The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
37
|
sequence length |
118
|
structure length |
118
|
Chain Sequence |
ADRIELRGLTVHGRHGVAAHERVAGQRFVIDVTVWIDLAEAANSDDLADTYDYVRLASRAAEIVAGPPRKLIETVGAEIADHVMDDQRVHAVEVAVHKPQAPIPQTFDDVAVVIRRSR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Regulation by oligomerization in a mycobacterial folate biosynthetic enzyme.
pubmed doi rcsb |
| molecule keywords |
Probable dihydroneopterin aldolase
|
| molecule tags |
Lyase
|
| source organism |
Mycobacterium tuberculosis
|
| total genus |
37
|
| structure length |
118
|
| sequence length |
118
|
| ec nomenclature |
ec
1.13.11.81: 7,8-dihydroneopterin oxygenase. |
| pdb deposition date | 2002-12-03 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| C | PF02152 | FolB | Dihydroneopterin aldolase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | GTP Cyclohydrolase I, domain 2 | GTP Cyclohydrolase I, domain 2 |
#chains in the Genus database with same CATH superfamily 4AEY A; 2NM2 A; 1RRI A; 1U68 A; 2CG8 A; 1GTP A; 1IS7 A; 1N3R A; 1RSI A; 1N3T A; 2O90 A; 3S19 A; 2DHN A; 5F3M A; 4GHM A; 1RSD A; 1WPL A; 1B9L A; 3RZP A; 1WUQ A; 1Z9W A; 4FGC A; 1IS8 A; 3V9O A; 1A8R A; 1NBU C; 3R2E A; 3UXV A; 4UQF A; 3BP1 A; 1WM9 A; 5FAR A; 4DU6 A; 1WUR A; 4F8B A; 3O1K A; 1A9C A; 3RJ4 A; 1FBX A; 3UXJ A; 4IQI A; 1NBU B; 1NBU A; 1FB1 A; 1N3S A; 1RRW A; 1SQL A; 2NM3 A; 1RS2 A; 1RS4 A; 1RRY A; 1DHN A; #chains in the Genus database with same CATH topology 4AEY A; 2NM2 A; 1RRI A; 1U68 A; 2CG8 A; 1GTP A; 1IS7 A; 1N3R A; 1RSI A; 1N3T A; 2O90 A; 3S19 A; 2DHN A; 5F3M A; 4GHM A; 1RSD A; 1WPL A; 1B9L A; 3RZP A; 1WUQ A; 1Z9W A; 4FGC A; 1IS8 A; 3V9O A; 1A8R A; 1NBU C; 3R2E A; 3UXV A; 4UQF A; 3BP1 A; 1WM9 A; 5FAR A; 4DU6 A; 1WUR A; 4F8B A; 3O1K A; 1A9C A; 3RJ4 A; 1FBX A; 3UXJ A; 4IQI A; 1NBU B; 1NBU A; 1FB1 A; 1N3S A; 1RRW A; 1SQL A; 2NM3 A; 1RS2 A; 1RS4 A; 1RRY A; 1DHN A; #chains in the Genus database with same CATH homology 4AEY A; 2NM2 A; 1RRI A; 1U68 A; 2CG8 A; 1GTP A; 1IS7 A; 1N3R A; 1RSI A; 1N3T A; 2O90 A; 3S19 A; 2DHN A; 5F3M A; 4GHM A; 1RSD A; 1WPL A; 1B9L A; 3RZP A; 1WUQ A; 1Z9W A; 4FGC A; 1IS8 A; 3V9O A; 1A8R A; 1NBU C; 3R2E A; 3UXV A; 4UQF A; 3BP1 A; 1WM9 A; 5FAR A; 4DU6 A; 1WUR A; 4F8B A; 3O1K A; 1A9C A; 3RJ4 A; 1FBX A; 3UXJ A; 4IQI A; 1NBU B; 1NBU A; 1FB1 A; 1N3S A; 1RRW A; 1SQL A; 2NM3 A; 1RS2 A; 1RS4 A; 1RRY A; 1DHN A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
