The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
35
|
sequence length |
121
|
structure length |
121
|
Chain Sequence |
MQDTIFLKGMRFYGYHGALSAENEIGQIFKVDVTLKVDLSEAGRTDNVIDTVHYGEVFEEVKSIMEGKAVNLLEHLAERIANRINSQYNRVMETKVRITKENPPIPGHYDGVGIEIVRENK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure and reaction mechanism of 7,8-dihydroneopterin aldolase from Staphylococcus aureus.
pubmed doi rcsb |
| molecule tags |
Pterin binding
|
| source organism |
Staphylococcus aureus
|
| molecule keywords |
7,8-DIHYDRONEOPTERIN ALDOLASE
|
| total genus |
35
|
| structure length |
121
|
| sequence length |
121
|
| ec nomenclature |
ec
4.1.2.25: Dihydroneopterin aldolase. |
| pdb deposition date | 1998-03-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02152 | FolB | Dihydroneopterin aldolase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | GTP Cyclohydrolase I, domain 2 | GTP Cyclohydrolase I, domain 2 |
#chains in the Genus database with same CATH superfamily 4GHM A; 2NM3 A; 1NBU B; 1A9C A; 2NM2 A; 1A8R A; 1NBU C; 1RRY A; 3R2E A; 1FB1 A; 1WPL A; 1RSI A; 1WUQ A; 4UQF A; 4DU6 A; 3S19 A; 1NBU A; 1RRW A; 5F3M A; 4IQI A; 1SQL A; 1WUR A; 1WM9 A; 4AEY A; 3UXV A; 3BP1 A; 3O1K A; 1RRI A; 5FAR A; 1N3T A; 1IS8 A; 3RZP A; 4F8B A; 1N3R A; 1N3S A; 3UXJ A; 3V9O A; 2O90 A; 1RS2 A; 1RSD A; 1FBX A; 1B9L A; 1RS4 A; 4FGC A; 3RJ4 A; 2CG8 A; 1IS7 A; 1GTP A; 2DHN A; 1DHN A; 1Z9W A; 1U68 A; #chains in the Genus database with same CATH topology 4GHM A; 2NM3 A; 1NBU B; 1A9C A; 2NM2 A; 1A8R A; 1NBU C; 1RRY A; 3R2E A; 1FB1 A; 1WPL A; 1RSI A; 1WUQ A; 4UQF A; 4DU6 A; 3S19 A; 1NBU A; 1RRW A; 5F3M A; 4IQI A; 1SQL A; 1WUR A; 1WM9 A; 4AEY A; 3UXV A; 3BP1 A; 3O1K A; 1RRI A; 5FAR A; 1N3T A; 1IS8 A; 3RZP A; 4F8B A; 1N3R A; 1N3S A; 3UXJ A; 3V9O A; 2O90 A; 1RS2 A; 1RSD A; 1FBX A; 1B9L A; 1RS4 A; 4FGC A; 3RJ4 A; 2CG8 A; 1IS7 A; 1GTP A; 2DHN A; 1DHN A; 1Z9W A; 1U68 A; #chains in the Genus database with same CATH homology 4GHM A; 2NM3 A; 1NBU B; 1A9C A; 2NM2 A; 1A8R A; 1NBU C; 1RRY A; 3R2E A; 1FB1 A; 1WPL A; 1RSI A; 1WUQ A; 4UQF A; 4DU6 A; 3S19 A; 1NBU A; 1RRW A; 5F3M A; 4IQI A; 1SQL A; 1WUR A; 1WM9 A; 4AEY A; 3UXV A; 3BP1 A; 3O1K A; 1RRI A; 5FAR A; 1N3T A; 1IS8 A; 3RZP A; 4F8B A; 1N3R A; 1N3S A; 3UXJ A; 3V9O A; 2O90 A; 1RS2 A; 1RSD A; 1FBX A; 1B9L A; 1RS4 A; 4FGC A; 3RJ4 A; 2CG8 A; 1IS7 A; 1GTP A; 2DHN A; 1DHN A; 1Z9W A; 1U68 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
