DA 5FVPA 5FVOA 4UGKA 4UH2A 5G6JA 1LZZA 3E7SB 3PNHA 3NLQA 4UG9A 5ADGA 2G6MA 5G6IA 3TYNA 4UH8A 5G6KA 5FVRA 4CWYA 7NSEA 4C39A 1I83A 1FOJA 2G6IA 3JWSA 5G6MA 3E7GA 4UH9A 1D1YA 4D34A 3NLGA 4D32A 4JS9A 4D3JA 4CFTA 4UQSA 3N5VA 1DM8A 3EJ8A 1DD7A 5G6CA 4D3NA 3N5ZA 4EUXA 3E7IA 4D3VA 5AD5A 3NNYA 5G6QA 3JX6A 4KCNA 3N6BA 5AD6A 4NSEA 3JX5A 4UH1A 1JWKA 4UGLA 3JX3A 1M9KA 4KCKA 3TYLA 4CTVA 1D1WA 4CTZA 4CX2A 4KCQA 2NSEA 3N69A 5FJ2A 4CAPA 3N6AA 4D3KA 4CTWA 3N6EA 2FLQA 4JSKA 3JWYA 9NSEA 4D3MA 3NLVA 4UPRA 4JSJA 3NLKA 2Y37A 5G6AA 3SVPA 5ADKA 3DQRA 5AGNA 5G6BA 3UFOA 5G6NA 2G6NA 5FJ3A 3Q9AA 4UGTA 5FW0A 4CTYA 4UGVA 1OM5A 4UH5A 1K2UA 3B3OA 3JWWA 1QW5A 1ZZTA 5G6GA 1MMWA 1RS8A 2FC1A 1ED4A 1QWCA 1ZZRA 1QW4A 5ADFA 1M8EA 4D7JA 4UG5A 4KCPA 3TYMA 3B3MA 5G65A 4CWWA 3N68A 3N5QA 3JWZA 4CFTB 4UGBA 5G68A 5G0PA 4K5GA 1RS6A 3UFQA 5FVQA 4V3XA 3N66A 3N64A 3EAIA 3NLYA 4K5EA 3E65A 4C3AA 3Q99A 2FC2A 2HX3A 2ORSA 4CX3A 1P6HA 4KCLA 4UG6A 4UGEA 1DF1A 3NOSA 4CX0A 5ADDA 4GQEA 4D36A 1K2TA 5ADJA 3N65A 4D39A 3N5PA 5FVUA 4CTQA 2BHJA 4CX4A 3JT8A 3E67A 3RQMA 1M9JA 3RQNA 3E68A 4UH3A 4CU1A 1NSIA 3N62A 4D3IA 4UH4A 5G6EA 1P6NA 4UGRA 5AGOA 3UFTA 4UGCA 4IMSA 1DWXA 1JWJA 4CTUA 4V3ZA 4D2ZA 1DM6A 4CDTA 3RQJA 4UPOA 1D1XA 5AD9A 5AGMA 3E6TA 3NLNA 4JSGA 4D35A 3RQPA 4FVZA 1FOPA 5AD8A 4UGSA 3N63A 4CX5A 1P6MA 3JT3A 4UPPA 1ZZQA 3N5YA 3HSNA 1DM7A 3NW2A 4CTXA 3HSOA 5ADNA 4CTPA 1P6JA 2G6LA 4IMUA 1DMIA 4D3TA 3PNEA 3N61A 1ZVIA 3NLEA 4UPQA 4D38A 5ADBA 3JT7A 1NOCA 3B3PA 4CX6A 4UPSA 4UGMA 3NLFA 1N2NA 4UG8A 4KCRA 3NLWA 4UHAA 5G6DA 1NSEA 5G6HA 4JSIA 3RQKA 1FOIA 1ED6A 3UFPA 3NLPA 2AN2A 1FOLA 4CU1B 4UGAA 4CVGA 4JSFA 2HX4A 4CAQA 4D7OA 4CWZA 3TYOA 3NLDA 2NODA 3FC5A 1ED5A 1M9RA 3NLJA 4JSHA 3E7TA 1P6LA 2ORTA 3E6LA 3NODA 4LWBA 1RS9A 3NLXA 3JT4A 4D2YA 4D3AA 4V3UA 3JTAA 3N5TA 5AGLA 1MJTA 4UGOA 2ORQA 4UH7A 5NSEA 4UH0A 3NLTA 3UFWA 2G6JA 4JSLA 1M7ZA 4CWVA 5FVWA 4LUWA 3N5WA 1M9MA 4KCHA 4LUXA 3NLOA 4IMXA 5G0OA 5ADCA 3E6OA 3RQLA 5G6FA 2OROA 4D3OA 5G67A 3NM0A 1NODA 1VAGA 4CX7A 1MMVA 2G6HA 3JWTA 4LWAA 1ZVLA 4KCJA 4D3BA 3EBFA 1D0OA 3JT5A 4D37A 8NSEA 1M9QA 1DMJA 4FVWA 4KCOA 1M8HA 3JWVA 4KCIA 4UGPA 3PNFA 3NLIA 5FVYA 4K5KA 5AGKA 1P6KA 2G6OA 4D7HA 4KCSA 3B3NA 4V3YA 1M9TA 4KCMA 5ADLA 4UGGA 1DWVA 4CWXA 1Q2OA 1M7VA 3SVQA 4K5IA 4NOSA 4D33A 2AMOA 3N67A 3N60A 1DWWA 3N6CA 1P6IA 3DQTA 5ADIA 4IMTA 3NLRA 4UG7A 5AD7A 3NLUA 1K2RA 1FOOA 4FVXA 3NNZA 1DMKA 4CAOA 2ORRA 4UGZA 3JT9A 3N6DA 5G6OA 4UGUA 3EAHA 3E6NA 1M8IA 4UPNA 1LZXA 2G6KA 3NLHA 3N5SA 4UH6A 4CU0A 1QW6A 4D3UA 4UGHA 4D7IA 6NSEA 3EBDA 3UFRA 3N6GA 3JX1A 1RS7A 4V3WA
chains in the Genus database with same CATH superfamily
1D1VA 2FBZX 3E7MA 4D30A 5G6PA 4CUMA 4CAMA 3NSEA 5G6LA 3NLZA 3DWJA 3RQOA 5FVSA 5AD4A 3JWUA 4D31A 4D1NA 4UGDA 4CTRA 3E7SA 3JWXA 1QOMA 2NSIA 3N2RA 4UGYA 5ADAA 5FVXA 4UPTA 4UGWA 4UGQA 5FVVA 3JT6A 4UGXA 4UGNA 4K5JA 4D1OA 3NQSA 2AN0A 4K5HA 5FVZA 5ADMA 4K5FA 1M00A 3UFVA 1K2SA 5G0NA 3DQSA 1OM4A 4D1PA 3UFUA 4V3VA 3HSPA 3JX4A 3JX2A 4CANA 3JX0A 4CX1A 5ADEA 4JSEA 2ORPA 1R35A 4UQRA 4JSMA 4FW0A 4CTTA 5AGPA 5G69A 4CULA 3N5XA 1ZZUA 3N6FA 4CARA 3N5RA 4UGFA 2HX2A 4K5DA 1ZZSA 5FVTA 4UCHA 4FVYA 3UFSA 3PNGA 2NOSA 4UPMA 1D0CA 1NOSA 1VAFA 3NLMA 4UGIA 5G66A 4IMWA 4CUNA 4UGJA 1M8DA 5FVPA 5FVOA 4UGKA 4UH2A 5G6JA 1LZZA 3E7SB 3PNHA 3NLQA 4UG9A 5ADGA 2G6MA 5G6IA 3TYNA 4UH8A 5G6KA 5FVRA 4CWYA 7NSEA 4C39A 1I83A 1FOJA 2G6IA 3JWSA 5G6MA 3E7GA 4UH9A 1D1YA 4D34A 3NLGA 4D32A 4JS9A 4D3JA 4CFTA 4UQSA 3N5VA 1DM8A 3EJ8A 1DD7A 5G6CA 4D3NA 3N5ZA 4EUXA 3E7IA 4D3VA 5AD5A 3NNYA 5G6QA 3JX6A 4KCNA 3N6BA 5AD6A 4NSEA 3JX5A 4UH1A 1JWKA 4UGLA 3JX3A 1M9KA 4KCKA 3TYLA 4CTVA 1D1WA 4CTZA 4CX2A 4KCQA 2NSEA 3N69A 5FJ2A 4CAPA 3N6AA 4D3KA 4CTWA 3N6EA 2FLQA 4JSKA 3JWYA 9NSEA 4D3MA 3NLVA 4UPRA 4JSJA 3NLKA 2Y37A 5G6AA 3SVPA 5ADKA 3DQRA 5AGNA 5G6BA 3UFOA 5G6NA 2G6NA 5FJ3A 3Q9AA 4UGTA 5FW0A 4CTYA 4UGVA 1OM5A 4UH5A 1K2UA 3B3OA 3JWWA 1QW5A 1ZZTA 5G6GA 1MMWA 1RS8A 2FC1A 1ED4A 1QWCA 1ZZRA 1QW4A 5ADFA 1M8EA 4D7JA 4UG5A 4KCPA 3TYMA 3B3MA 5G65A 4CWWA 3N68A 3N5QA 3JWZA 4CFTB 4UGBA 5G68A 5G0PA 4K5GA 1RS6A 3UFQA 5FVQA 4V3XA 3N66A 3N64A 3EAIA 3NLYA 4K5EA 3E65A 4C3AA 3Q99A 2FC2A 2HX3A 2ORSA 4CX3A 1P6HA 4KCLA 4UG6A 4UGEA 1DF1A 3NOSA 4CX0A 5ADDA 4GQEA 4D36A 1K2TA 5ADJA 3N65A 4D39A 3N5PA 5FVUA 4CTQA 2BHJA 4CX4A 3JT8A 3E67A 3RQMA 1M9JA 3RQNA 3E68A 4UH3A 4CU1A 1NSIA 3N62A 4D3IA 4UH4A 5G6EA 1P6NA 4UGRA 5AGOA 3UFTA 4UGCA 4IMSA 1DWXA 1JWJA 4CTUA 4V3ZA 4D2ZA 1DM6A 4CDTA 3RQJA 4UPOA 1D1XA 5AD9A 5AGMA 3E6TA 3NLNA 4JSGA 4D35A 3RQPA 4FVZA 1FOPA 5AD8A 4UGSA 3N63A 4CX5A 1P6MA 3JT3A 4UPPA 1ZZQA 3N5YA 3HSNA 1DM7A 3NW2A 4CTXA 3HSOA 5ADNA 4CTPA 1P6JA 2G6LA 4IMUA 1DMIA 4D3TA 3PNEA 3N61A 1ZVIA 3NLEA 4UPQA 4D38A 5ADBA 3JT7A 1NOCA 3B3PA 4CX6A 4UPSA 4UGMA 3NLFA 1N2NA 4UG8A 4KCRA 3NLWA 4UHAA 5G6DA 1NSEA 5G6HA 4JSIA 3RQKA 1FOIA 1ED6A 3UFPA 3NLPA 2AN2A 1FOLA 4CU1B 4UGAA 4CVGA 4JSFA 2HX4A 4CAQA 4D7OA 4CWZA 3TYOA 3NLDA 2NODA 3FC5A 1ED5A 1M9RA 3NLJA 4JSHA 3E7TA 1P6LA 2ORTA 3E6LA 3NODA 4LWBA 1RS9A 3NLXA 3JT4A 4D2YA 4D3AA 4V3UA 3JTAA 3N5TA 5AGLA 1MJTA 4UGOA 2ORQA 4UH7A 5NSEA 4UH0A 3NLTA 3UFWA 2G6JA 4JSLA 1M7ZA 4CWVA 5FVWA 4LUWA 3N5WA 1M9MA 4KCHA 4LUXA 3NLOA 4IMXA 5G0OA 5ADCA 3E6OA 3RQLA 5G6FA 2OROA 4D3OA 5G67A 3NM0A 1NODA 1VAGA 4CX7A 1MMVA 2G6HA 3JWTA 4LWAA 1ZVLA 4KCJA 4D3BA 3EBFA 1D0OA 3JT5A 4D37A 8NSEA 1M9QA 1DMJA 4FVWA 4KCOA 1M8HA 3JWVA 4KCIA 4UGPA 3PNFA 3NLIA 5FVYA 4K5KA 5AGKA 1P6KA 2G6OA 4D7HA 4KCSA 3B3NA 4V3YA 1M9TA 4KCMA 5ADLA 4UGGA 1DWVA 4CWXA 1Q2OA 1M7VA 3SVQA 4K5IA 4NOSA 4D33A 2AMOA 3N67A 3N60A 1DWWA 3N6CA 1P6IA 3DQTA 5ADIA 4IMTA 3NLRA 4UG7A 5AD7A 3NLUA 1K2RA 1FOOA 4FVXA 3NNZA 1DMKA 4CAOA 2ORRA 4UGZA 3JT9A 3N6DA 5G6OA 4UGUA 3EAHA 3E6NA 1M8IA 4UPNA 1LZXA 2G6KA 3NLHA 3N5SA 4UH6A 4CU0A 1QW6A 4D3UA 4UGHA 4D7IA 6NSEA 3EBDA 3UFRA 3N6GA 3JX1A 1RS7A 4V3WA
chains in the Genus database with same CATH topology
1D1VA 2FBZX 3E7MA 4D30A 5G6PA 4CUMA 4CAMA 3NSEA 5G6LA 3NLZA 3DWJA 3RQOA 5FVSA 5AD4A 3JWUA 4D31A 4D1NA 4UGDA 4CTRA 3E7SA 3JWXA 1QOMA 2NSIA 3N2RA 4UGYA 5ADAA 5FVXA 4UPTA 4UGWA 4UGQA 5FVVA 3JT6A 4UGXA 4UGNA 4K5JA 4D1OA 3NQSA 2AN0A 4K5HA 5FVZA 5ADMA 4K5FA 1M00A 3UFVA 1K2SA 5G0NA 3DQSA 1OM4A 4D1PA 3UFUA 4V3VA 3HSPA 3JX4A 3JX2A 4CANA 3JX0A 4CX1A 5ADEA 4JSEA 2ORPA 1R35A 4UQRA 4JSMA 4FW0A 4CTTA 5AGPA 5G69A 4CULA 3N5XA 1ZZUA 3N6FA 4CARA 3N5RA 4UGFA 2HX2A 4K5DA 1ZZSA 5FVTA 4UCHA 4FVYA 3UFSA 3PNGA 2NOSA 4UPMA 1D0CA 1NOSA 1VAFA 3NLMA 4UGIA 5G66A 4IMWA 4CUNA 4UGJA 1M8DA 5FVPA 5FVOA 4UGKA 4UH2A 5G6JA 1LZZA 3E7SB 3PNHA 3NLQA 4UG9A 5ADGA 2G6MA 5G6IA 3TYNA 4UH8A 5G6KA 5FVRA 4CWYA 7NSEA 4C39A 1I83A 1FOJA 2G6IA 3JWSA 5G6MA 3E7GA 4UH9A 1D1YA 4D34A 3NLGA 4D32A 4JS9A 4D3JA 4CFTA 4UQSA 3N5VA 1DM8A 3EJ8A 1DD7A 5G6CA 4D3NA 3N5ZA 4EUXA 3E7IA 4D3VA 5AD5A 3NNYA 5G6QA 3JX6A 4KCNA 3N6BA 5AD6A 4NSEA 3JX5A 4UH1A 1JWKA 4UGLA 3JX3A 1M9KA 4KCKA 3TYLA 4CTVA 1D1WA 4CTZA 4CX2A 4KCQA 2NSEA 3N69A 5FJ2A 4CAPA 3N6AA 4D3KA 4CTWA 3N6EA 2FLQA 4JSKA 3JWYA 9NSEA 4D3MA 3NLVA 4UPRA 4JSJA 3NLKA 2Y37A 5G6AA 3SVPA 5ADKA 3DQRA 5AGNA 5G6BA 3UFOA 5G6NA 2G6NA 5FJ3A 3Q9AA 4UGTA 5FW0A 4CTYA 4UGVA 1OM5A 4UH5A 1K2UA 3B3OA 3JWWA 1QW5A 1ZZTA 5G6GA 1MMWA 1RS8A 2FC1A 1ED4A 1QWCA 1ZZRA 1QW4A 5ADFA 1M8EA 4D7JA 4UG5A 4KCPA 3TYMA 3B3MA 5G65A 4CWWA 3N68A 3N5QA 3JWZA 4CFTB 4UGBA 5G68A 5G0PA 4K5GA 1RS6A 3UFQA 5FVQA 4V3XA 3N66A 3N64A 3EAIA 3NLYA 4K5EA 3E65A 4C3AA 3Q99A 2FC2A 2HX3A 2ORSA 4CX3A 1P6HA 4KCLA 4UG6A 4UGEA 1DF1A 3NOSA 4CX0A 5ADDA 4GQEA 4D36A 1K2TA 5ADJA 3N65A 4D39A 3N5PA 5FVUA 4CTQA 2BHJA 4CX4A 3JT8A 3E67A 3RQMA 1M9JA 3RQNA 3E68A 4UH3A 4CU1A 1NSIA 3N62A 4D3IA 4UH4A 5G6EA 1P6NA 4UGRA 5AGOA 3UFTA 4UGCA 4IMSA 1DWXA 1JWJA 4CTUA 4V3ZA 4D2ZA 1DM6A 4CDTA 3RQJA 4UPOA 1D1XA 5AD9A 5AGMA 3E6TA 3NLNA 4JSGA 4D35A 3RQPA 4FVZA 1FOPA 5AD8A 4UGSA 3N63A 4CX5A 1P6MA 3JT3A 4UPPA 1ZZQA 3N5YA 3HSNA 1DM7A 3NW2A 4CTXA 3HSOA 5ADNA 4CTPA 1P6JA 2G6LA 4IMUA 1DMIA 4D3TA 3PNEA 3N61A 1ZVIA 3NLEA 4UPQA 4D38A 5ADBA 3JT7A 1NOCA 3B3PA 4CX6A 4UPSA 4UGMA 3NLFA 1N2NA 4UG8A 4KCRA 3NLWA 4UHAA 5G6DA 1NSEA 5G6HA 4JSIA 3RQKA 1FOIA 1ED6A 3UFPA 3NLPA 2AN2A 1FOLA 4CU1B 4UGAA 4CVGA 4JSFA 2HX4A 4CAQA 4D7OA 4CWZA 3TYOA 3NLDA 2NODA 3FC5A 1ED5A 1M9RA 3NLJA 4JSHA 3E7TA 1P6LA 2ORTA 3E6LA 3NODA 4LWBA 1RS9A 3NLXA 3JT4A 4D2YA 4D3AA 4V3UA 3JTAA 3N5TA 5AGLA 1MJTA 4UGOA 2ORQA 4UH7A 5NSEA 4UH0A 3NLTA 3UFWA 2G6JA 4JSLA 1M7ZA 4CWVA 5FVWA 4LUWA 3N5WA 1M9MA 4KCHA 4LUXA 3NLOA 4IMXA 5G0OA 5ADCA 3E6OA 3RQLA 5G6FA 2OROA 4D3OA 5G67A 3NM0A 1NODA 1VAGA 4CX7A 1MMVA 2G6HA 3JWTA 4LWAA 1ZVLA 4KCJA 4D3BA 3EBFA 1D0OA 3JT5A 4D37A 8NSEA 1M9QA 1DMJA 4FVWA 4KCOA 1M8HA 3JWVA 4KCIA 4UGPA 3PNFA 3NLIA 5FVYA 4K5KA 5AGKA 1P6KA 2G6OA 4D7HA 4KCSA 3B3NA 4V3YA 1M9TA 4KCMA 5ADLA 4UGGA 1DWVA 4CWXA 1Q2OA 1M7VA 3SVQA 4K5IA 4NOSA 4D33A 2AMOA 3N67A 3N60A 1DWWA 3N6CA 1P6IA 3DQTA 5ADIA 4IMTA 3NLRA 4UG7A 5AD7A 3NLUA 1K2RA 1FOOA 4FVXA 3NNZA 1DMKA 4CAOA 2ORRA 4UGZA 3JT9A 3N6DA 5G6OA 4UGUA 3EAHA 3E6NA 1M8IA 4UPNA 1LZXA 2G6KA 3NLHA 3N5SA 4UH6A 4CU0A 1QW6A 4D3UA 4UGHA 4D7IA 6NSEA 3EBDA 3UFRA 3N6GA 3JX1A 1RS7A 4V3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D1V A;  2FBZ X;  3E7M A;  4D30 A;  5G6P A;  4CUM A;  4CAM A;  3NSE A;  5G6L A;  3NLZ A;  3DWJ A;  3RQO A;  5FVS A;  5AD4 A;  3JWU A;  4D31 A;  4D1N A;  4UGD A;  4CTR A;  3E7S A;  3JWX A;  1QOM A;  2NSI A;  3N2R A;  4UGY A;  5ADA A;  5FVX A;  4UPT A;  4UGW A;  4UGQ A;  5FVV A;  3JT6 A;  4UGX A;  4UGN A;  4K5J A;  4D1O A;  3NQS A;  2AN0 A;  4K5H A;  5FVZ A;  5ADM A;  4K5F A;  1M00 A;  3UFV A;  1K2S A;  5G0N A;  3DQS A;  1OM4 A;  4D1P A;  3UFU A;  4V3V A;  3HSP A;  3JX4 A;  3JX2 A;  4CAN A;  3JX0 A;  4CX1 A;  5ADE A;  4JSE A;  2ORP A;  1R35 A;  4UQR A;  4JSM A;  4FW0 A;  4CTT A;  5AGP A;  5G69 A;  4CUL A;  3N5X A;  1ZZU A;  3N6F A;  4CAR A;  3N5R A;  4UGF A;  2HX2 A;  4K5D A;  1ZZS A;  5FVT A;  4UCH A;  4FVY A;  3UFS A;  3PNG A;  2NOS A;  4UPM A;  1D0C A;  1NOS A;  1VAF A;  3NLM A;  4UGI A;  5G66 A;  4IMW A;  4CUN A;  4UGJ A;  1M8D A;  5FVP A;  5FVO A;  4UGK A;  4UH2 A;  5G6J A;  1LZZ A;  3E7S B;  3PNH A;  3NLQ A;  4UG9 A;  5ADG A;  2G6M A;  5G6I A;  3TYN A;  4UH8 A;  5G6K A;  5FVR A;  4CWY A;  7NSE A;  4C39 A;  1I83 A;  1FOJ A;  2G6I A;  3JWS A;  5G6M A;  3E7G A;  4UH9 A;  1D1Y A;  4D34 A;  3NLG A;  4D32 A;  4JS9 A;  4D3J A;  4CFT A;  4UQS A;  3N5V A;  1DM8 A;  3EJ8 A;  1DD7 A;  5G6C A;  4D3N A;  3N5Z A;  4EUX A;  3E7I A;  4D3V A;  5AD5 A;  3NNY A;  5G6Q A;  3JX6 A;  4KCN A;  3N6B A;  5AD6 A;  4NSE A;  3JX5 A;  4UH1 A;  1JWK A;  4UGL A;  3JX3 A;  1M9K A;  4KCK A;  3TYL A;  4CTV A;  1D1W A;  4CTZ A;  4CX2 A;  4KCQ A;  2NSE A;  3N69 A;  5FJ2 A;  4CAP A;  3N6A A;  4D3K A;  4CTW A;  3N6E A;  2FLQ A;  4JSK A;  3JWY A;  9NSE A;  4D3M A;  3NLV A;  4UPR A;  4JSJ A;  3NLK A;  2Y37 A;  5G6A A;  3SVP A;  5ADK A;  3DQR A;  5AGN A;  5G6B A;  3UFO A;  5G6N A;  2G6N A;  5FJ3 A;  3Q9A A;  4UGT A;  5FW0 A;  4CTY A;  4UGV A;  1OM5 A;  4UH5 A;  1K2U A;  3B3O A;  3JWW A;  1QW5 A;  1ZZT A;  5G6G A;  1MMW A;  1RS8 A;  2FC1 A;  1ED4 A;  1QWC A;  1ZZR A;  1QW4 A;  5ADF A;  1M8E A;  4D7J A;  4UG5 A;  4KCP A;  3TYM A;  3B3M A;  5G65 A;  4CWW A;  3N68 A;  3N5Q A;  3JWZ A;  4CFT B;  4UGB A;  5G68 A;  5G0P A;  4K5G A;  1RS6 A;  3UFQ A;  5FVQ A;  4V3X A;  3N66 A;  3N64 A;  3EAI A;  3NLY A;  4K5E A;  3E65 A;  4C3A A;  3Q99 A;  2FC2 A;  2HX3 A;  2ORS A;  4CX3 A;  1P6H A;  4KCL A;  4UG6 A;  4UGE A;  1DF1 A;  3NOS A;  4CX0 A;  5ADD A;  4GQE A;  4D36 A;  1K2T A;  5ADJ A;  3N65 A;  4D39 A;  3N5P A;  5FVU A;  4CTQ A;  2BHJ A;  4CX4 A;  3JT8 A;  3E67 A;  3RQM A;  1M9J A;  3RQN A;  3E68 A;  4UH3 A;  4CU1 A;  1NSI A;  3N62 A;  4D3I A;  4UH4 A;  5G6E A;  1P6N A;  4UGR A;  5AGO A;  3UFT A;  4UGC A;  4IMS A;  1DWX A;  1JWJ A;  4CTU A;  4V3Z A;  4D2Z A;  1DM6 A;  4CDT A;  3RQJ A;  4UPO A;  1D1X A;  5AD9 A;  5AGM A;  3E6T A;  3NLN A;  4JSG A;  4D35 A;  3RQP A;  4FVZ A;  1FOP A;  5AD8 A;  4UGS A;  3N63 A;  4CX5 A;  1P6M A;  3JT3 A;  4UPP A;  1ZZQ A;  3N5Y A;  3HSN A;  1DM7 A;  3NW2 A;  4CTX A;  3HSO A;  5ADN A;  4CTP A;  1P6J A;  2G6L A;  4IMU A;  1DMI A;  4D3T A;  3PNE A;  3N61 A;  1ZVI A;  3NLE A;  4UPQ A;  4D38 A;  5ADB A;  3JT7 A;  1NOC A;  3B3P A;  4CX6 A;  4UPS A;  4UGM A;  3NLF A;  1N2N A;  4UG8 A;  4KCR A;  3NLW A;  4UHA A;  5G6D A;  1NSE A;  5G6H A;  4JSI A;  3RQK A;  1FOI A;  1ED6 A;  3UFP A;  3NLP A;  2AN2 A;  1FOL A;  4CU1 B;  4UGA A;  4CVG A;  4JSF A;  2HX4 A;  4CAQ A;  4D7O A;  4CWZ A;  3TYO A;  3NLD A;  2NOD A;  3FC5 A;  1ED5 A;  1M9R A;  3NLJ A;  4JSH A;  3E7T A;  1P6L A;  2ORT A;  3E6L A;  3NOD A;  4LWB A;  1RS9 A;  3NLX A;  3JT4 A;  4D2Y A;  4D3A A;  4V3U A;  3JTA A;  3N5T A;  5AGL A;  1MJT A;  4UGO A;  2ORQ A;  4UH7 A;  5NSE A;  4UH0 A;  3NLT A;  3UFW A;  2G6J A;  4JSL A;  1M7Z A;  4CWV A;  5FVW A;  4LUW A;  3N5W A;  1M9M A;  4KCH A;  4LUX A;  3NLO A;  4IMX A;  5G0O A;  5ADC A;  3E6O A;  3RQL A;  5G6F A;  2ORO A;  4D3O A;  5G67 A;  3NM0 A;  1NOD A;  1VAG A;  4CX7 A;  1MMV A;  2G6H A;  3JWT A;  4LWA A;  1ZVL A;  4KCJ A;  4D3B A;  3EBF A;  1D0O A;  3JT5 A;  4D37 A;  8NSE A;  1M9Q A;  1DMJ A;  4FVW A;  4KCO A;  1M8H A;  3JWV A;  4KCI A;  4UGP A;  3PNF A;  3NLI A;  5FVY A;  4K5K A;  5AGK A;  1P6K A;  2G6O A;  4D7H A;  4KCS A;  3B3N A;  4V3Y A;  1M9T A;  4KCM A;  5ADL A;  4UGG A;  1DWV A;  4CWX A;  1Q2O A;  1M7V A;  3SVQ A;  4K5I A;  4NOS A;  4D33 A;  2AMO A;  3N67 A;  3N60 A;  1DWW A;  3N6C A;  1P6I A;  3DQT A;  5ADI A;  4IMT A;  3NLR A;  4UG7 A;  5AD7 A;  3NLU A;  1K2R A;  1FOO A;  4FVX A;  3NNZ A;  1DMK A;  4CAO A;  2ORR A;  4UGZ A;  3JT9 A;  3N6D A;  5G6O A;  4UGU A;  3EAH A;  3E6N A;  1M8I A;  4UPN A;  1LZX A;  2G6K A;  3NLH A;  3N5S A;  4UH6 A;  4CU0 A;  1QW6 A;  4D3U A;  4UGH A;  4D7I A;  6NSE A;  3EBD A;  3UFR A;  3N6G A;  3JX1 A;  1RS7 A;  4V3W A; 
#chains in the Genus database with same CATH topology
 1D1V A;  2FBZ X;  3E7M A;  4D30 A;  5G6P A;  4CUM A;  4CAM A;  3NSE A;  5G6L A;  3NLZ A;  3DWJ A;  3RQO A;  5FVS A;  5AD4 A;  3JWU A;  4D31 A;  4D1N A;  4UGD A;  4CTR A;  3E7S A;  3JWX A;  1QOM A;  2NSI A;  3N2R A;  4UGY A;  5ADA A;  5FVX A;  4UPT A;  4UGW A;  4UGQ A;  5FVV A;  3JT6 A;  4UGX A;  4UGN A;  4K5J A;  4D1O A;  3NQS A;  2AN0 A;  4K5H A;  5FVZ A;  5ADM A;  4K5F A;  1M00 A;  3UFV A;  1K2S A;  5G0N A;  3DQS A;  1OM4 A;  4D1P A;  3UFU A;  4V3V A;  3HSP A;  3JX4 A;  3JX2 A;  4CAN A;  3JX0 A;  4CX1 A;  5ADE A;  4JSE A;  2ORP A;  1R35 A;  4UQR A;  4JSM A;  4FW0 A;  4CTT A;  5AGP A;  5G69 A;  4CUL A;  3N5X A;  1ZZU A;  3N6F A;  4CAR A;  3N5R A;  4UGF A;  2HX2 A;  4K5D A;  1ZZS A;  5FVT A;  4UCH A;  4FVY A;  3UFS A;  3PNG A;  2NOS A;  4UPM A;  1D0C A;  1NOS A;  1VAF A;  3NLM A;  4UGI A;  5G66 A;  4IMW A;  4CUN A;  4UGJ A;  1M8D A;  5FVP A;  5FVO A;  4UGK A;  4UH2 A;  5G6J A;  1LZZ A;  3E7S B;  3PNH A;  3NLQ A;  4UG9 A;  5ADG A;  2G6M A;  5G6I A;  3TYN A;  4UH8 A;  5G6K A;  5FVR A;  4CWY A;  7NSE A;  4C39 A;  1I83 A;  1FOJ A;  2G6I A;  3JWS A;  5G6M A;  3E7G A;  4UH9 A;  1D1Y A;  4D34 A;  3NLG A;  4D32 A;  4JS9 A;  4D3J A;  4CFT A;  4UQS A;  3N5V A;  1DM8 A;  3EJ8 A;  1DD7 A;  5G6C A;  4D3N A;  3N5Z A;  4EUX A;  3E7I A;  4D3V A;  5AD5 A;  3NNY A;  5G6Q A;  3JX6 A;  4KCN A;  3N6B A;  5AD6 A;  4NSE A;  3JX5 A;  4UH1 A;  1JWK A;  4UGL A;  3JX3 A;  1M9K A;  4KCK A;  3TYL A;  4CTV A;  1D1W A;  4CTZ A;  4CX2 A;  4KCQ A;  2NSE A;  3N69 A;  5FJ2 A;  4CAP A;  3N6A A;  4D3K A;  4CTW A;  3N6E A;  2FLQ A;  4JSK A;  3JWY A;  9NSE A;  4D3M A;  3NLV A;  4UPR A;  4JSJ A;  3NLK A;  2Y37 A;  5G6A A;  3SVP A;  5ADK A;  3DQR A;  5AGN A;  5G6B A;  3UFO A;  5G6N A;  2G6N A;  5FJ3 A;  3Q9A A;  4UGT A;  5FW0 A;  4CTY A;  4UGV A;  1OM5 A;  4UH5 A;  1K2U A;  3B3O A;  3JWW A;  1QW5 A;  1ZZT A;  5G6G A;  1MMW A;  1RS8 A;  2FC1 A;  1ED4 A;  1QWC A;  1ZZR A;  1QW4 A;  5ADF A;  1M8E A;  4D7J A;  4UG5 A;  4KCP A;  3TYM A;  3B3M A;  5G65 A;  4CWW A;  3N68 A;  3N5Q A;  3JWZ A;  4CFT B;  4UGB A;  5G68 A;  5G0P A;  4K5G A;  1RS6 A;  3UFQ A;  5FVQ A;  4V3X A;  3N66 A;  3N64 A;  3EAI A;  3NLY A;  4K5E A;  3E65 A;  4C3A A;  3Q99 A;  2FC2 A;  2HX3 A;  2ORS A;  4CX3 A;  1P6H A;  4KCL A;  4UG6 A;  4UGE A;  1DF1 A;  3NOS A;  4CX0 A;  5ADD A;  4GQE A;  4D36 A;  1K2T A;  5ADJ A;  3N65 A;  4D39 A;  3N5P A;  5FVU A;  4CTQ A;  2BHJ A;  4CX4 A;  3JT8 A;  3E67 A;  3RQM A;  1M9J A;  3RQN A;  3E68 A;  4UH3 A;  4CU1 A;  1NSI A;  3N62 A;  4D3I A;  4UH4 A;  5G6E A;  1P6N A;  4UGR A;  5AGO A;  3UFT A;  4UGC A;  4IMS A;  1DWX A;  1JWJ A;  4CTU A;  4V3Z A;  4D2Z A;  1DM6 A;  4CDT A;  3RQJ A;  4UPO A;  1D1X A;  5AD9 A;  5AGM A;  3E6T A;  3NLN A;  4JSG A;  4D35 A;  3RQP A;  4FVZ A;  1FOP A;  5AD8 A;  4UGS A;  3N63 A;  4CX5 A;  1P6M A;  3JT3 A;  4UPP A;  1ZZQ A;  3N5Y A;  3HSN A;  1DM7 A;  3NW2 A;  4CTX A;  3HSO A;  5ADN A;  4CTP A;  1P6J A;  2G6L A;  4IMU A;  1DMI A;  4D3T A;  3PNE A;  3N61 A;  1ZVI A;  3NLE A;  4UPQ A;  4D38 A;  5ADB A;  3JT7 A;  1NOC A;  3B3P A;  4CX6 A;  4UPS A;  4UGM A;  3NLF A;  1N2N A;  4UG8 A;  4KCR A;  3NLW A;  4UHA A;  5G6D A;  1NSE A;  5G6H A;  4JSI A;  3RQK A;  1FOI A;  1ED6 A;  3UFP A;  3NLP A;  2AN2 A;  1FOL A;  4CU1 B;  4UGA A;  4CVG A;  4JSF A;  2HX4 A;  4CAQ A;  4D7O A;  4CWZ A;  3TYO A;  3NLD A;  2NOD A;  3FC5 A;  1ED5 A;  1M9R A;  3NLJ A;  4JSH A;  3E7T A;  1P6L A;  2ORT A;  3E6L A;  3NOD A;  4LWB A;  1RS9 A;  3NLX A;  3JT4 A;  4D2Y A;  4D3A A;  4V3U A;  3JTA A;  3N5T A;  5AGL A;  1MJT A;  4UGO A;  2ORQ A;  4UH7 A;  5NSE A;  4UH0 A;  3NLT A;  3UFW A;  2G6J A;  4JSL A;  1M7Z A;  4CWV A;  5FVW A;  4LUW A;  3N5W A;  1M9M A;  4KCH A;  4LUX A;  3NLO A;  4IMX A;  5G0O A;  5ADC A;  3E6O A;  3RQL A;  5G6F A;  2ORO A;  4D3O A;  5G67 A;  3NM0 A;  1NOD A;  1VAG A;  4CX7 A;  1MMV A;  2G6H A;  3JWT A;  4LWA A;  1ZVL A;  4KCJ A;  4D3B A;  3EBF A;  1D0O A;  3JT5 A;  4D37 A;  8NSE A;  1M9Q A;  1DMJ A;  4FVW A;  4KCO A;  1M8H A;  3JWV A;  4KCI A;  4UGP A;  3PNF A;  3NLI A;  5FVY A;  4K5K A;  5AGK A;  1P6K A;  2G6O A;  4D7H A;  4KCS A;  3B3N A;  4V3Y A;  1M9T A;  4KCM A;  5ADL A;  4UGG A;  1DWV A;  4CWX A;  1Q2O A;  1M7V A;  3SVQ A;  4K5I A;  4NOS A;  4D33 A;  2AMO A;  3N67 A;  3N60 A;  1DWW A;  3N6C A;  1P6I A;  3DQT A;  5ADI A;  4IMT A;  3NLR A;  4UG7 A;  5AD7 A;  3NLU A;  1K2R A;  1FOO A;  4FVX A;  3NNZ A;  1DMK A;  4CAO A;  2ORR A;  4UGZ A;  3JT9 A;  3N6D A;  5G6O A;  4UGU A;  3EAH A;  3E6N A;  1M8I A;  4UPN A;  1LZX A;  2G6K A;  3NLH A;  3N5S A;  4UH6 A;  4CU0 A;  1QW6 A;  4D3U A;  4UGH A;  4D7I A;  6NSE A;  3EBD A;  3UFR A;  3N6G A;  3JX1 A;  1RS7 A;  4V3W A; 
#chains in the Genus database with same CATH homology
 1D1V A;  2FBZ X;  3E7M A;  4D30 A;  5G6P A;  4CUM A;  4CAM A;  3NSE A;  5G6L A;  3NLZ A;  3DWJ A;  3RQO A;  5FVS A;  5AD4 A;  3JWU A;  4D31 A;  4D1N A;  4UGD A;  4CTR A;  3E7S A;  3JWX A;  1QOM A;  2NSI A;  3N2R A;  4UGY A;  5ADA A;  5FVX A;  4UPT A;  4UGW A;  4UGQ A;  5FVV A;  3JT6 A;  4UGX A;  4UGN A;  4K5J A;  4D1O A;  3NQS A;  2AN0 A;  4K5H A;  5FVZ A;  5ADM A;  4K5F A;  1M00 A;  3UFV A;  1K2S A;  5G0N A;  3DQS A;  1OM4 A;  4D1P A;  3UFU A;  4V3V A;  3HSP A;  3JX4 A;  3JX2 A;  4CAN A;  3JX0 A;  4CX1 A;  5ADE A;  4JSE A;  2ORP A;  1R35 A;  4UQR A;  4JSM A;  4FW0 A;  4CTT A;  5AGP A;  5G69 A;  4CUL A;  3N5X A;  1ZZU A;  3N6F A;  4CAR A;  3N5R A;  4UGF A;  2HX2 A;  4K5D A;  1ZZS A;  5FVT A;  4UCH A;  4FVY A;  3UFS A;  3PNG A;  2NOS A;  4UPM A;  1D0C A;  1NOS A;  1VAF A;  3NLM A;  4UGI A;  5G66 A;  4IMW A;  4CUN A;  4UGJ A;  1M8D A;  5FVP A;  5FVO A;  4UGK A;  4UH2 A;  5G6J A;  1LZZ A;  3E7S B;  3PNH A;  3NLQ A;  4UG9 A;  5ADG A;  2G6M A;  5G6I A;  3TYN A;  4UH8 A;  5G6K A;  5FVR A;  4CWY A;  7NSE A;  4C39 A;  1I83 A;  1FOJ A;  2G6I A;  3JWS A;  5G6M A;  3E7G A;  4UH9 A;  1D1Y A;  4D34 A;  3NLG A;  4D32 A;  4JS9 A;  4D3J A;  4CFT A;  4UQS A;  3N5V A;  1DM8 A;  3EJ8 A;  1DD7 A;  5G6C A;  4D3N A;  3N5Z A;  4EUX A;  3E7I A;  4D3V A;  5AD5 A;  3NNY A;  5G6Q A;  3JX6 A;  4KCN A;  3N6B A;  5AD6 A;  4NSE A;  3JX5 A;  4UH1 A;  1JWK A;  4UGL A;  3JX3 A;  1M9K A;  4KCK A;  3TYL A;  4CTV A;  1D1W A;  4CTZ A;  4CX2 A;  4KCQ A;  2NSE A;  3N69 A;  5FJ2 A;  4CAP A;  3N6A A;  4D3K A;  4CTW A;  3N6E A;  2FLQ A;  4JSK A;  3JWY A;  9NSE A;  4D3M A;  3NLV A;  4UPR A;  4JSJ A;  3NLK A;  2Y37 A;  5G6A A;  3SVP A;  5ADK A;  3DQR A;  5AGN A;  5G6B A;  3UFO A;  5G6N A;  2G6N A;  5FJ3 A;  3Q9A A;  4UGT A;  5FW0 A;  4CTY A;  4UGV A;  1OM5 A;  4UH5 A;  1K2U A;  3B3O A;  3JWW A;  1QW5 A;  1ZZT A;  5G6G A;  1MMW A;  1RS8 A;  2FC1 A;  1ED4 A;  1QWC A;  1ZZR A;  1QW4 A;  5ADF A;  1M8E A;  4D7J A;  4UG5 A;  4KCP A;  3TYM A;  3B3M A;  5G65 A;  4CWW A;  3N68 A;  3N5Q A;  3JWZ A;  4CFT B;  4UGB A;  5G68 A;  5G0P A;  4K5G A;  1RS6 A;  3UFQ A;  5FVQ A;  4V3X A;  3N66 A;  3N64 A;  3EAI A;  3NLY A;  4K5E A;  3E65 A;  4C3A A;  3Q99 A;  2FC2 A;  2HX3 A;  2ORS A;  4CX3 A;  1P6H A;  4KCL A;  4UG6 A;  4UGE A;  1DF1 A;  3NOS A;  4CX0 A;  5ADD A;  4GQE A;  4D36 A;  1K2T A;  5ADJ A;  3N65 A;  4D39 A;  3N5P A;  5FVU A;  4CTQ A;  2BHJ A;  4CX4 A;  3JT8 A;  3E67 A;  3RQM A;  1M9J A;  3RQN A;  3E68 A;  4UH3 A;  4CU1 A;  1NSI A;  3N62 A;  4D3I A;  4UH4 A;  5G6E A;  1P6N A;  4UGR A;  5AGO A;  3UFT A;  4UGC A;  4IMS A;  1DWX A;  1JWJ A;  4CTU A;  4V3Z A;  4D2Z A;  1DM6 A;  4CDT A;  3RQJ A;  4UPO A;  1D1X A;  5AD9 A;  5AGM A;  3E6T A;  3NLN A;  4JSG A;  4D35 A;  3RQP A;  4FVZ A;  1FOP A;  5AD8 A;  4UGS A;  3N63 A;  4CX5 A;  1P6M A;  3JT3 A;  4UPP A;  1ZZQ A;  3N5Y A;  3HSN A;  1DM7 A;  3NW2 A;  4CTX A;  3HSO A;  5ADN A;  4CTP A;  1P6J A;  2G6L A;  4IMU A;  1DMI A;  4D3T A;  3PNE A;  3N61 A;  1ZVI A;  3NLE A;  4UPQ A;  4D38 A;  5ADB A;  3JT7 A;  1NOC A;  3B3P A;  4CX6 A;  4UPS A;  4UGM A;  3NLF A;  1N2N A;  4UG8 A;  4KCR A;  3NLW A;  4UHA A;  5G6D A;  1NSE A;  5G6H A;  4JSI A;  3RQK A;  1FOI A;  1ED6 A;  3UFP A;  3NLP A;  2AN2 A;  1FOL A;  4CU1 B;  4UGA A;  4CVG A;  4JSF A;  2HX4 A;  4CAQ A;  4D7O A;  4CWZ A;  3TYO A;  3NLD A;  2NOD A;  3FC5 A;  1ED5 A;  1M9R A;  3NLJ A;  4JSH A;  3E7T A;  1P6L A;  2ORT A;  3E6L A;  3NOD A;  4LWB A;  1RS9 A;  3NLX A;  3JT4 A;  4D2Y A;  4D3A A;  4V3U A;  3JTA A;  3N5T A;  5AGL A;  1MJT A;  4UGO A;  2ORQ A;  4UH7 A;  5NSE A;  4UH0 A;  3NLT A;  3UFW A;  2G6J A;  4JSL A;  1M7Z A;  4CWV A;  5FVW A;  4LUW A;  3N5W A;  1M9M A;  4KCH A;  4LUX A;  3NLO A;  4IMX A;  5G0O A;  5ADC A;  3E6O A;  3RQL A;  5G6F A;  2ORO A;  4D3O A;  5G67 A;  3NM0 A;  1NOD A;  1VAG A;  4CX7 A;  1MMV A;  2G6H A;  3JWT A;  4LWA A;  1ZVL A;  4KCJ A;  4D3B A;  3EBF A;  1D0O A;  3JT5 A;  4D37 A;  8NSE A;  1M9Q A;  1DMJ A;  4FVW A;  4KCO A;  1M8H A;  3JWV A;  4KCI A;  4UGP A;  3PNF A;  3NLI A;  5FVY A;  4K5K A;  5AGK A;  1P6K A;  2G6O A;  4D7H A;  4KCS A;  3B3N A;  4V3Y A;  1M9T A;  4KCM A;  5ADL A;  4UGG A;  1DWV A;  4CWX A;  1Q2O A;  1M7V A;  3SVQ A;  4K5I A;  4NOS A;  4D33 A;  2AMO A;  3N67 A;  3N60 A;  1DWW A;  3N6C A;  1P6I A;  3DQT A;  5ADI A;  4IMT A;  3NLR A;  4UG7 A;  5AD7 A;  3NLU A;  1K2R A;  1FOO A;  4FVX A;  3NNZ A;  1DMK A;  4CAO A;  2ORR A;  4UGZ A;  3JT9 A;  3N6D A;  5G6O A;  4UGU A;  3EAH A;  3E6N A;  1M8I A;  4UPN A;  1LZX A;  2G6K A;  3NLH A;  3N5S A;  4UH6 A;  4CU0 A;  1QW6 A;  4D3U A;  4UGH A;  4D7I A;  6NSE A;  3EBD A;  3UFR A;  3N6G A;  3JX1 A;  1RS7 A;  4V3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...