The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
22
|
sequence length |
89
|
structure length |
89
|
Chain Sequence |
SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
HBP1 and Mad1 repressors bind the Sin3 corepressor PAH2 domain with opposite helical orientations.
pubmed doi rcsb |
| molecule keywords |
high mobility group box transcription factor 1
|
| molecule tags |
Transcription
|
| source organism |
Mus musculus
|
| total genus |
22
|
| structure length |
89
|
| sequence length |
89
|
| ec nomenclature | |
| pdb deposition date | 2004-01-21 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| B | PF02671 | PAH | Paired amphipathic helix repeat |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | Paired amphipathic helix 2 (pah2 repeat) | Paired amphipathic helix |
#chains in the Genus database with same CATH superfamily 1E91 A; 1G1E B; 2CR7 A; 1S5Q B; 2RMR A; 1PD7 A; 1S5R B; 2LD7 B; 2RMS A; 2F05 A; 2CZY A; 2L9S B; #chains in the Genus database with same CATH topology 1S5Q B; 2LD7 B; 2KBQ A; 4YKC A; 1G1E B; 2LSR A; 4FQN A; 2CZY A; 4YL6 A; 2KBR A; 2CR7 A; 2RMR A; 1PD7 A; 1S5R B; 2RMS A; 4YKD A; 1E91 A; 4Y5O A; 5F3X A; 2F05 A; 3K1R A; 2L9S B; #chains in the Genus database with same CATH homology 1E91 A; 1G1E B; 2CR7 A; 1S5Q B; 2RMR A; 1PD7 A; 1S5R B; 2LD7 B; 2RMS A; 2F05 A; 2CZY A; 2L9S B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...