The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
20
|
sequence length |
67
|
structure length |
67
|
Chain Sequence |
ACQASQLAVCASAILSGAKPSGECCGNLRAQQGCFCQYAKDPTYGQYIRSPHARDTLTSCGLAVPHC
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of a liganded type 2 non-specific lipid-transfer protein from wheat and the molecular basis of lipid binding.
pubmed doi rcsb |
| molecule tags |
Lipid transport
|
| molecule keywords |
Nonspecific lipid-transfer protein 2G
|
| total genus |
20
|
| structure length |
67
|
| sequence length |
67
|
| ec nomenclature | |
| pdb deposition date | 2004-06-25 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Hydrophobic Seed Protein | Plant lipid-transfer and hydrophobic proteins |
#chains in the Genus database with same CATH superfamily 1GH1 A; 1FK3 A; 1JTB A; 1FK2 A; 4XUW A; 1PSY A; 1BWO A; 1MID A; 2LVF A; 1HSS A; 1BFA A; 1BE2 A; 4CVW C; 1TUK A; 2MAL A; 1FK6 A; 1BEA A; 1FK4 A; 1SIY A; 2DS2 B; 1AFH A; 1B1U A; 2N81 A; 1FK5 A; 1T12 A; 1L6H A; 2N2Z A; 1FK1 A; 1UVB A; 2RKN A; 1FK0 A; 1HYP A; 2B5S A; 1PNB B; 1BIP A; 1N89 A; 1UVC A; 1BV2 A; 1TMQ B; 1W2Q A; 1CZ2 A; 1SM7 A; 1FK7 A; 2ALG A; 1RZL A; 1MZL A; 5DOM A; 1S6D A; 1LIP A; 3GSH A; 1MZM A; 1UVA A; #chains in the Genus database with same CATH topology 1GH1 A; 1FK3 A; 1JTB A; 2VKZ G; 3HMJ G; 1FK2 A; 4XUW A; 3H37 A; 1PSY A; 1BWO A; 1MID A; 2LVF A; 1HSS A; 1BFA A; 1BE2 A; 4CVW C; 1TUK A; 2MAL A; 1MIY A; 1FK6 A; 1BEA A; 1FK4 A; 1SIY A; 2DS2 B; 1MIW A; 1AFH A; 1B1U A; 2N81 A; 1FK5 A; 1T12 A; 1L6H A; 2N2Z A; 1FK1 A; 1UVB A; 2RKN A; 1FK0 A; 1HYP A; 2B5S A; 2UV8 G; 1PNB B; 1BIP A; 1N89 A; 1UVC A; 3H3A A; 1BV2 A; 1TMQ B; 1W2Q A; 1CZ2 A; 1SM7 A; 1FK7 A; 2ALG A; 1RZL A; 1MIV A; 1MZL A; 5DOM A; 1S6D A; 1LIP A; 3GSH A; 1MZM A; 1UVA A; #chains in the Genus database with same CATH homology 1GH1 A; 1FK3 A; 1JTB A; 1FK2 A; 4XUW A; 1PSY A; 1BWO A; 1MID A; 2LVF A; 1HSS A; 1BFA A; 1BE2 A; 4CVW C; 1TUK A; 2MAL A; 1FK6 A; 1BEA A; 1FK4 A; 1SIY A; 2DS2 B; 1AFH A; 1B1U A; 2N81 A; 1FK5 A; 1T12 A; 1L6H A; 2N2Z A; 1FK1 A; 1UVB A; 2RKN A; 1FK0 A; 1HYP A; 2B5S A; 1PNB B; 1BIP A; 1N89 A; 1UVC A; 1BV2 A; 1TMQ B; 1W2Q A; 1CZ2 A; 1SM7 A; 1FK7 A; 2ALG A; 1RZL A; 1MZL A; 5DOM A; 1S6D A; 1LIP A; 3GSH A; 1MZM A; 1UVA A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
