4UGVA

Structure of y357f bacillus subtilis nitric oxide synthase in complex with arginine and 5,6,7,8-tetrahydrobiopterin
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
362
structure length
362
Chain Sequence
EEKEILWNEAKAFIAACYQELGKAAEVKDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPPEEKGEKQVEIWNHQLIRYAGYESDGERIGDPASCSLTAACEELGWRGERTDFDLLPLIFRMKGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQAEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFFQDKPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NITRIC OXIDE SYNTHASE OXYGENASE
publication title Inhibitor Bound Crystal Structures of Bacterial Nitric Oxide Synthase.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 121
structure length 362
sequence length 362
ec nomenclature ec 1.14.14.47: Nitric-oxide synthase (flavodoxin).
pdb deposition date 2015-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02898 NO_synthase Nitric oxide synthase, oxygenase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.340.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase; Chain A, domain 1 Nitric Oxide Synthase; Chain A, domain 1 4ugvA01
3.90.440.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase;Heme Domain; Chain A, domain 2 Nitric Oxide Synthase;Heme Domain;Chain A domain 2 4ugvA02
3.90.1230.10 Alpha Beta Alpha-Beta Complex Bovine Endothelial Nitric Oxide Synthase Heme Domain; Chain: A,domain 3 Nitric Oxide Synthase; Chain A, domain 3 4ugvA03
5G6HA 3JWTA 5FVQA 3PNHA 1JWKA 1NODA 4UGWA 4GQEA 3E6NA 5FJ3A 4D7HA 4K5IA 4KCJA 1M9KA 4NSEA 2HX3A 2NODA 3JWVA 3SVQA 4D2YA 4D34A 2G6KA 1D1XA 3N5PA 1LZZA 1OM4A 5AD9A 1QW4A 4LWAA 1M9QA 5G6PA 2NOSA 5G6KA 4D3BA 4IMXA 3NOSA 4CAQA 4UGIA 4D1OA 3DQRA 4UH2A 5FVVA 4UGQA 3E68A 3Q9AA 4NOSA 3N65A 5G6MA 3N5SA 1M9RA 4UGVA 1D1VA 5ADKA 5AGMA 4UGLA 3NLTA 3HSNA 1RS8A 1Q2OA 4D3KA 1ZVLA 3EJ8A 4V3XA 4UPMA 4CX0A 4UGOA 3PNGA 4UG5A 5G0NA 2FC1A 3N6EA 1ZZTA 1M9JA 5ADCA 3JWZA 2FLQA 3JWYA 1FOIA 1K2RA 3TYNA 4UQSA 4K5EA 3NW2A 5AGLA 4KCQA 5G6EA 3UFPA 4D7OA 5FVWA 5G66A 5G6NA 3N62A 4UGTA 4UGGA 4JSEA 4D3MA 4CTXA 3E67A 4LUWA 1VAGA 4K5JA 4UGCA 5FVYA 3DWJA 3UFVA 3NLXA 4UGNA 4UPTA 3NLQA 3NLFA 1ED6A 3N5ZA 4KCRA 1K2SA 1P6MA 4FW0A 3NLZA 3NM0A 4UG6A 4JSMA 3Q99A 4UG7A 3UFOA 4D3JA 1NSIA 5FVTA 3TYMA 3N5WA 2Y37A 3DQTA 3UFTA 4EUXA 3RQMA 1NOSA 2ORSA 1DM7A 1ZZQA 1NSEA 2HX2A 3N67A 4C3AA 5ADDA 3RQOA 3NLMA 4LWBA 4UGZA 1M00A 4CULA 5NSEA 4KCNA 5G6GA 3RQJA 2FC2A 4CTVA 4UGXA 5FW0A 1ZVIA 4D3VA 1OM5A 5AD4A 5AGOA 2G6NA 4C39A 3NNYA 4CTTA 2G6JA 4D3AA 3NSEA 4CAPA 3N5VA 3E6TA 4KCIA 5G6AA 5G6CA 5G0OA 7NSEA 4UGEA 1D0OA 2BHJA 4UH5A 2NSIA 5AGKA 3NLOA 5AD7A 4CX7A 5AGNA 5FJ2A 4CX1A 4UPQA 3NLVA 1M9TA 5ADGA 4CAMA 1M8DA 3JT9A 3TYLA 4CARA 4CX6A 2HX4A 3N2RA 4CANA 4CWXA 3N5YA 5ADLA 1FOOA 5G65A 1K2UA 4UGSA 4UPOA 4UH8A 4UH1A 4V3YA 5ADMA 5ADFA 3NLDA 5FVRA 2G6HA 3JT5A 4CX3A 4UH6A 4UH4A 1RS7A 4KCLA 4UCHA 3JT3A 3NLNA 4JSLA 1DMJA 4D30A 4CTUA 4D2ZA 1DMIA 1FOLA 4FVWA 2ORPA 4CX2A 4CTPA 4JSJA 2G6IA 1P6NA 1DM8A 4KCPA 4CX4A 4D39A 4D3UA 2G6MA 3N5TA 3NLPA 5ADJA 3UFWA 4UGUA 3NLJA 3E65A 5G6LA 2NSEA 4CU1A 9NSEA 4D38A 1K2TA 5ADEA 4CU1B 5G68A 1VAFA 3E7GA 4UH0A 5G6OA 3NLKA 3UFQA 1RS6A 4UGMA 3NLWA 3JT6A 2ORQA 1M8EA 3N5RA 3RQKA 1ZZUA 4D7JA 3JWWA 4CWZA 5ADBA 3B3PA 3HSOA 1D1YA 4UGYA 1P6HA 3RQLA 1P6IA 3N64A 3NLUA 4FVZA 3JX1A 3N5XA 3E7SA 1DWVA 3JX5A 4UPRA 2AN2A 5AD8A 2FBZX 5G6JA 3E7SB 3UFSA 4IMTA 1ZZRA 3JX4A 3RQNA 1D1WA 5AD6A 5G6QA 3E7IA 4K5FA 3N66A 3N60A 4UQRA 2OROA 1LZXA 4K5HA 3E6OA 3B3MA 3E6LA 3E7TA 3JT7A 3JWSA 4CFTA 3N61A 4UPPA 4CUNA 2ORTA 4CFTB 3N6FA 4UGHA 4UHAA 1DWWA 1I83A 3TYOA 5G6BA 4CTRA 4UH9A 3NLGA 4FVYA 3N6CA 2G6OA 1DMKA 3JT8A 3B3NA 4D37A 4CVGA 5G69A 1R35A 4CTYA 3UFRA 1RS9A 5AGPA 4D36A 3EAIA 4CU0A 1M9MA 1MMVA 3N69A 5G6IA 1QW6A 4K5DA 4D7IA 5ADIA 4D3IA 4JSGA 4UGAA 4CWWA 4UH3A 1N2NA 4D1NA 4CWYA 3NNZA 4D35A 1M7ZA 3JWUA 4CUMA 3NLIA 4K5GA 4KCSA 4D33A 3FC5A 1NOCA 3N5QA 4D3NA 4CTWA 3N63A 1M8HA 4V3UA 4CX5A 4JSFA 1ED4A 4V3WA 1DM6A 1ZZSA 1P6JA 2AMOA 5FVOA 3N6GA 5FVPA 1ED5A 5G6DA 3NLRA 4JSKA 1FOJA 8NSEA 3NLYA 3UFUA 4D31A 1FOPA 3JWXA 4IMWA 4UGKA 5FVUA 4UGDA 4JSIA 4UGPA 4UG9A 4FVXA 1M7VA 4CWVA 4UPNA 5FVSA 1QOMA 1MJTA 5FVXA 4KCOA 2AN0A 5AD5A 3N6AA 3E7MA 4D32A 4UGFA 3HSPA 4UPSA 5ADNA 1MMWA 5FVZA 1JWJA 1D0CA 3JX0A 4CTQA 4V3ZA 1QW5A 6NSEA 3NODA 3JX3A 3SVPA 1DWXA 4JSHA 4D3TA 4IMSA 5ADAA 1QWCA 2G6LA 1DF1A 1M8IA 1P6LA 4IMUA 4UGBA 4LUXA 4UG8A 1DD7A 4CAOA 3EBFA 4JS9A 3EAHA 3PNFA 4K5KA 3B3OA 3N68A 3EBDA 3NQSA 4KCMA 3JT4A 4D3OA 4UGRA 5G0PA 4CDTA 3JTAA 3JX6A 4D1PA 3JX2A 4UH7A 3N6BA 3NLHA 4KCHA 5G67A 3PNEA 3NLEA 2ORRA 1P6KA 3RQPA 3N6DA 4UGJA 4CTZA 4KCKA 3DQSA 5G6FA 4V3VA
chains in the Genus database with same CATH superfamily
5G6HA 3JWTA 5FVQA 3PNHA 1JWKA 1NODA 4UGWA 4GQEA 3E6NA 5FJ3A 4D7HA 4K5IA 4KCJA 1M9KA 4NSEA 2HX3A 2NODA 3JWVA 3SVQA 4D2YA 4D34A 2G6KA 1D1XA 3N5PA 1LZZA 1OM4A 5AD9A 1QW4A 4LWAA 1M9QA 5G6PA 2NOSA 5G6KA 4D3BA 4IMXA 3NOSA 4CAQA 4UGIA 4D1OA 3DQRA 4UH2A 5FVVA 4UGQA 3E68A 3Q9AA 4NOSA 3N65A 5G6MA 3N5SA 1M9RA 4UGVA 1D1VA 5ADKA 5AGMA 4UGLA 3NLTA 3HSNA 1RS8A 1Q2OA 4D3KA 1ZVLA 3EJ8A 4V3XA 4UPMA 4CX0A 4UGOA 3PNGA 4UG5A 5G0NA 2FC1A 3N6EA 1ZZTA 1M9JA 5ADCA 3JWZA 2FLQA 3JWYA 1FOIA 1K2RA 3TYNA 4UQSA 4K5EA 3NW2A 5AGLA 4KCQA 5G6EA 3UFPA 4D7OA 5FVWA 5G66A 5G6NA 3N62A 4UGTA 4UGGA 4JSEA 4D3MA 4CTXA 3E67A 4LUWA 1VAGA 4K5JA 4UGCA 5FVYA 3DWJA 3UFVA 3NLXA 4UGNA 4UPTA 3NLQA 3NLFA 1ED6A 3N5ZA 4KCRA 1K2SA 1P6MA 4FW0A 3NLZA 3NM0A 4UG6A 4JSMA 3Q99A 4UG7A 3UFOA 4D3JA 1NSIA 5FVTA 3TYMA 3N5WA 2Y37A 3DQTA 3UFTA 4EUXA 3RQMA 1NOSA 2ORSA 1DM7A 1ZZQA 1NSEA 2HX2A 3N67A 4C3AA 5ADDA 3RQOA 3NLMA 4LWBA 4UGZA 1M00A 4CULA 5NSEA 4KCNA 5G6GA 3RQJA 2FC2A 4CTVA 4UGXA 5FW0A 1ZVIA 4D3VA 1OM5A 5AD4A 5AGOA 2G6NA 4C39A 3NNYA 4CTTA 2G6JA 4D3AA 3NSEA 4CAPA 3N5VA 3E6TA 4KCIA 5G6AA 5G6CA 5G0OA 7NSEA 4UGEA 1D0OA 2BHJA 4UH5A 2NSIA 5AGKA 3NLOA 5AD7A 4CX7A 5AGNA 5FJ2A 4CX1A 4UPQA 3NLVA 1M9TA 5ADGA 4CAMA 1M8DA 3JT9A 3TYLA 4CARA 4CX6A 2HX4A 3N2RA 4CANA 4CWXA 3N5YA 5ADLA 1FOOA 5G65A 1K2UA 4UGSA 4UPOA 4UH8A 4UH1A 4V3YA 5ADMA 5ADFA 3NLDA 5FVRA 2G6HA 3JT5A 4CX3A 4UH6A 4UH4A 1RS7A 4KCLA 4UCHA 3JT3A 3NLNA 4JSLA 1DMJA 4D30A 4CTUA 4D2ZA 1DMIA 1FOLA 4FVWA 2ORPA 4CX2A 4CTPA 4JSJA 2G6IA 1P6NA 1DM8A 4KCPA 4CX4A 4D39A 4D3UA 2G6MA 3N5TA 3NLPA 5ADJA 3UFWA 4UGUA 3NLJA 3E65A 5G6LA 2NSEA 4CU1A 9NSEA 4D38A 1K2TA 5ADEA 4CU1B 5G68A 1VAFA 3E7GA 4UH0A 5G6OA 3NLKA 3UFQA 1RS6A 4UGMA 3NLWA 3JT6A 2ORQA 1M8EA 3N5RA 3RQKA 1ZZUA 4D7JA 3JWWA 4CWZA 5ADBA 3B3PA 3HSOA 1D1YA 4UGYA 1P6HA 3RQLA 1P6IA 3N64A 3NLUA 4FVZA 3JX1A 3N5XA 3E7SA 1DWVA 3JX5A 4UPRA 2AN2A 5AD8A 2FBZX 5G6JA 3E7SB 3UFSA 4IMTA 1ZZRA 3JX4A 3RQNA 1D1WA 5AD6A 5G6QA 3E7IA 4K5FA 3N66A 3N60A 4UQRA 2OROA 1LZXA 4K5HA 3E6OA 3B3MA 3E6LA 3E7TA 3JT7A 3JWSA 4CFTA 3N61A 4UPPA 4CUNA 2ORTA 4CFTB 3N6FA 4UGHA 4UHAA 1DWWA 1I83A 3TYOA 5G6BA 4CTRA 4UH9A 3NLGA 4FVYA 3N6CA 2G6OA 1DMKA 3JT8A 3B3NA 4D37A 4CVGA 5G69A 1R35A 4CTYA 3UFRA 1RS9A 5AGPA 4D36A 3EAIA 4CU0A 1M9MA 1MMVA 3N69A 5G6IA 1QW6A 4K5DA 4D7IA 5ADIA 4D3IA 4JSGA 4UGAA 4CWWA 4UH3A 1N2NA 4D1NA 4CWYA 3NNZA 4D35A 1M7ZA 3JWUA 4CUMA 3NLIA 4K5GA 4KCSA 4D33A 3FC5A 1NOCA 3N5QA 4D3NA 4CTWA 3N63A 1M8HA 4V3UA 4CX5A 4JSFA 1ED4A 4V3WA 1DM6A 1ZZSA 1P6JA 2AMOA 5FVOA 3N6GA 5FVPA 1ED5A 5G6DA 3NLRA 4JSKA 1FOJA 8NSEA 3NLYA 3UFUA 4D31A 1FOPA 3JWXA 4IMWA 4UGKA 5FVUA 4UGDA 4JSIA 4UGPA 4UG9A 4FVXA 1M7VA 4CWVA 4UPNA 5FVSA 1QOMA 1MJTA 5FVXA 4KCOA 2AN0A 5AD5A 3N6AA 3E7MA 4D32A 4UGFA 3HSPA 4UPSA 5ADNA 1MMWA 5FVZA 1JWJA 1D0CA 3JX0A 4CTQA 4V3ZA 1QW5A 6NSEA 3NODA 3JX3A 3SVPA 1DWXA 4JSHA 4D3TA 4IMSA 5ADAA 1QWCA 2G6LA 1DF1A 1M8IA 1P6LA 4IMUA 4UGBA 4LUXA 4UG8A 1DD7A 4CAOA 3EBFA 4JS9A 3EAHA 3PNFA 4K5KA 3B3OA 3N68A 3EBDA 3NQSA 4KCMA 3JT4A 4D3OA 4UGRA 5G0PA 4CDTA 3JTAA 3JX6A 4D1PA 3JX2A 4UH7A 3N6BA 3NLHA 4KCHA 5G67A 3PNEA 3NLEA 2ORRA 1P6KA 3RQPA 3N6DA 4UGJA 4CTZA 4KCKA 3DQSA 5G6FA 4V3VA
chains in the Genus database with same CATH topology
5G6HA 3JWTA 5FVQA 3PNHA 1JWKA 1NODA 4UGWA 4GQEA 3E6NA 5FJ3A 4D7HA 4K5IA 4KCJA 1M9KA 4NSEA 2HX3A 2NODA 3JWVA 3SVQA 4D2YA 4D34A 2G6KA 1D1XA 3N5PA 1LZZA 1OM4A 5AD9A 1QW4A 4LWAA 1M9QA 5G6PA 2NOSA 5G6KA 4D3BA 4IMXA 3NOSA 4CAQA 4UGIA 4D1OA 3DQRA 4UH2A 5FVVA 4UGQA 3E68A 3Q9AA 4NOSA 3N65A 5G6MA 3N5SA 1M9RA 4UGVA 1D1VA 5ADKA 5AGMA 4UGLA 3NLTA 3HSNA 1RS8A 1Q2OA 4D3KA 1ZVLA 3EJ8A 4V3XA 4UPMA 4CX0A 4UGOA 3PNGA 4UG5A 5G0NA 2FC1A 3N6EA 1ZZTA 1M9JA 5ADCA 3JWZA 2FLQA 3JWYA 1FOIA 1K2RA 3TYNA 4UQSA 4K5EA 3NW2A 5AGLA 4KCQA 5G6EA 3UFPA 4D7OA 5FVWA 5G66A 5G6NA 3N62A 4UGTA 4UGGA 4JSEA 4D3MA 4CTXA 3E67A 4LUWA 1VAGA 4K5JA 4UGCA 5FVYA 3DWJA 3UFVA 3NLXA 4UGNA 4UPTA 3NLQA 3NLFA 1ED6A 3N5ZA 4KCRA 1K2SA 1P6MA 4FW0A 3NLZA 3NM0A 4UG6A 4JSMA 3Q99A 4UG7A 3UFOA 4D3JA 1NSIA 5FVTA 3TYMA 3N5WA 2Y37A 3DQTA 3UFTA 4EUXA 3RQMA 1NOSA 2ORSA 1DM7A 1ZZQA 1NSEA 2HX2A 3N67A 4C3AA 5ADDA 3RQOA 3NLMA 4LWBA 4UGZA 1M00A 4CULA 5NSEA 4KCNA 5G6GA 3RQJA 2FC2A 4CTVA 4UGXA 5FW0A 1ZVIA 4D3VA 1OM5A 5AD4A 5AGOA 2G6NA 4C39A 3NNYA 4CTTA 2G6JA 4D3AA 3NSEA 4CAPA 3N5VA 3E6TA 4KCIA 5G6AA 5G6CA 5G0OA 7NSEA 4UGEA 1D0OA 2BHJA 4UH5A 2NSIA 5AGKA 3NLOA 5AD7A 4CX7A 5AGNA 5FJ2A 4CX1A 4UPQA 3NLVA 1M9TA 5ADGA 4CAMA 1M8DA 3JT9A 3TYLA 4CARA 4CX6A 2HX4A 3N2RA 4CANA 4CWXA 3N5YA 5ADLA 1FOOA 5G65A 1K2UA 4UGSA 4UPOA 4UH8A 4UH1A 4V3YA 5ADMA 5ADFA 3NLDA 5FVRA 2G6HA 3JT5A 4CX3A 4UH6A 4UH4A 1RS7A 4KCLA 4UCHA 3JT3A 3NLNA 4JSLA 1DMJA 4D30A 4CTUA 4D2ZA 1DMIA 1FOLA 4FVWA 2ORPA 4CX2A 4CTPA 4JSJA 2G6IA 1P6NA 1DM8A 4KCPA 4CX4A 4D39A 4D3UA 2G6MA 3N5TA 3NLPA 5ADJA 3UFWA 4UGUA 3NLJA 3E65A 5G6LA 2NSEA 4CU1A 9NSEA 4D38A 1K2TA 5ADEA 4CU1B 5G68A 1VAFA 3E7GA 4UH0A 5G6OA 3NLKA 3UFQA 1RS6A 4UGMA 3NLWA 3JT6A 2ORQA 1M8EA 3N5RA 3RQKA 1ZZUA 4D7JA 3JWWA 4CWZA 5ADBA 3B3PA 3HSOA 1D1YA 4UGYA 1P6HA 3RQLA 1P6IA 3N64A 3NLUA 4FVZA 3JX1A 3N5XA 3E7SA 1DWVA 3JX5A 4UPRA 2AN2A 5AD8A 2FBZX 5G6JA 3E7SB 3UFSA 4IMTA 1ZZRA 3JX4A 3RQNA 1D1WA 5AD6A 5G6QA 3E7IA 4K5FA 3N66A 3N60A 4UQRA 2OROA 1LZXA 4K5HA 3E6OA 3B3MA 3E6LA 3E7TA 3JT7A 3JWSA 4CFTA 3N61A 4UPPA 4CUNA 2ORTA 4CFTB 3N6FA 4UGHA 4UHAA 1DWWA 1I83A 3TYOA 5G6BA 4CTRA 4UH9A 3NLGA 4FVYA 3N6CA 2G6OA 1DMKA 3JT8A 3B3NA 4D37A 4CVGA 5G69A 1R35A 4CTYA 3UFRA 1RS9A 5AGPA 4D36A 3EAIA 4CU0A 1M9MA 1MMVA 3N69A 5G6IA 1QW6A 4K5DA 4D7IA 5ADIA 4D3IA 4JSGA 4UGAA 4CWWA 4UH3A 1N2NA 4D1NA 4CWYA 3NNZA 4D35A 1M7ZA 3JWUA 4CUMA 3NLIA 4K5GA 4KCSA 4D33A 3FC5A 1NOCA 3N5QA 4D3NA 4CTWA 3N63A 1M8HA 4V3UA 4CX5A 4JSFA 1ED4A 4V3WA 1DM6A 1ZZSA 1P6JA 2AMOA 5FVOA 3N6GA 5FVPA 1ED5A 5G6DA 3NLRA 4JSKA 1FOJA 8NSEA 3NLYA 3UFUA 4D31A 1FOPA 3JWXA 4IMWA 4UGKA 5FVUA 4UGDA 4JSIA 4UGPA 4UG9A 4FVXA 1M7VA 4CWVA 4UPNA 5FVSA 1QOMA 1MJTA 5FVXA 4KCOA 2AN0A 5AD5A 3N6AA 3E7MA 4D32A 4UGFA 3HSPA 4UPSA 5ADNA 1MMWA 5FVZA 1JWJA 1D0CA 3JX0A 4CTQA 4V3ZA 1QW5A 6NSEA 3NODA 3JX3A 3SVPA 1DWXA 4JSHA 4D3TA 4IMSA 5ADAA 1QWCA 2G6LA 1DF1A 1M8IA 1P6LA 4IMUA 4UGBA 4LUXA 4UG8A 1DD7A 4CAOA 3EBFA 4JS9A 3EAHA 3PNFA 4K5KA 3B3OA 3N68A 3EBDA 3NQSA 4KCMA 3JT4A 4D3OA 4UGRA 5G0PA 4CDTA 3JTAA 3JX6A 4D1PA 3JX2A 4UH7A 3N6BA 3NLHA 4KCHA 5G67A 3PNEA 3NLEA 2ORRA 1P6KA 3RQPA 3N6DA 4UGJA 4CTZA 4KCKA 3DQSA 5G6FA 4V3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G6H A;  3JWT A;  5FVQ A;  3PNH A;  1JWK A;  1NOD A;  4UGW A;  4GQE A;  3E6N A;  5FJ3 A;  4D7H A;  4K5I A;  4KCJ A;  1M9K A;  4NSE A;  2HX3 A;  2NOD A;  3JWV A;  3SVQ A;  4D2Y A;  4D34 A;  2G6K A;  1D1X A;  3N5P A;  1LZZ A;  1OM4 A;  5AD9 A;  1QW4 A;  4LWA A;  1M9Q A;  5G6P A;  2NOS A;  5G6K A;  4D3B A;  4IMX A;  3NOS A;  4CAQ A;  4UGI A;  4D1O A;  3DQR A;  4UH2 A;  5FVV A;  4UGQ A;  3E68 A;  3Q9A A;  4NOS A;  3N65 A;  5G6M A;  3N5S A;  1M9R A;  4UGV A;  1D1V A;  5ADK A;  5AGM A;  4UGL A;  3NLT A;  3HSN A;  1RS8 A;  1Q2O A;  4D3K A;  1ZVL A;  3EJ8 A;  4V3X A;  4UPM A;  4CX0 A;  4UGO A;  3PNG A;  4UG5 A;  5G0N A;  2FC1 A;  3N6E A;  1ZZT A;  1M9J A;  5ADC A;  3JWZ A;  2FLQ A;  3JWY A;  1FOI A;  1K2R A;  3TYN A;  4UQS A;  4K5E A;  3NW2 A;  5AGL A;  4KCQ A;  5G6E A;  3UFP A;  4D7O A;  5FVW A;  5G66 A;  5G6N A;  3N62 A;  4UGT A;  4UGG A;  4JSE A;  4D3M A;  4CTX A;  3E67 A;  4LUW A;  1VAG A;  4K5J A;  4UGC A;  5FVY A;  3DWJ A;  3UFV A;  3NLX A;  4UGN A;  4UPT A;  3NLQ A;  3NLF A;  1ED6 A;  3N5Z A;  4KCR A;  1K2S A;  1P6M A;  4FW0 A;  3NLZ A;  3NM0 A;  4UG6 A;  4JSM A;  3Q99 A;  4UG7 A;  3UFO A;  4D3J A;  1NSI A;  5FVT A;  3TYM A;  3N5W A;  2Y37 A;  3DQT A;  3UFT A;  4EUX A;  3RQM A;  1NOS A;  2ORS A;  1DM7 A;  1ZZQ A;  1NSE A;  2HX2 A;  3N67 A;  4C3A A;  5ADD A;  3RQO A;  3NLM A;  4LWB A;  4UGZ A;  1M00 A;  4CUL A;  5NSE A;  4KCN A;  5G6G A;  3RQJ A;  2FC2 A;  4CTV A;  4UGX A;  5FW0 A;  1ZVI A;  4D3V A;  1OM5 A;  5AD4 A;  5AGO A;  2G6N A;  4C39 A;  3NNY A;  4CTT A;  2G6J A;  4D3A A;  3NSE A;  4CAP A;  3N5V A;  3E6T A;  4KCI A;  5G6A A;  5G6C A;  5G0O A;  7NSE A;  4UGE A;  1D0O A;  2BHJ A;  4UH5 A;  2NSI A;  5AGK A;  3NLO A;  5AD7 A;  4CX7 A;  5AGN A;  5FJ2 A;  4CX1 A;  4UPQ A;  3NLV A;  1M9T A;  5ADG A;  4CAM A;  1M8D A;  3JT9 A;  3TYL A;  4CAR A;  4CX6 A;  2HX4 A;  3N2R A;  4CAN A;  4CWX A;  3N5Y A;  5ADL A;  1FOO A;  5G65 A;  1K2U A;  4UGS A;  4UPO A;  4UH8 A;  4UH1 A;  4V3Y A;  5ADM A;  5ADF A;  3NLD A;  5FVR A;  2G6H A;  3JT5 A;  4CX3 A;  4UH6 A;  4UH4 A;  1RS7 A;  4KCL A;  4UCH A;  3JT3 A;  3NLN A;  4JSL A;  1DMJ A;  4D30 A;  4CTU A;  4D2Z A;  1DMI A;  1FOL A;  4FVW A;  2ORP A;  4CX2 A;  4CTP A;  4JSJ A;  2G6I A;  1P6N A;  1DM8 A;  4KCP A;  4CX4 A;  4D39 A;  4D3U A;  2G6M A;  3N5T A;  3NLP A;  5ADJ A;  3UFW A;  4UGU A;  3NLJ A;  3E65 A;  5G6L A;  2NSE A;  4CU1 A;  9NSE A;  4D38 A;  1K2T A;  5ADE A;  4CU1 B;  5G68 A;  1VAF A;  3E7G A;  4UH0 A;  5G6O A;  3NLK A;  3UFQ A;  1RS6 A;  4UGM A;  3NLW A;  3JT6 A;  2ORQ A;  1M8E A;  3N5R A;  3RQK A;  1ZZU A;  4D7J A;  3JWW A;  4CWZ A;  5ADB A;  3B3P A;  3HSO A;  1D1Y A;  4UGY A;  1P6H A;  3RQL A;  1P6I A;  3N64 A;  3NLU A;  4FVZ A;  3JX1 A;  3N5X A;  3E7S A;  1DWV A;  3JX5 A;  4UPR A;  2AN2 A;  5AD8 A;  2FBZ X;  5G6J A;  3E7S B;  3UFS A;  4IMT A;  1ZZR A;  3JX4 A;  3RQN A;  1D1W A;  5AD6 A;  5G6Q A;  3E7I A;  4K5F A;  3N66 A;  3N60 A;  4UQR A;  2ORO A;  1LZX A;  4K5H A;  3E6O A;  3B3M A;  3E6L A;  3E7T A;  3JT7 A;  3JWS A;  4CFT A;  3N61 A;  4UPP A;  4CUN A;  2ORT A;  4CFT B;  3N6F A;  4UGH A;  4UHA A;  1DWW A;  1I83 A;  3TYO A;  5G6B A;  4CTR A;  4UH9 A;  3NLG A;  4FVY A;  3N6C A;  2G6O A;  1DMK A;  3JT8 A;  3B3N A;  4D37 A;  4CVG A;  5G69 A;  1R35 A;  4CTY A;  3UFR A;  1RS9 A;  5AGP A;  4D36 A;  3EAI A;  4CU0 A;  1M9M A;  1MMV A;  3N69 A;  5G6I A;  1QW6 A;  4K5D A;  4D7I A;  5ADI A;  4D3I A;  4JSG A;  4UGA A;  4CWW A;  4UH3 A;  1N2N A;  4D1N A;  4CWY A;  3NNZ A;  4D35 A;  1M7Z A;  3JWU A;  4CUM A;  3NLI A;  4K5G A;  4KCS A;  4D33 A;  3FC5 A;  1NOC A;  3N5Q A;  4D3N A;  4CTW A;  3N63 A;  1M8H A;  4V3U A;  4CX5 A;  4JSF A;  1ED4 A;  4V3W A;  1DM6 A;  1ZZS A;  1P6J A;  2AMO A;  5FVO A;  3N6G A;  5FVP A;  1ED5 A;  5G6D A;  3NLR A;  4JSK A;  1FOJ A;  8NSE A;  3NLY A;  3UFU A;  4D31 A;  1FOP A;  3JWX A;  4IMW A;  4UGK A;  5FVU A;  4UGD A;  4JSI A;  4UGP A;  4UG9 A;  4FVX A;  1M7V A;  4CWV A;  4UPN A;  5FVS A;  1QOM A;  1MJT A;  5FVX A;  4KCO A;  2AN0 A;  5AD5 A;  3N6A A;  3E7M A;  4D32 A;  4UGF A;  3HSP A;  4UPS A;  5ADN A;  1MMW A;  5FVZ A;  1JWJ A;  1D0C A;  3JX0 A;  4CTQ A;  4V3Z A;  1QW5 A;  6NSE A;  3NOD A;  3JX3 A;  3SVP A;  1DWX A;  4JSH A;  4D3T A;  4IMS A;  5ADA A;  1QWC A;  2G6L A;  1DF1 A;  1M8I A;  1P6L A;  4IMU A;  4UGB A;  4LUX A;  4UG8 A;  1DD7 A;  4CAO A;  3EBF A;  4JS9 A;  3EAH A;  3PNF A;  4K5K A;  3B3O A;  3N68 A;  3EBD A;  3NQS A;  4KCM A;  3JT4 A;  4D3O A;  4UGR A;  5G0P A;  4CDT A;  3JTA A;  3JX6 A;  4D1P A;  3JX2 A;  4UH7 A;  3N6B A;  3NLH A;  4KCH A;  5G67 A;  3PNE A;  3NLE A;  2ORR A;  1P6K A;  3RQP A;  3N6D A;  4UGJ A;  4CTZ A;  4KCK A;  3DQS A;  5G6F A;  4V3V A; 
#chains in the Genus database with same CATH topology
 5G6H A;  3JWT A;  5FVQ A;  3PNH A;  1JWK A;  1NOD A;  4UGW A;  4GQE A;  3E6N A;  5FJ3 A;  4D7H A;  4K5I A;  4KCJ A;  1M9K A;  4NSE A;  2HX3 A;  2NOD A;  3JWV A;  3SVQ A;  4D2Y A;  4D34 A;  2G6K A;  1D1X A;  3N5P A;  1LZZ A;  1OM4 A;  5AD9 A;  1QW4 A;  4LWA A;  1M9Q A;  5G6P A;  2NOS A;  5G6K A;  4D3B A;  4IMX A;  3NOS A;  4CAQ A;  4UGI A;  4D1O A;  3DQR A;  4UH2 A;  5FVV A;  4UGQ A;  3E68 A;  3Q9A A;  4NOS A;  3N65 A;  5G6M A;  3N5S A;  1M9R A;  4UGV A;  1D1V A;  5ADK A;  5AGM A;  4UGL A;  3NLT A;  3HSN A;  1RS8 A;  1Q2O A;  4D3K A;  1ZVL A;  3EJ8 A;  4V3X A;  4UPM A;  4CX0 A;  4UGO A;  3PNG A;  4UG5 A;  5G0N A;  2FC1 A;  3N6E A;  1ZZT A;  1M9J A;  5ADC A;  3JWZ A;  2FLQ A;  3JWY A;  1FOI A;  1K2R A;  3TYN A;  4UQS A;  4K5E A;  3NW2 A;  5AGL A;  4KCQ A;  5G6E A;  3UFP A;  4D7O A;  5FVW A;  5G66 A;  5G6N A;  3N62 A;  4UGT A;  4UGG A;  4JSE A;  4D3M A;  4CTX A;  3E67 A;  4LUW A;  1VAG A;  4K5J A;  4UGC A;  5FVY A;  3DWJ A;  3UFV A;  3NLX A;  4UGN A;  4UPT A;  3NLQ A;  3NLF A;  1ED6 A;  3N5Z A;  4KCR A;  1K2S A;  1P6M A;  4FW0 A;  3NLZ A;  3NM0 A;  4UG6 A;  4JSM A;  3Q99 A;  4UG7 A;  3UFO A;  4D3J A;  1NSI A;  5FVT A;  3TYM A;  3N5W A;  2Y37 A;  3DQT A;  3UFT A;  4EUX A;  3RQM A;  1NOS A;  2ORS A;  1DM7 A;  1ZZQ A;  1NSE A;  2HX2 A;  3N67 A;  4C3A A;  5ADD A;  3RQO A;  3NLM A;  4LWB A;  4UGZ A;  1M00 A;  4CUL A;  5NSE A;  4KCN A;  5G6G A;  3RQJ A;  2FC2 A;  4CTV A;  4UGX A;  5FW0 A;  1ZVI A;  4D3V A;  1OM5 A;  5AD4 A;  5AGO A;  2G6N A;  4C39 A;  3NNY A;  4CTT A;  2G6J A;  4D3A A;  3NSE A;  4CAP A;  3N5V A;  3E6T A;  4KCI A;  5G6A A;  5G6C A;  5G0O A;  7NSE A;  4UGE A;  1D0O A;  2BHJ A;  4UH5 A;  2NSI A;  5AGK A;  3NLO A;  5AD7 A;  4CX7 A;  5AGN A;  5FJ2 A;  4CX1 A;  4UPQ A;  3NLV A;  1M9T A;  5ADG A;  4CAM A;  1M8D A;  3JT9 A;  3TYL A;  4CAR A;  4CX6 A;  2HX4 A;  3N2R A;  4CAN A;  4CWX A;  3N5Y A;  5ADL A;  1FOO A;  5G65 A;  1K2U A;  4UGS A;  4UPO A;  4UH8 A;  4UH1 A;  4V3Y A;  5ADM A;  5ADF A;  3NLD A;  5FVR A;  2G6H A;  3JT5 A;  4CX3 A;  4UH6 A;  4UH4 A;  1RS7 A;  4KCL A;  4UCH A;  3JT3 A;  3NLN A;  4JSL A;  1DMJ A;  4D30 A;  4CTU A;  4D2Z A;  1DMI A;  1FOL A;  4FVW A;  2ORP A;  4CX2 A;  4CTP A;  4JSJ A;  2G6I A;  1P6N A;  1DM8 A;  4KCP A;  4CX4 A;  4D39 A;  4D3U A;  2G6M A;  3N5T A;  3NLP A;  5ADJ A;  3UFW A;  4UGU A;  3NLJ A;  3E65 A;  5G6L A;  2NSE A;  4CU1 A;  9NSE A;  4D38 A;  1K2T A;  5ADE A;  4CU1 B;  5G68 A;  1VAF A;  3E7G A;  4UH0 A;  5G6O A;  3NLK A;  3UFQ A;  1RS6 A;  4UGM A;  3NLW A;  3JT6 A;  2ORQ A;  1M8E A;  3N5R A;  3RQK A;  1ZZU A;  4D7J A;  3JWW A;  4CWZ A;  5ADB A;  3B3P A;  3HSO A;  1D1Y A;  4UGY A;  1P6H A;  3RQL A;  1P6I A;  3N64 A;  3NLU A;  4FVZ A;  3JX1 A;  3N5X A;  3E7S A;  1DWV A;  3JX5 A;  4UPR A;  2AN2 A;  5AD8 A;  2FBZ X;  5G6J A;  3E7S B;  3UFS A;  4IMT A;  1ZZR A;  3JX4 A;  3RQN A;  1D1W A;  5AD6 A;  5G6Q A;  3E7I A;  4K5F A;  3N66 A;  3N60 A;  4UQR A;  2ORO A;  1LZX A;  4K5H A;  3E6O A;  3B3M A;  3E6L A;  3E7T A;  3JT7 A;  3JWS A;  4CFT A;  3N61 A;  4UPP A;  4CUN A;  2ORT A;  4CFT B;  3N6F A;  4UGH A;  4UHA A;  1DWW A;  1I83 A;  3TYO A;  5G6B A;  4CTR A;  4UH9 A;  3NLG A;  4FVY A;  3N6C A;  2G6O A;  1DMK A;  3JT8 A;  3B3N A;  4D37 A;  4CVG A;  5G69 A;  1R35 A;  4CTY A;  3UFR A;  1RS9 A;  5AGP A;  4D36 A;  3EAI A;  4CU0 A;  1M9M A;  1MMV A;  3N69 A;  5G6I A;  1QW6 A;  4K5D A;  4D7I A;  5ADI A;  4D3I A;  4JSG A;  4UGA A;  4CWW A;  4UH3 A;  1N2N A;  4D1N A;  4CWY A;  3NNZ A;  4D35 A;  1M7Z A;  3JWU A;  4CUM A;  3NLI A;  4K5G A;  4KCS A;  4D33 A;  3FC5 A;  1NOC A;  3N5Q A;  4D3N A;  4CTW A;  3N63 A;  1M8H A;  4V3U A;  4CX5 A;  4JSF A;  1ED4 A;  4V3W A;  1DM6 A;  1ZZS A;  1P6J A;  2AMO A;  5FVO A;  3N6G A;  5FVP A;  1ED5 A;  5G6D A;  3NLR A;  4JSK A;  1FOJ A;  8NSE A;  3NLY A;  3UFU A;  4D31 A;  1FOP A;  3JWX A;  4IMW A;  4UGK A;  5FVU A;  4UGD A;  4JSI A;  4UGP A;  4UG9 A;  4FVX A;  1M7V A;  4CWV A;  4UPN A;  5FVS A;  1QOM A;  1MJT A;  5FVX A;  4KCO A;  2AN0 A;  5AD5 A;  3N6A A;  3E7M A;  4D32 A;  4UGF A;  3HSP A;  4UPS A;  5ADN A;  1MMW A;  5FVZ A;  1JWJ A;  1D0C A;  3JX0 A;  4CTQ A;  4V3Z A;  1QW5 A;  6NSE A;  3NOD A;  3JX3 A;  3SVP A;  1DWX A;  4JSH A;  4D3T A;  4IMS A;  5ADA A;  1QWC A;  2G6L A;  1DF1 A;  1M8I A;  1P6L A;  4IMU A;  4UGB A;  4LUX A;  4UG8 A;  1DD7 A;  4CAO A;  3EBF A;  4JS9 A;  3EAH A;  3PNF A;  4K5K A;  3B3O A;  3N68 A;  3EBD A;  3NQS A;  4KCM A;  3JT4 A;  4D3O A;  4UGR A;  5G0P A;  4CDT A;  3JTA A;  3JX6 A;  4D1P A;  3JX2 A;  4UH7 A;  3N6B A;  3NLH A;  4KCH A;  5G67 A;  3PNE A;  3NLE A;  2ORR A;  1P6K A;  3RQP A;  3N6D A;  4UGJ A;  4CTZ A;  4KCK A;  3DQS A;  5G6F A;  4V3V A; 
#chains in the Genus database with same CATH homology
 5G6H A;  3JWT A;  5FVQ A;  3PNH A;  1JWK A;  1NOD A;  4UGW A;  4GQE A;  3E6N A;  5FJ3 A;  4D7H A;  4K5I A;  4KCJ A;  1M9K A;  4NSE A;  2HX3 A;  2NOD A;  3JWV A;  3SVQ A;  4D2Y A;  4D34 A;  2G6K A;  1D1X A;  3N5P A;  1LZZ A;  1OM4 A;  5AD9 A;  1QW4 A;  4LWA A;  1M9Q A;  5G6P A;  2NOS A;  5G6K A;  4D3B A;  4IMX A;  3NOS A;  4CAQ A;  4UGI A;  4D1O A;  3DQR A;  4UH2 A;  5FVV A;  4UGQ A;  3E68 A;  3Q9A A;  4NOS A;  3N65 A;  5G6M A;  3N5S A;  1M9R A;  4UGV A;  1D1V A;  5ADK A;  5AGM A;  4UGL A;  3NLT A;  3HSN A;  1RS8 A;  1Q2O A;  4D3K A;  1ZVL A;  3EJ8 A;  4V3X A;  4UPM A;  4CX0 A;  4UGO A;  3PNG A;  4UG5 A;  5G0N A;  2FC1 A;  3N6E A;  1ZZT A;  1M9J A;  5ADC A;  3JWZ A;  2FLQ A;  3JWY A;  1FOI A;  1K2R A;  3TYN A;  4UQS A;  4K5E A;  3NW2 A;  5AGL A;  4KCQ A;  5G6E A;  3UFP A;  4D7O A;  5FVW A;  5G66 A;  5G6N A;  3N62 A;  4UGT A;  4UGG A;  4JSE A;  4D3M A;  4CTX A;  3E67 A;  4LUW A;  1VAG A;  4K5J A;  4UGC A;  5FVY A;  3DWJ A;  3UFV A;  3NLX A;  4UGN A;  4UPT A;  3NLQ A;  3NLF A;  1ED6 A;  3N5Z A;  4KCR A;  1K2S A;  1P6M A;  4FW0 A;  3NLZ A;  3NM0 A;  4UG6 A;  4JSM A;  3Q99 A;  4UG7 A;  3UFO A;  4D3J A;  1NSI A;  5FVT A;  3TYM A;  3N5W A;  2Y37 A;  3DQT A;  3UFT A;  4EUX A;  3RQM A;  1NOS A;  2ORS A;  1DM7 A;  1ZZQ A;  1NSE A;  2HX2 A;  3N67 A;  4C3A A;  5ADD A;  3RQO A;  3NLM A;  4LWB A;  4UGZ A;  1M00 A;  4CUL A;  5NSE A;  4KCN A;  5G6G A;  3RQJ A;  2FC2 A;  4CTV A;  4UGX A;  5FW0 A;  1ZVI A;  4D3V A;  1OM5 A;  5AD4 A;  5AGO A;  2G6N A;  4C39 A;  3NNY A;  4CTT A;  2G6J A;  4D3A A;  3NSE A;  4CAP A;  3N5V A;  3E6T A;  4KCI A;  5G6A A;  5G6C A;  5G0O A;  7NSE A;  4UGE A;  1D0O A;  2BHJ A;  4UH5 A;  2NSI A;  5AGK A;  3NLO A;  5AD7 A;  4CX7 A;  5AGN A;  5FJ2 A;  4CX1 A;  4UPQ A;  3NLV A;  1M9T A;  5ADG A;  4CAM A;  1M8D A;  3JT9 A;  3TYL A;  4CAR A;  4CX6 A;  2HX4 A;  3N2R A;  4CAN A;  4CWX A;  3N5Y A;  5ADL A;  1FOO A;  5G65 A;  1K2U A;  4UGS A;  4UPO A;  4UH8 A;  4UH1 A;  4V3Y A;  5ADM A;  5ADF A;  3NLD A;  5FVR A;  2G6H A;  3JT5 A;  4CX3 A;  4UH6 A;  4UH4 A;  1RS7 A;  4KCL A;  4UCH A;  3JT3 A;  3NLN A;  4JSL A;  1DMJ A;  4D30 A;  4CTU A;  4D2Z A;  1DMI A;  1FOL A;  4FVW A;  2ORP A;  4CX2 A;  4CTP A;  4JSJ A;  2G6I A;  1P6N A;  1DM8 A;  4KCP A;  4CX4 A;  4D39 A;  4D3U A;  2G6M A;  3N5T A;  3NLP A;  5ADJ A;  3UFW A;  4UGU A;  3NLJ A;  3E65 A;  5G6L A;  2NSE A;  4CU1 A;  9NSE A;  4D38 A;  1K2T A;  5ADE A;  4CU1 B;  5G68 A;  1VAF A;  3E7G A;  4UH0 A;  5G6O A;  3NLK A;  3UFQ A;  1RS6 A;  4UGM A;  3NLW A;  3JT6 A;  2ORQ A;  1M8E A;  3N5R A;  3RQK A;  1ZZU A;  4D7J A;  3JWW A;  4CWZ A;  5ADB A;  3B3P A;  3HSO A;  1D1Y A;  4UGY A;  1P6H A;  3RQL A;  1P6I A;  3N64 A;  3NLU A;  4FVZ A;  3JX1 A;  3N5X A;  3E7S A;  1DWV A;  3JX5 A;  4UPR A;  2AN2 A;  5AD8 A;  2FBZ X;  5G6J A;  3E7S B;  3UFS A;  4IMT A;  1ZZR A;  3JX4 A;  3RQN A;  1D1W A;  5AD6 A;  5G6Q A;  3E7I A;  4K5F A;  3N66 A;  3N60 A;  4UQR A;  2ORO A;  1LZX A;  4K5H A;  3E6O A;  3B3M A;  3E6L A;  3E7T A;  3JT7 A;  3JWS A;  4CFT A;  3N61 A;  4UPP A;  4CUN A;  2ORT A;  4CFT B;  3N6F A;  4UGH A;  4UHA A;  1DWW A;  1I83 A;  3TYO A;  5G6B A;  4CTR A;  4UH9 A;  3NLG A;  4FVY A;  3N6C A;  2G6O A;  1DMK A;  3JT8 A;  3B3N A;  4D37 A;  4CVG A;  5G69 A;  1R35 A;  4CTY A;  3UFR A;  1RS9 A;  5AGP A;  4D36 A;  3EAI A;  4CU0 A;  1M9M A;  1MMV A;  3N69 A;  5G6I A;  1QW6 A;  4K5D A;  4D7I A;  5ADI A;  4D3I A;  4JSG A;  4UGA A;  4CWW A;  4UH3 A;  1N2N A;  4D1N A;  4CWY A;  3NNZ A;  4D35 A;  1M7Z A;  3JWU A;  4CUM A;  3NLI A;  4K5G A;  4KCS A;  4D33 A;  3FC5 A;  1NOC A;  3N5Q A;  4D3N A;  4CTW A;  3N63 A;  1M8H A;  4V3U A;  4CX5 A;  4JSF A;  1ED4 A;  4V3W A;  1DM6 A;  1ZZS A;  1P6J A;  2AMO A;  5FVO A;  3N6G A;  5FVP A;  1ED5 A;  5G6D A;  3NLR A;  4JSK A;  1FOJ A;  8NSE A;  3NLY A;  3UFU A;  4D31 A;  1FOP A;  3JWX A;  4IMW A;  4UGK A;  5FVU A;  4UGD A;  4JSI A;  4UGP A;  4UG9 A;  4FVX A;  1M7V A;  4CWV A;  4UPN A;  5FVS A;  1QOM A;  1MJT A;  5FVX A;  4KCO A;  2AN0 A;  5AD5 A;  3N6A A;  3E7M A;  4D32 A;  4UGF A;  3HSP A;  4UPS A;  5ADN A;  1MMW A;  5FVZ A;  1JWJ A;  1D0C A;  3JX0 A;  4CTQ A;  4V3Z A;  1QW5 A;  6NSE A;  3NOD A;  3JX3 A;  3SVP A;  1DWX A;  4JSH A;  4D3T A;  4IMS A;  5ADA A;  1QWC A;  2G6L A;  1DF1 A;  1M8I A;  1P6L A;  4IMU A;  4UGB A;  4LUX A;  4UG8 A;  1DD7 A;  4CAO A;  3EBF A;  4JS9 A;  3EAH A;  3PNF A;  4K5K A;  3B3O A;  3N68 A;  3EBD A;  3NQS A;  4KCM A;  3JT4 A;  4D3O A;  4UGR A;  5G0P A;  4CDT A;  3JTA A;  3JX6 A;  4D1P A;  3JX2 A;  4UH7 A;  3N6B A;  3NLH A;  4KCH A;  5G67 A;  3PNE A;  3NLE A;  2ORR A;  1P6K A;  3RQP A;  3N6D A;  4UGJ A;  4CTZ A;  4KCK A;  3DQS A;  5G6F A;  4V3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...