4UGXA

Structure of bacillus subtilis nitric oxide synthase in complex with n-(3-((ethyl(2-(3-fluorophenyl)ethyl)amino)methyl)phenyl)thiophene-2- carboximidamide
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
362
structure length
362
Chain Sequence
EEKEILWNEAKAFIAACYQELGKAAEVKDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPPEEKGEKQVEIWNHQLIRYAGYESDGERIGDPASCSLTAACEELGWRGERTDFDLLPLIFRMKGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQAEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDKPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NITRIC OXIDE SYNTHASE OXYGENASE
publication title Inhibitor Bound Crystal Structures of Bacterial Nitric Oxide Synthase.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 126
structure length 362
sequence length 362
ec nomenclature ec 1.14.14.47: Nitric-oxide synthase (flavodoxin).
pdb deposition date 2015-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02898 NO_synthase Nitric oxide synthase, oxygenase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.340.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase; Chain A, domain 1 Nitric Oxide Synthase; Chain A, domain 1 4ugxA01
3.90.440.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase;Heme Domain; Chain A, domain 2 Nitric Oxide Synthase;Heme Domain;Chain A domain 2 4ugxA02
3.90.1230.10 Alpha Beta Alpha-Beta Complex Bovine Endothelial Nitric Oxide Synthase Heme Domain; Chain: A,domain 3 Nitric Oxide Synthase; Chain A, domain 3 4ugxA03
3NLNA 4C3AA 3TYNA 4D1NA 3RQNA 5ADJA 5G6QA 3B3NA 1D1WA 2HX3A 3UFOA 5ADDA 5AGKA 1FOOA 4CWVA 3DWJA 3RQOA 3B3OA 4CX5A 1M9KA 3NLKA 1M9RA 5ADEA 1MJTA 2AN0A 4UPPA 4CAOA 1P6MA 4D7JA 4D1PA 1OM4A 4V3VA 1D0CA 3NLJA 4UH4A 3RQMA 4D35A 4CU1B 1DM7A 2FLQA 5FVPA 3UFUA 4UGGA 4UGQA 3N6BA 4JSEA 1QW4A 1M9JA 3SVPA 5AD5A 3JT9A 3JT7A 2ORTA 3N6EA 4UGPA 3NLTA 3HSOA 4CX4A 3JX6A 3E6NA 5FVWA 4D36A 3NNZA 4D3MA 1P6HA 4D37A 4UGNA 1ZZSA 4UH7A 3NLWA 1QOMA 1DMJA 3N5TA 2G6MA 3NLQA 4UG9A 4D7HA 3E6LA 5ADCA 4UQRA 3JWSA 3UFRA 1OM5A 4CTQA 1M9QA 3JWUA 5G0PA 5G6BA 4D39A 5AGPA 5G6PA 4CTWA 1D1VA 5AGLA 2BHJA 4CFTA 1ZZRA 3DQTA 5G0NA 1DMIA 3RQPA 4D3NA 1QWCA 4CWYA 4D2ZA 3N6CA 4D3JA 2G6JA 5G6EA 4CX3A 4CX2A 5AGNA 5ADMA 4KCNA 4UH6A 3N68A 4D3OA 3RQKA 1DF1A 5G6MA 3N62A 4FVWA 3E68A 3JWXA 3N2RA 4CTZA 4KCLA 3DQSA 3DQRA 1K2SA 4KCMA 4KCJA 5ADAA 4UGHA 3NLZA 1DD7A 3NQSA 4UGEA 4UG5A 1M8IA 3JX4A 3N5WA 1FOIA 2AMOA 4UH5A 3N5QA 2G6KA 4D32A 3E7MA 5ADBA 4CVGA 3N64A 3Q99A 4K5IA 1ZVIA 4V3UA 3NLXA 1LZXA 4GQEA 1M7VA 2HX2A 2ORPA 2FBZX 9NSEA 1Q2OA 3PNGA 4UPOA 3TYLA 4UGRA 4UGZA 4K5KA 4UGJA 1FOPA 3E7SB 3N6GA 1P6KA 1M00A 4KCQA 1QW6A 5AD6A 2G6HA 5ADFA 1ZZTA 3JX5A 1RS9A 4CWXA 1DM6A 4K5JA 4JSHA 4LWBA 4CU1A 1ED5A 3N65A 3JX3A 5G69A 2ORSA 4D33A 1NOCA 4V3ZA 4CTVA 1P6NA 3N5XA 1P6JA 1M8HA 5ADIA 3N69A 1RS6A 2G6NA 1P6LA 1M8DA 4UGTA 3JT4A 1LZZA 3TYMA 3E6TA 1ZZQA 1DWWA 4KCSA 4UPNA 1ZZUA 4K5HA 4CUMA 1ZVLA 4UG7A 4JSFA 5ADGA 4IMTA 5FVSA 5FVOA 4D3UA 3UFQA 3JTAA 5FVQA 1VAFA 3JX2A 4UH2A 3JWYA 4UGSA 4D34A 3JT5A 4UGYA 3NNYA 4CAMA 3Q9AA 2G6OA 1P6IA 4CAQA 1MMWA 4D3TA 1NODA 3PNHA 4CULA 3NLMA 3JX0A 1QW5A 4JSMA 5FVUA 4UPTA 3EAIA 5AGMA 1VAGA 3JWTA 5FW0A 5AD9A 4K5DA 6NSEA 3NLPA 1D1XA 5G6CA 1ED6A 4V3WA 3N67A 3N6DA 4UGUA 5FVTA 5FVVA 2NODA 4UGVA 3PNEA 4CDTA 4KCIA 5FVZA 4KCPA 3RQLA 4UG8A 3UFWA 5G65A 4FVXA 4FVYA 3N61A 1DWXA 3NLIA 4D3KA 3SVQA 3NM0A 4FW0A 2FC2A 4D7IA 5G6GA 1JWKA 5AD4A 1M9TA 3NLUA 1NOSA 3JT8A 3N5YA 4IMSA 3N6FA 5AGOA 5FJ3A 3E7SA 4C39A 3JWVA 4D7OA 5G0OA 5AD7A 3RQJA 4UGBA 4JSIA 4CTTA 5G6LA 1DMKA 8NSEA 4UH1A 1M8EA 2NSIA 4FVZA 4CX7A 1D1YA 4V3XA 1M9MA 3JT3A 3NOSA 4KCKA 3JWZA 5G68A 3NLHA 4JSGA 4D3AA 7NSEA 4K5GA 1DWVA 4UGCA 1JWJA 4UGMA 3N6AA 3E65A 5G6FA 4UGXA 4CX0A 3UFTA 3JX1A 4CWWA 4D3VA 4UH8A 5G66A 1FOJA 4CTPA 1D0OA 4UGAA 4CTXA 2ORQA 4UHAA 2NOSA 5G6JA 3NLYA 4UPSA 4IMXA 4UH9A 2NSEA 4UQSA 1FOLA 3TYOA 5FVXA 1K2TA 4CX6A 2G6IA 3NLVA 3NSEA 5G6HA 4CTUA 1NSIA 3NLEA 3JWWA 4UGDA 3NLGA 4LUXA 2G6LA 4UGIA 4IMWA 1DM8A 4CWZA 3EBFA 4EUXA 5NSEA 4CX1A 3N5ZA 4UPRA 3E7IA 3E7TA 4D1OA 1K2RA 3N5SA 5G6OA 2ORRA 5G6NA 3HSPA 1MMVA 4UGFA 3NLFA 1RS8A 3E7GA 2FC1A 3NLRA 1ED4A 4UGOA 3N63A 1N2NA 3N66A 4UPQA 4D31A 4UGKA 3UFSA 5G6DA 4UG6A 1K2UA 4LUWA 5G67A 3FC5A 4K5EA 3B3MA 3EAHA 3NLOA 3JT6A 5AD8A 4D2YA 2Y37A 5G6AA 4CFTB 1I83A 3N5PA 5ADLA 5G6KA 4KCOA 4CU0A 5ADKA 3UFVA 3UFPA 3NW2A 4UH0A 4D30A 3N5RA 3NLDA 4IMUA 4UGWA 4JSKA 4CTYA 2OROA 4CARA 4D3IA 4KCRA 1M7ZA 1RS7A 3HSNA 4V3YA 4K5FA 2HX4A 4UH3A 4D38A 4KCHA 5ADNA 5FVYA 4CAPA 3EBDA 1NSEA 1R35A 4NOSA 4NSEA 4JS9A 4CANA 3N5VA 4UCHA 4UGLA 4CTRA 3E6OA 5FJ2A 5G6IA 3EJ8A 4D3BA 4JSLA 4LWAA 4JSJA 3PNFA 3N60A 3E67A 3B3PA 2AN2A 5FVRA 3NODA 4CUNA 4UPMA
chains in the Genus database with same CATH superfamily
3NLNA 4C3AA 3TYNA 4D1NA 3RQNA 5ADJA 5G6QA 3B3NA 1D1WA 2HX3A 3UFOA 5ADDA 5AGKA 1FOOA 4CWVA 3DWJA 3RQOA 3B3OA 4CX5A 1M9KA 3NLKA 1M9RA 5ADEA 1MJTA 2AN0A 4UPPA 4CAOA 1P6MA 4D7JA 4D1PA 1OM4A 4V3VA 1D0CA 3NLJA 4UH4A 3RQMA 4D35A 4CU1B 1DM7A 2FLQA 5FVPA 3UFUA 4UGGA 4UGQA 3N6BA 4JSEA 1QW4A 1M9JA 3SVPA 5AD5A 3JT9A 3JT7A 2ORTA 3N6EA 4UGPA 3NLTA 3HSOA 4CX4A 3JX6A 3E6NA 5FVWA 4D36A 3NNZA 4D3MA 1P6HA 4D37A 4UGNA 1ZZSA 4UH7A 3NLWA 1QOMA 1DMJA 3N5TA 2G6MA 3NLQA 4UG9A 4D7HA 3E6LA 5ADCA 4UQRA 3JWSA 3UFRA 1OM5A 4CTQA 1M9QA 3JWUA 5G0PA 5G6BA 4D39A 5AGPA 5G6PA 4CTWA 1D1VA 5AGLA 2BHJA 4CFTA 1ZZRA 3DQTA 5G0NA 1DMIA 3RQPA 4D3NA 1QWCA 4CWYA 4D2ZA 3N6CA 4D3JA 2G6JA 5G6EA 4CX3A 4CX2A 5AGNA 5ADMA 4KCNA 4UH6A 3N68A 4D3OA 3RQKA 1DF1A 5G6MA 3N62A 4FVWA 3E68A 3JWXA 3N2RA 4CTZA 4KCLA 3DQSA 3DQRA 1K2SA 4KCMA 4KCJA 5ADAA 4UGHA 3NLZA 1DD7A 3NQSA 4UGEA 4UG5A 1M8IA 3JX4A 3N5WA 1FOIA 2AMOA 4UH5A 3N5QA 2G6KA 4D32A 3E7MA 5ADBA 4CVGA 3N64A 3Q99A 4K5IA 1ZVIA 4V3UA 3NLXA 1LZXA 4GQEA 1M7VA 2HX2A 2ORPA 2FBZX 9NSEA 1Q2OA 3PNGA 4UPOA 3TYLA 4UGRA 4UGZA 4K5KA 4UGJA 1FOPA 3E7SB 3N6GA 1P6KA 1M00A 4KCQA 1QW6A 5AD6A 2G6HA 5ADFA 1ZZTA 3JX5A 1RS9A 4CWXA 1DM6A 4K5JA 4JSHA 4LWBA 4CU1A 1ED5A 3N65A 3JX3A 5G69A 2ORSA 4D33A 1NOCA 4V3ZA 4CTVA 1P6NA 3N5XA 1P6JA 1M8HA 5ADIA 3N69A 1RS6A 2G6NA 1P6LA 1M8DA 4UGTA 3JT4A 1LZZA 3TYMA 3E6TA 1ZZQA 1DWWA 4KCSA 4UPNA 1ZZUA 4K5HA 4CUMA 1ZVLA 4UG7A 4JSFA 5ADGA 4IMTA 5FVSA 5FVOA 4D3UA 3UFQA 3JTAA 5FVQA 1VAFA 3JX2A 4UH2A 3JWYA 4UGSA 4D34A 3JT5A 4UGYA 3NNYA 4CAMA 3Q9AA 2G6OA 1P6IA 4CAQA 1MMWA 4D3TA 1NODA 3PNHA 4CULA 3NLMA 3JX0A 1QW5A 4JSMA 5FVUA 4UPTA 3EAIA 5AGMA 1VAGA 3JWTA 5FW0A 5AD9A 4K5DA 6NSEA 3NLPA 1D1XA 5G6CA 1ED6A 4V3WA 3N67A 3N6DA 4UGUA 5FVTA 5FVVA 2NODA 4UGVA 3PNEA 4CDTA 4KCIA 5FVZA 4KCPA 3RQLA 4UG8A 3UFWA 5G65A 4FVXA 4FVYA 3N61A 1DWXA 3NLIA 4D3KA 3SVQA 3NM0A 4FW0A 2FC2A 4D7IA 5G6GA 1JWKA 5AD4A 1M9TA 3NLUA 1NOSA 3JT8A 3N5YA 4IMSA 3N6FA 5AGOA 5FJ3A 3E7SA 4C39A 3JWVA 4D7OA 5G0OA 5AD7A 3RQJA 4UGBA 4JSIA 4CTTA 5G6LA 1DMKA 8NSEA 4UH1A 1M8EA 2NSIA 4FVZA 4CX7A 1D1YA 4V3XA 1M9MA 3JT3A 3NOSA 4KCKA 3JWZA 5G68A 3NLHA 4JSGA 4D3AA 7NSEA 4K5GA 1DWVA 4UGCA 1JWJA 4UGMA 3N6AA 3E65A 5G6FA 4UGXA 4CX0A 3UFTA 3JX1A 4CWWA 4D3VA 4UH8A 5G66A 1FOJA 4CTPA 1D0OA 4UGAA 4CTXA 2ORQA 4UHAA 2NOSA 5G6JA 3NLYA 4UPSA 4IMXA 4UH9A 2NSEA 4UQSA 1FOLA 3TYOA 5FVXA 1K2TA 4CX6A 2G6IA 3NLVA 3NSEA 5G6HA 4CTUA 1NSIA 3NLEA 3JWWA 4UGDA 3NLGA 4LUXA 2G6LA 4UGIA 4IMWA 1DM8A 4CWZA 3EBFA 4EUXA 5NSEA 4CX1A 3N5ZA 4UPRA 3E7IA 3E7TA 4D1OA 1K2RA 3N5SA 5G6OA 2ORRA 5G6NA 3HSPA 1MMVA 4UGFA 3NLFA 1RS8A 3E7GA 2FC1A 3NLRA 1ED4A 4UGOA 3N63A 1N2NA 3N66A 4UPQA 4D31A 4UGKA 3UFSA 5G6DA 4UG6A 1K2UA 4LUWA 5G67A 3FC5A 4K5EA 3B3MA 3EAHA 3NLOA 3JT6A 5AD8A 4D2YA 2Y37A 5G6AA 4CFTB 1I83A 3N5PA 5ADLA 5G6KA 4KCOA 4CU0A 5ADKA 3UFVA 3UFPA 3NW2A 4UH0A 4D30A 3N5RA 3NLDA 4IMUA 4UGWA 4JSKA 4CTYA 2OROA 4CARA 4D3IA 4KCRA 1M7ZA 1RS7A 3HSNA 4V3YA 4K5FA 2HX4A 4UH3A 4D38A 4KCHA 5ADNA 5FVYA 4CAPA 3EBDA 1NSEA 1R35A 4NOSA 4NSEA 4JS9A 4CANA 3N5VA 4UCHA 4UGLA 4CTRA 3E6OA 5FJ2A 5G6IA 3EJ8A 4D3BA 4JSLA 4LWAA 4JSJA 3PNFA 3N60A 3E67A 3B3PA 2AN2A 5FVRA 3NODA 4CUNA 4UPMA
chains in the Genus database with same CATH topology
3NLNA 4C3AA 3TYNA 4D1NA 3RQNA 5ADJA 5G6QA 3B3NA 1D1WA 2HX3A 3UFOA 5ADDA 5AGKA 1FOOA 4CWVA 3DWJA 3RQOA 3B3OA 4CX5A 1M9KA 3NLKA 1M9RA 5ADEA 1MJTA 2AN0A 4UPPA 4CAOA 1P6MA 4D7JA 4D1PA 1OM4A 4V3VA 1D0CA 3NLJA 4UH4A 3RQMA 4D35A 4CU1B 1DM7A 2FLQA 5FVPA 3UFUA 4UGGA 4UGQA 3N6BA 4JSEA 1QW4A 1M9JA 3SVPA 5AD5A 3JT9A 3JT7A 2ORTA 3N6EA 4UGPA 3NLTA 3HSOA 4CX4A 3JX6A 3E6NA 5FVWA 4D36A 3NNZA 4D3MA 1P6HA 4D37A 4UGNA 1ZZSA 4UH7A 3NLWA 1QOMA 1DMJA 3N5TA 2G6MA 3NLQA 4UG9A 4D7HA 3E6LA 5ADCA 4UQRA 3JWSA 3UFRA 1OM5A 4CTQA 1M9QA 3JWUA 5G0PA 5G6BA 4D39A 5AGPA 5G6PA 4CTWA 1D1VA 5AGLA 2BHJA 4CFTA 1ZZRA 3DQTA 5G0NA 1DMIA 3RQPA 4D3NA 1QWCA 4CWYA 4D2ZA 3N6CA 4D3JA 2G6JA 5G6EA 4CX3A 4CX2A 5AGNA 5ADMA 4KCNA 4UH6A 3N68A 4D3OA 3RQKA 1DF1A 5G6MA 3N62A 4FVWA 3E68A 3JWXA 3N2RA 4CTZA 4KCLA 3DQSA 3DQRA 1K2SA 4KCMA 4KCJA 5ADAA 4UGHA 3NLZA 1DD7A 3NQSA 4UGEA 4UG5A 1M8IA 3JX4A 3N5WA 1FOIA 2AMOA 4UH5A 3N5QA 2G6KA 4D32A 3E7MA 5ADBA 4CVGA 3N64A 3Q99A 4K5IA 1ZVIA 4V3UA 3NLXA 1LZXA 4GQEA 1M7VA 2HX2A 2ORPA 2FBZX 9NSEA 1Q2OA 3PNGA 4UPOA 3TYLA 4UGRA 4UGZA 4K5KA 4UGJA 1FOPA 3E7SB 3N6GA 1P6KA 1M00A 4KCQA 1QW6A 5AD6A 2G6HA 5ADFA 1ZZTA 3JX5A 1RS9A 4CWXA 1DM6A 4K5JA 4JSHA 4LWBA 4CU1A 1ED5A 3N65A 3JX3A 5G69A 2ORSA 4D33A 1NOCA 4V3ZA 4CTVA 1P6NA 3N5XA 1P6JA 1M8HA 5ADIA 3N69A 1RS6A 2G6NA 1P6LA 1M8DA 4UGTA 3JT4A 1LZZA 3TYMA 3E6TA 1ZZQA 1DWWA 4KCSA 4UPNA 1ZZUA 4K5HA 4CUMA 1ZVLA 4UG7A 4JSFA 5ADGA 4IMTA 5FVSA 5FVOA 4D3UA 3UFQA 3JTAA 5FVQA 1VAFA 3JX2A 4UH2A 3JWYA 4UGSA 4D34A 3JT5A 4UGYA 3NNYA 4CAMA 3Q9AA 2G6OA 1P6IA 4CAQA 1MMWA 4D3TA 1NODA 3PNHA 4CULA 3NLMA 3JX0A 1QW5A 4JSMA 5FVUA 4UPTA 3EAIA 5AGMA 1VAGA 3JWTA 5FW0A 5AD9A 4K5DA 6NSEA 3NLPA 1D1XA 5G6CA 1ED6A 4V3WA 3N67A 3N6DA 4UGUA 5FVTA 5FVVA 2NODA 4UGVA 3PNEA 4CDTA 4KCIA 5FVZA 4KCPA 3RQLA 4UG8A 3UFWA 5G65A 4FVXA 4FVYA 3N61A 1DWXA 3NLIA 4D3KA 3SVQA 3NM0A 4FW0A 2FC2A 4D7IA 5G6GA 1JWKA 5AD4A 1M9TA 3NLUA 1NOSA 3JT8A 3N5YA 4IMSA 3N6FA 5AGOA 5FJ3A 3E7SA 4C39A 3JWVA 4D7OA 5G0OA 5AD7A 3RQJA 4UGBA 4JSIA 4CTTA 5G6LA 1DMKA 8NSEA 4UH1A 1M8EA 2NSIA 4FVZA 4CX7A 1D1YA 4V3XA 1M9MA 3JT3A 3NOSA 4KCKA 3JWZA 5G68A 3NLHA 4JSGA 4D3AA 7NSEA 4K5GA 1DWVA 4UGCA 1JWJA 4UGMA 3N6AA 3E65A 5G6FA 4UGXA 4CX0A 3UFTA 3JX1A 4CWWA 4D3VA 4UH8A 5G66A 1FOJA 4CTPA 1D0OA 4UGAA 4CTXA 2ORQA 4UHAA 2NOSA 5G6JA 3NLYA 4UPSA 4IMXA 4UH9A 2NSEA 4UQSA 1FOLA 3TYOA 5FVXA 1K2TA 4CX6A 2G6IA 3NLVA 3NSEA 5G6HA 4CTUA 1NSIA 3NLEA 3JWWA 4UGDA 3NLGA 4LUXA 2G6LA 4UGIA 4IMWA 1DM8A 4CWZA 3EBFA 4EUXA 5NSEA 4CX1A 3N5ZA 4UPRA 3E7IA 3E7TA 4D1OA 1K2RA 3N5SA 5G6OA 2ORRA 5G6NA 3HSPA 1MMVA 4UGFA 3NLFA 1RS8A 3E7GA 2FC1A 3NLRA 1ED4A 4UGOA 3N63A 1N2NA 3N66A 4UPQA 4D31A 4UGKA 3UFSA 5G6DA 4UG6A 1K2UA 4LUWA 5G67A 3FC5A 4K5EA 3B3MA 3EAHA 3NLOA 3JT6A 5AD8A 4D2YA 2Y37A 5G6AA 4CFTB 1I83A 3N5PA 5ADLA 5G6KA 4KCOA 4CU0A 5ADKA 3UFVA 3UFPA 3NW2A 4UH0A 4D30A 3N5RA 3NLDA 4IMUA 4UGWA 4JSKA 4CTYA 2OROA 4CARA 4D3IA 4KCRA 1M7ZA 1RS7A 3HSNA 4V3YA 4K5FA 2HX4A 4UH3A 4D38A 4KCHA 5ADNA 5FVYA 4CAPA 3EBDA 1NSEA 1R35A 4NOSA 4NSEA 4JS9A 4CANA 3N5VA 4UCHA 4UGLA 4CTRA 3E6OA 5FJ2A 5G6IA 3EJ8A 4D3BA 4JSLA 4LWAA 4JSJA 3PNFA 3N60A 3E67A 3B3PA 2AN2A 5FVRA 3NODA 4CUNA 4UPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NLN A;  4C3A A;  3TYN A;  4D1N A;  3RQN A;  5ADJ A;  5G6Q A;  3B3N A;  1D1W A;  2HX3 A;  3UFO A;  5ADD A;  5AGK A;  1FOO A;  4CWV A;  3DWJ A;  3RQO A;  3B3O A;  4CX5 A;  1M9K A;  3NLK A;  1M9R A;  5ADE A;  1MJT A;  2AN0 A;  4UPP A;  4CAO A;  1P6M A;  4D7J A;  4D1P A;  1OM4 A;  4V3V A;  1D0C A;  3NLJ A;  4UH4 A;  3RQM A;  4D35 A;  4CU1 B;  1DM7 A;  2FLQ A;  5FVP A;  3UFU A;  4UGG A;  4UGQ A;  3N6B A;  4JSE A;  1QW4 A;  1M9J A;  3SVP A;  5AD5 A;  3JT9 A;  3JT7 A;  2ORT A;  3N6E A;  4UGP A;  3NLT A;  3HSO A;  4CX4 A;  3JX6 A;  3E6N A;  5FVW A;  4D36 A;  3NNZ A;  4D3M A;  1P6H A;  4D37 A;  4UGN A;  1ZZS A;  4UH7 A;  3NLW A;  1QOM A;  1DMJ A;  3N5T A;  2G6M A;  3NLQ A;  4UG9 A;  4D7H A;  3E6L A;  5ADC A;  4UQR A;  3JWS A;  3UFR A;  1OM5 A;  4CTQ A;  1M9Q A;  3JWU A;  5G0P A;  5G6B A;  4D39 A;  5AGP A;  5G6P A;  4CTW A;  1D1V A;  5AGL A;  2BHJ A;  4CFT A;  1ZZR A;  3DQT A;  5G0N A;  1DMI A;  3RQP A;  4D3N A;  1QWC A;  4CWY A;  4D2Z A;  3N6C A;  4D3J A;  2G6J A;  5G6E A;  4CX3 A;  4CX2 A;  5AGN A;  5ADM A;  4KCN A;  4UH6 A;  3N68 A;  4D3O A;  3RQK A;  1DF1 A;  5G6M A;  3N62 A;  4FVW A;  3E68 A;  3JWX A;  3N2R A;  4CTZ A;  4KCL A;  3DQS A;  3DQR A;  1K2S A;  4KCM A;  4KCJ A;  5ADA A;  4UGH A;  3NLZ A;  1DD7 A;  3NQS A;  4UGE A;  4UG5 A;  1M8I A;  3JX4 A;  3N5W A;  1FOI A;  2AMO A;  4UH5 A;  3N5Q A;  2G6K A;  4D32 A;  3E7M A;  5ADB A;  4CVG A;  3N64 A;  3Q99 A;  4K5I A;  1ZVI A;  4V3U A;  3NLX A;  1LZX A;  4GQE A;  1M7V A;  2HX2 A;  2ORP A;  2FBZ X;  9NSE A;  1Q2O A;  3PNG A;  4UPO A;  3TYL A;  4UGR A;  4UGZ A;  4K5K A;  4UGJ A;  1FOP A;  3E7S B;  3N6G A;  1P6K A;  1M00 A;  4KCQ A;  1QW6 A;  5AD6 A;  2G6H A;  5ADF A;  1ZZT A;  3JX5 A;  1RS9 A;  4CWX A;  1DM6 A;  4K5J A;  4JSH A;  4LWB A;  4CU1 A;  1ED5 A;  3N65 A;  3JX3 A;  5G69 A;  2ORS A;  4D33 A;  1NOC A;  4V3Z A;  4CTV A;  1P6N A;  3N5X A;  1P6J A;  1M8H A;  5ADI A;  3N69 A;  1RS6 A;  2G6N A;  1P6L A;  1M8D A;  4UGT A;  3JT4 A;  1LZZ A;  3TYM A;  3E6T A;  1ZZQ A;  1DWW A;  4KCS A;  4UPN A;  1ZZU A;  4K5H A;  4CUM A;  1ZVL A;  4UG7 A;  4JSF A;  5ADG A;  4IMT A;  5FVS A;  5FVO A;  4D3U A;  3UFQ A;  3JTA A;  5FVQ A;  1VAF A;  3JX2 A;  4UH2 A;  3JWY A;  4UGS A;  4D34 A;  3JT5 A;  4UGY A;  3NNY A;  4CAM A;  3Q9A A;  2G6O A;  1P6I A;  4CAQ A;  1MMW A;  4D3T A;  1NOD A;  3PNH A;  4CUL A;  3NLM A;  3JX0 A;  1QW5 A;  4JSM A;  5FVU A;  4UPT A;  3EAI A;  5AGM A;  1VAG A;  3JWT A;  5FW0 A;  5AD9 A;  4K5D A;  6NSE A;  3NLP A;  1D1X A;  5G6C A;  1ED6 A;  4V3W A;  3N67 A;  3N6D A;  4UGU A;  5FVT A;  5FVV A;  2NOD A;  4UGV A;  3PNE A;  4CDT A;  4KCI A;  5FVZ A;  4KCP A;  3RQL A;  4UG8 A;  3UFW A;  5G65 A;  4FVX A;  4FVY A;  3N61 A;  1DWX A;  3NLI A;  4D3K A;  3SVQ A;  3NM0 A;  4FW0 A;  2FC2 A;  4D7I A;  5G6G A;  1JWK A;  5AD4 A;  1M9T A;  3NLU A;  1NOS A;  3JT8 A;  3N5Y A;  4IMS A;  3N6F A;  5AGO A;  5FJ3 A;  3E7S A;  4C39 A;  3JWV A;  4D7O A;  5G0O A;  5AD7 A;  3RQJ A;  4UGB A;  4JSI A;  4CTT A;  5G6L A;  1DMK A;  8NSE A;  4UH1 A;  1M8E A;  2NSI A;  4FVZ A;  4CX7 A;  1D1Y A;  4V3X A;  1M9M A;  3JT3 A;  3NOS A;  4KCK A;  3JWZ A;  5G68 A;  3NLH A;  4JSG A;  4D3A A;  7NSE A;  4K5G A;  1DWV A;  4UGC A;  1JWJ A;  4UGM A;  3N6A A;  3E65 A;  5G6F A;  4UGX A;  4CX0 A;  3UFT A;  3JX1 A;  4CWW A;  4D3V A;  4UH8 A;  5G66 A;  1FOJ A;  4CTP A;  1D0O A;  4UGA A;  4CTX A;  2ORQ A;  4UHA A;  2NOS A;  5G6J A;  3NLY A;  4UPS A;  4IMX A;  4UH9 A;  2NSE A;  4UQS A;  1FOL A;  3TYO A;  5FVX A;  1K2T A;  4CX6 A;  2G6I A;  3NLV A;  3NSE A;  5G6H A;  4CTU A;  1NSI A;  3NLE A;  3JWW A;  4UGD A;  3NLG A;  4LUX A;  2G6L A;  4UGI A;  4IMW A;  1DM8 A;  4CWZ A;  3EBF A;  4EUX A;  5NSE A;  4CX1 A;  3N5Z A;  4UPR A;  3E7I A;  3E7T A;  4D1O A;  1K2R A;  3N5S A;  5G6O A;  2ORR A;  5G6N A;  3HSP A;  1MMV A;  4UGF A;  3NLF A;  1RS8 A;  3E7G A;  2FC1 A;  3NLR A;  1ED4 A;  4UGO A;  3N63 A;  1N2N A;  3N66 A;  4UPQ A;  4D31 A;  4UGK A;  3UFS A;  5G6D A;  4UG6 A;  1K2U A;  4LUW A;  5G67 A;  3FC5 A;  4K5E A;  3B3M A;  3EAH A;  3NLO A;  3JT6 A;  5AD8 A;  4D2Y A;  2Y37 A;  5G6A A;  4CFT B;  1I83 A;  3N5P A;  5ADL A;  5G6K A;  4KCO A;  4CU0 A;  5ADK A;  3UFV A;  3UFP A;  3NW2 A;  4UH0 A;  4D30 A;  3N5R A;  3NLD A;  4IMU A;  4UGW A;  4JSK A;  4CTY A;  2ORO A;  4CAR A;  4D3I A;  4KCR A;  1M7Z A;  1RS7 A;  3HSN A;  4V3Y A;  4K5F A;  2HX4 A;  4UH3 A;  4D38 A;  4KCH A;  5ADN A;  5FVY A;  4CAP A;  3EBD A;  1NSE A;  1R35 A;  4NOS A;  4NSE A;  4JS9 A;  4CAN A;  3N5V A;  4UCH A;  4UGL A;  4CTR A;  3E6O A;  5FJ2 A;  5G6I A;  3EJ8 A;  4D3B A;  4JSL A;  4LWA A;  4JSJ A;  3PNF A;  3N60 A;  3E67 A;  3B3P A;  2AN2 A;  5FVR A;  3NOD A;  4CUN A;  4UPM A; 
#chains in the Genus database with same CATH topology
 3NLN A;  4C3A A;  3TYN A;  4D1N A;  3RQN A;  5ADJ A;  5G6Q A;  3B3N A;  1D1W A;  2HX3 A;  3UFO A;  5ADD A;  5AGK A;  1FOO A;  4CWV A;  3DWJ A;  3RQO A;  3B3O A;  4CX5 A;  1M9K A;  3NLK A;  1M9R A;  5ADE A;  1MJT A;  2AN0 A;  4UPP A;  4CAO A;  1P6M A;  4D7J A;  4D1P A;  1OM4 A;  4V3V A;  1D0C A;  3NLJ A;  4UH4 A;  3RQM A;  4D35 A;  4CU1 B;  1DM7 A;  2FLQ A;  5FVP A;  3UFU A;  4UGG A;  4UGQ A;  3N6B A;  4JSE A;  1QW4 A;  1M9J A;  3SVP A;  5AD5 A;  3JT9 A;  3JT7 A;  2ORT A;  3N6E A;  4UGP A;  3NLT A;  3HSO A;  4CX4 A;  3JX6 A;  3E6N A;  5FVW A;  4D36 A;  3NNZ A;  4D3M A;  1P6H A;  4D37 A;  4UGN A;  1ZZS A;  4UH7 A;  3NLW A;  1QOM A;  1DMJ A;  3N5T A;  2G6M A;  3NLQ A;  4UG9 A;  4D7H A;  3E6L A;  5ADC A;  4UQR A;  3JWS A;  3UFR A;  1OM5 A;  4CTQ A;  1M9Q A;  3JWU A;  5G0P A;  5G6B A;  4D39 A;  5AGP A;  5G6P A;  4CTW A;  1D1V A;  5AGL A;  2BHJ A;  4CFT A;  1ZZR A;  3DQT A;  5G0N A;  1DMI A;  3RQP A;  4D3N A;  1QWC A;  4CWY A;  4D2Z A;  3N6C A;  4D3J A;  2G6J A;  5G6E A;  4CX3 A;  4CX2 A;  5AGN A;  5ADM A;  4KCN A;  4UH6 A;  3N68 A;  4D3O A;  3RQK A;  1DF1 A;  5G6M A;  3N62 A;  4FVW A;  3E68 A;  3JWX A;  3N2R A;  4CTZ A;  4KCL A;  3DQS A;  3DQR A;  1K2S A;  4KCM A;  4KCJ A;  5ADA A;  4UGH A;  3NLZ A;  1DD7 A;  3NQS A;  4UGE A;  4UG5 A;  1M8I A;  3JX4 A;  3N5W A;  1FOI A;  2AMO A;  4UH5 A;  3N5Q A;  2G6K A;  4D32 A;  3E7M A;  5ADB A;  4CVG A;  3N64 A;  3Q99 A;  4K5I A;  1ZVI A;  4V3U A;  3NLX A;  1LZX A;  4GQE A;  1M7V A;  2HX2 A;  2ORP A;  2FBZ X;  9NSE A;  1Q2O A;  3PNG A;  4UPO A;  3TYL A;  4UGR A;  4UGZ A;  4K5K A;  4UGJ A;  1FOP A;  3E7S B;  3N6G A;  1P6K A;  1M00 A;  4KCQ A;  1QW6 A;  5AD6 A;  2G6H A;  5ADF A;  1ZZT A;  3JX5 A;  1RS9 A;  4CWX A;  1DM6 A;  4K5J A;  4JSH A;  4LWB A;  4CU1 A;  1ED5 A;  3N65 A;  3JX3 A;  5G69 A;  2ORS A;  4D33 A;  1NOC A;  4V3Z A;  4CTV A;  1P6N A;  3N5X A;  1P6J A;  1M8H A;  5ADI A;  3N69 A;  1RS6 A;  2G6N A;  1P6L A;  1M8D A;  4UGT A;  3JT4 A;  1LZZ A;  3TYM A;  3E6T A;  1ZZQ A;  1DWW A;  4KCS A;  4UPN A;  1ZZU A;  4K5H A;  4CUM A;  1ZVL A;  4UG7 A;  4JSF A;  5ADG A;  4IMT A;  5FVS A;  5FVO A;  4D3U A;  3UFQ A;  3JTA A;  5FVQ A;  1VAF A;  3JX2 A;  4UH2 A;  3JWY A;  4UGS A;  4D34 A;  3JT5 A;  4UGY A;  3NNY A;  4CAM A;  3Q9A A;  2G6O A;  1P6I A;  4CAQ A;  1MMW A;  4D3T A;  1NOD A;  3PNH A;  4CUL A;  3NLM A;  3JX0 A;  1QW5 A;  4JSM A;  5FVU A;  4UPT A;  3EAI A;  5AGM A;  1VAG A;  3JWT A;  5FW0 A;  5AD9 A;  4K5D A;  6NSE A;  3NLP A;  1D1X A;  5G6C A;  1ED6 A;  4V3W A;  3N67 A;  3N6D A;  4UGU A;  5FVT A;  5FVV A;  2NOD A;  4UGV A;  3PNE A;  4CDT A;  4KCI A;  5FVZ A;  4KCP A;  3RQL A;  4UG8 A;  3UFW A;  5G65 A;  4FVX A;  4FVY A;  3N61 A;  1DWX A;  3NLI A;  4D3K A;  3SVQ A;  3NM0 A;  4FW0 A;  2FC2 A;  4D7I A;  5G6G A;  1JWK A;  5AD4 A;  1M9T A;  3NLU A;  1NOS A;  3JT8 A;  3N5Y A;  4IMS A;  3N6F A;  5AGO A;  5FJ3 A;  3E7S A;  4C39 A;  3JWV A;  4D7O A;  5G0O A;  5AD7 A;  3RQJ A;  4UGB A;  4JSI A;  4CTT A;  5G6L A;  1DMK A;  8NSE A;  4UH1 A;  1M8E A;  2NSI A;  4FVZ A;  4CX7 A;  1D1Y A;  4V3X A;  1M9M A;  3JT3 A;  3NOS A;  4KCK A;  3JWZ A;  5G68 A;  3NLH A;  4JSG A;  4D3A A;  7NSE A;  4K5G A;  1DWV A;  4UGC A;  1JWJ A;  4UGM A;  3N6A A;  3E65 A;  5G6F A;  4UGX A;  4CX0 A;  3UFT A;  3JX1 A;  4CWW A;  4D3V A;  4UH8 A;  5G66 A;  1FOJ A;  4CTP A;  1D0O A;  4UGA A;  4CTX A;  2ORQ A;  4UHA A;  2NOS A;  5G6J A;  3NLY A;  4UPS A;  4IMX A;  4UH9 A;  2NSE A;  4UQS A;  1FOL A;  3TYO A;  5FVX A;  1K2T A;  4CX6 A;  2G6I A;  3NLV A;  3NSE A;  5G6H A;  4CTU A;  1NSI A;  3NLE A;  3JWW A;  4UGD A;  3NLG A;  4LUX A;  2G6L A;  4UGI A;  4IMW A;  1DM8 A;  4CWZ A;  3EBF A;  4EUX A;  5NSE A;  4CX1 A;  3N5Z A;  4UPR A;  3E7I A;  3E7T A;  4D1O A;  1K2R A;  3N5S A;  5G6O A;  2ORR A;  5G6N A;  3HSP A;  1MMV A;  4UGF A;  3NLF A;  1RS8 A;  3E7G A;  2FC1 A;  3NLR A;  1ED4 A;  4UGO A;  3N63 A;  1N2N A;  3N66 A;  4UPQ A;  4D31 A;  4UGK A;  3UFS A;  5G6D A;  4UG6 A;  1K2U A;  4LUW A;  5G67 A;  3FC5 A;  4K5E A;  3B3M A;  3EAH A;  3NLO A;  3JT6 A;  5AD8 A;  4D2Y A;  2Y37 A;  5G6A A;  4CFT B;  1I83 A;  3N5P A;  5ADL A;  5G6K A;  4KCO A;  4CU0 A;  5ADK A;  3UFV A;  3UFP A;  3NW2 A;  4UH0 A;  4D30 A;  3N5R A;  3NLD A;  4IMU A;  4UGW A;  4JSK A;  4CTY A;  2ORO A;  4CAR A;  4D3I A;  4KCR A;  1M7Z A;  1RS7 A;  3HSN A;  4V3Y A;  4K5F A;  2HX4 A;  4UH3 A;  4D38 A;  4KCH A;  5ADN A;  5FVY A;  4CAP A;  3EBD A;  1NSE A;  1R35 A;  4NOS A;  4NSE A;  4JS9 A;  4CAN A;  3N5V A;  4UCH A;  4UGL A;  4CTR A;  3E6O A;  5FJ2 A;  5G6I A;  3EJ8 A;  4D3B A;  4JSL A;  4LWA A;  4JSJ A;  3PNF A;  3N60 A;  3E67 A;  3B3P A;  2AN2 A;  5FVR A;  3NOD A;  4CUN A;  4UPM A; 
#chains in the Genus database with same CATH homology
 3NLN A;  4C3A A;  3TYN A;  4D1N A;  3RQN A;  5ADJ A;  5G6Q A;  3B3N A;  1D1W A;  2HX3 A;  3UFO A;  5ADD A;  5AGK A;  1FOO A;  4CWV A;  3DWJ A;  3RQO A;  3B3O A;  4CX5 A;  1M9K A;  3NLK A;  1M9R A;  5ADE A;  1MJT A;  2AN0 A;  4UPP A;  4CAO A;  1P6M A;  4D7J A;  4D1P A;  1OM4 A;  4V3V A;  1D0C A;  3NLJ A;  4UH4 A;  3RQM A;  4D35 A;  4CU1 B;  1DM7 A;  2FLQ A;  5FVP A;  3UFU A;  4UGG A;  4UGQ A;  3N6B A;  4JSE A;  1QW4 A;  1M9J A;  3SVP A;  5AD5 A;  3JT9 A;  3JT7 A;  2ORT A;  3N6E A;  4UGP A;  3NLT A;  3HSO A;  4CX4 A;  3JX6 A;  3E6N A;  5FVW A;  4D36 A;  3NNZ A;  4D3M A;  1P6H A;  4D37 A;  4UGN A;  1ZZS A;  4UH7 A;  3NLW A;  1QOM A;  1DMJ A;  3N5T A;  2G6M A;  3NLQ A;  4UG9 A;  4D7H A;  3E6L A;  5ADC A;  4UQR A;  3JWS A;  3UFR A;  1OM5 A;  4CTQ A;  1M9Q A;  3JWU A;  5G0P A;  5G6B A;  4D39 A;  5AGP A;  5G6P A;  4CTW A;  1D1V A;  5AGL A;  2BHJ A;  4CFT A;  1ZZR A;  3DQT A;  5G0N A;  1DMI A;  3RQP A;  4D3N A;  1QWC A;  4CWY A;  4D2Z A;  3N6C A;  4D3J A;  2G6J A;  5G6E A;  4CX3 A;  4CX2 A;  5AGN A;  5ADM A;  4KCN A;  4UH6 A;  3N68 A;  4D3O A;  3RQK A;  1DF1 A;  5G6M A;  3N62 A;  4FVW A;  3E68 A;  3JWX A;  3N2R A;  4CTZ A;  4KCL A;  3DQS A;  3DQR A;  1K2S A;  4KCM A;  4KCJ A;  5ADA A;  4UGH A;  3NLZ A;  1DD7 A;  3NQS A;  4UGE A;  4UG5 A;  1M8I A;  3JX4 A;  3N5W A;  1FOI A;  2AMO A;  4UH5 A;  3N5Q A;  2G6K A;  4D32 A;  3E7M A;  5ADB A;  4CVG A;  3N64 A;  3Q99 A;  4K5I A;  1ZVI A;  4V3U A;  3NLX A;  1LZX A;  4GQE A;  1M7V A;  2HX2 A;  2ORP A;  2FBZ X;  9NSE A;  1Q2O A;  3PNG A;  4UPO A;  3TYL A;  4UGR A;  4UGZ A;  4K5K A;  4UGJ A;  1FOP A;  3E7S B;  3N6G A;  1P6K A;  1M00 A;  4KCQ A;  1QW6 A;  5AD6 A;  2G6H A;  5ADF A;  1ZZT A;  3JX5 A;  1RS9 A;  4CWX A;  1DM6 A;  4K5J A;  4JSH A;  4LWB A;  4CU1 A;  1ED5 A;  3N65 A;  3JX3 A;  5G69 A;  2ORS A;  4D33 A;  1NOC A;  4V3Z A;  4CTV A;  1P6N A;  3N5X A;  1P6J A;  1M8H A;  5ADI A;  3N69 A;  1RS6 A;  2G6N A;  1P6L A;  1M8D A;  4UGT A;  3JT4 A;  1LZZ A;  3TYM A;  3E6T A;  1ZZQ A;  1DWW A;  4KCS A;  4UPN A;  1ZZU A;  4K5H A;  4CUM A;  1ZVL A;  4UG7 A;  4JSF A;  5ADG A;  4IMT A;  5FVS A;  5FVO A;  4D3U A;  3UFQ A;  3JTA A;  5FVQ A;  1VAF A;  3JX2 A;  4UH2 A;  3JWY A;  4UGS A;  4D34 A;  3JT5 A;  4UGY A;  3NNY A;  4CAM A;  3Q9A A;  2G6O A;  1P6I A;  4CAQ A;  1MMW A;  4D3T A;  1NOD A;  3PNH A;  4CUL A;  3NLM A;  3JX0 A;  1QW5 A;  4JSM A;  5FVU A;  4UPT A;  3EAI A;  5AGM A;  1VAG A;  3JWT A;  5FW0 A;  5AD9 A;  4K5D A;  6NSE A;  3NLP A;  1D1X A;  5G6C A;  1ED6 A;  4V3W A;  3N67 A;  3N6D A;  4UGU A;  5FVT A;  5FVV A;  2NOD A;  4UGV A;  3PNE A;  4CDT A;  4KCI A;  5FVZ A;  4KCP A;  3RQL A;  4UG8 A;  3UFW A;  5G65 A;  4FVX A;  4FVY A;  3N61 A;  1DWX A;  3NLI A;  4D3K A;  3SVQ A;  3NM0 A;  4FW0 A;  2FC2 A;  4D7I A;  5G6G A;  1JWK A;  5AD4 A;  1M9T A;  3NLU A;  1NOS A;  3JT8 A;  3N5Y A;  4IMS A;  3N6F A;  5AGO A;  5FJ3 A;  3E7S A;  4C39 A;  3JWV A;  4D7O A;  5G0O A;  5AD7 A;  3RQJ A;  4UGB A;  4JSI A;  4CTT A;  5G6L A;  1DMK A;  8NSE A;  4UH1 A;  1M8E A;  2NSI A;  4FVZ A;  4CX7 A;  1D1Y A;  4V3X A;  1M9M A;  3JT3 A;  3NOS A;  4KCK A;  3JWZ A;  5G68 A;  3NLH A;  4JSG A;  4D3A A;  7NSE A;  4K5G A;  1DWV A;  4UGC A;  1JWJ A;  4UGM A;  3N6A A;  3E65 A;  5G6F A;  4UGX A;  4CX0 A;  3UFT A;  3JX1 A;  4CWW A;  4D3V A;  4UH8 A;  5G66 A;  1FOJ A;  4CTP A;  1D0O A;  4UGA A;  4CTX A;  2ORQ A;  4UHA A;  2NOS A;  5G6J A;  3NLY A;  4UPS A;  4IMX A;  4UH9 A;  2NSE A;  4UQS A;  1FOL A;  3TYO A;  5FVX A;  1K2T A;  4CX6 A;  2G6I A;  3NLV A;  3NSE A;  5G6H A;  4CTU A;  1NSI A;  3NLE A;  3JWW A;  4UGD A;  3NLG A;  4LUX A;  2G6L A;  4UGI A;  4IMW A;  1DM8 A;  4CWZ A;  3EBF A;  4EUX A;  5NSE A;  4CX1 A;  3N5Z A;  4UPR A;  3E7I A;  3E7T A;  4D1O A;  1K2R A;  3N5S A;  5G6O A;  2ORR A;  5G6N A;  3HSP A;  1MMV A;  4UGF A;  3NLF A;  1RS8 A;  3E7G A;  2FC1 A;  3NLR A;  1ED4 A;  4UGO A;  3N63 A;  1N2N A;  3N66 A;  4UPQ A;  4D31 A;  4UGK A;  3UFS A;  5G6D A;  4UG6 A;  1K2U A;  4LUW A;  5G67 A;  3FC5 A;  4K5E A;  3B3M A;  3EAH A;  3NLO A;  3JT6 A;  5AD8 A;  4D2Y A;  2Y37 A;  5G6A A;  4CFT B;  1I83 A;  3N5P A;  5ADL A;  5G6K A;  4KCO A;  4CU0 A;  5ADK A;  3UFV A;  3UFP A;  3NW2 A;  4UH0 A;  4D30 A;  3N5R A;  3NLD A;  4IMU A;  4UGW A;  4JSK A;  4CTY A;  2ORO A;  4CAR A;  4D3I A;  4KCR A;  1M7Z A;  1RS7 A;  3HSN A;  4V3Y A;  4K5F A;  2HX4 A;  4UH3 A;  4D38 A;  4KCH A;  5ADN A;  5FVY A;  4CAP A;  3EBD A;  1NSE A;  1R35 A;  4NOS A;  4NSE A;  4JS9 A;  4CAN A;  3N5V A;  4UCH A;  4UGL A;  4CTR A;  3E6O A;  5FJ2 A;  5G6I A;  3EJ8 A;  4D3B A;  4JSL A;  4LWA A;  4JSJ A;  3PNF A;  3N60 A;  3E67 A;  3B3P A;  2AN2 A;  5FVR A;  3NOD A;  4CUN A;  4UPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...