The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
19
|
sequence length |
85
|
structure length |
85
|
Chain Sequence |
ESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLHTKGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQFLPEAKR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Extension of the binding motif of the sin3 interacting domain of the mad family proteins(,).
pubmed rcsb |
| molecule keywords |
Sin3b protein
|
| molecule tags |
Transcription
|
| source organism |
Mus musculus
|
| total genus |
19
|
| structure length |
85
|
| sequence length |
85
|
| ec nomenclature | |
| pdb deposition date | 2003-05-19 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02671 | PAH | Paired amphipathic helix repeat |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | Paired amphipathic helix 2 (pah2 repeat) | Paired amphipathic helix |
#chains in the Genus database with same CATH superfamily 2F05 A; 1E91 A; 2L9S B; 2RMR A; 2LD7 B; 1S5R B; 2CR7 A; 1PD7 A; 1G1E B; 2CZY A; 2RMS A; 1S5Q B; #chains in the Genus database with same CATH topology 5F3X A; 4YL6 A; 2KBR A; 4YKC A; 2RMR A; 2LD7 B; 4FQN A; 4Y5O A; 3K1R A; 1S5R B; 2CR7 A; 2CZY A; 2RMS A; 1S5Q B; 2F05 A; 4YKD A; 1G1E B; 1E91 A; 2KBQ A; 2L9S B; 2LSR A; 1PD7 A; #chains in the Genus database with same CATH homology 2F05 A; 1E91 A; 2L9S B; 2RMR A; 2LD7 B; 1S5R B; 2CR7 A; 1PD7 A; 1G1E B; 2CZY A; 2RMS A; 1S5Q B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
