The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
40
|
sequence length |
170
|
structure length |
160
|
Chain Sequence |
AMEKFAEYALSFGTEILTVEYGPLPIGKIVSEEINCSVYSVDPEGRVYTQAIAQWHDRGEQEVLEYELEDGSVIRATSDHRFLTTDYQLLAIEEIFARQLDLLTLENHRLPFPLLDAGTIKMVKVIGRRSLGVQRIFDIGLPQDHNFLLANGAIAAACFN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structures of an intein from the split dnaE gene of Synechocystis sp. PCC6803 reveal the catalytic model without the penultimate histidine and the mechanism of zinc ion inhibition of protein splicing
pubmed doi rcsb |
molecule tags |
Transferase
|
source organism |
Synechocystis sp. pcc 6803
|
molecule keywords |
DNA polymerase III alpha subunit
|
total genus |
40
|
structure length |
160
|
sequence length |
170
|
ec nomenclature |
ec
2.7.7.7: DNA-directed DNA polymerase. |
pdb deposition date | 2005-04-14 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Complex | Endonuclease - Pi-scei; Chain A, domain 1 | Hedgehog/Intein (Hint) domain |
#chains in the Genus database with same CATH superfamily 1DQ3 A; 1MI8 A; 2L8L A; 2CW7 A; 2IN8 A; 3NZM A; 1LWT A; 4KL6 A; 5I0A A; 1DFA A; 1UM2 A; 1EF0 A; 1LWS A; 2LQM A; 1AT0 A; 1VDE A; 2IMZ A; 4KL5 A; 4O1S A; 1JVA A; 2JNQ A; 3IFJ A; 1ZDE A; 4OZ6 A; 2CW8 A; 4E2U A; 4E2T A; 2LCJ A; 2IN9 A; 4O1R A; 4GIG A; 1ZD7 A; 2IN0 A; 2LWY A; 2JMZ A; 2KEQ A; 3IGD A; 5K08 A; 1AM2 A; 1GPP A; #chains in the Genus database with same CATH topology 1DQ3 A; 1MI8 A; 2L8L A; 4LX3 A; 2CW7 A; 4QFQ A; 2IN8 A; 3NZM A; 1LWT A; 4KL6 A; 5I0A A; 1DFA A; 1UM2 A; 1EF0 A; 1LWS A; 2LQM A; 1AT0 A; 1VDE A; 2IMZ A; 4KL5 A; 4O1S A; 1JVA A; 2JNQ A; 3IFJ A; 1ZDE A; 4OZ6 A; 2CW8 A; 4E2U A; 4E2T A; 2LCJ A; 2IN9 A; 4O1R A; 4GIG A; 1ZD7 A; 2IN0 A; 2LWY A; 2JMZ A; 2KEQ A; 3IGD A; 5K08 A; 1AM2 A; 1GPP A; #chains in the Genus database with same CATH homology 1DQ3 A; 1MI8 A; 2L8L A; 2CW7 A; 2IN8 A; 3NZM A; 1LWT A; 4KL6 A; 5I0A A; 1DFA A; 1UM2 A; 1EF0 A; 1LWS A; 2LQM A; 1AT0 A; 1VDE A; 2IMZ A; 4KL5 A; 4O1S A; 1JVA A; 2JNQ A; 3IFJ A; 1ZDE A; 4OZ6 A; 2CW8 A; 4E2U A; 4E2T A; 2LCJ A; 2IN9 A; 4O1R A; 4GIG A; 1ZD7 A; 2IN0 A; 2LWY A; 2JMZ A; 2KEQ A; 3IGD A; 5K08 A; 1AM2 A; 1GPP A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...