2CW7A

Crystal structure of intein homing endonuclease ii
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
537
structure length
537
Chain Sequence
SILPEEWLPVLEEGEVHFVRIGELIDRMMEENAGKVKREGETEVLEVSGLEVPSFNRRTNKAELKRVKALIRHDYSGKVYTIRLKSGRRIKITSGHSLFSVRNGELVEVTGDELKPGDLVAVPRRLELPERNHVLNLVELLLGTPEEETLDIVMTIPVKGKKNFFKGMLRTLRWIFGEEKRPRTARRYLRHLEDLGYVRLKKIGYEVLDWDSLKNYRRLYEALVENVRYNGNKREYLVEFNSIRDAVGIMPLKELKEWKIGTLNGFRMRKLIEVDESLAKLLGYYVSEGYARKQRNPKNGWSYSVKLYNEDPEVLDDMERLASRFFGKVRRGRNYVEIPKKIGYLLFENMCGVLAENKRIPEFVFTSPKGVRLAFLEGYFIGDGDVHPNKRLRLSTKSELLANQLVLLLNSVGVSAVKLGHDSGVYRVYINEELPFVKLDKKKNAYYSHVIPKEVLSEVFGKVFQKNVSPQTFRKMVEDGRLDPEKAQRLSWLIEGDVVLDRVESVDVEDYDGYVYDLSVEDNENFLVGFGLVYAHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Endonuclease PI-PkoII
publication title Crystal structure of intein homing endonuclease II encoded in DNA polymerase gene from hyperthermophilic archaeon Thermococcus kodakaraensis strain KOD1
pubmed doi rcsb
source organism Thermococcus kodakarensis
total genus 160
structure length 537
sequence length 537
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2005-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14528 LAGLIDADG_3 LAGLIDADG-like domain
A PF14890 Intein_splicing Intein splicing domain
A PF18714 PI-TkoII_IV DNA polymerase II intein Domain IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1010 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2cw7A02
2.170.16.10 Mainly Beta Beta Complex Endonuclease - Pi-scei; Chain A, domain 1 Hedgehog/Intein (Hint) domain 2cw7A01
3.10.28.10 Alpha Beta Roll Endonuclease I-creI Homing endonucleases 2cw7A03
3.30.1490.210 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2cw7A04
4AQXA 1U0DA 1DFAA 4E2TA 2CW7A 2VBOA 5K08A 3MX9A 1P8KZ 2AB5A 1AF5A 2IMZA 1MOWA 5AKNA 4Z1XA 1DQ3A 4Z1ZA 5AK9A 1ZDEA 5E5OA 2O7MA 3QQYA 3MXBB 3MXAA 4YHXA 2L8LA 4GIGA 4UN9A 4UNBA 2VBOB 2IN0A 2I3QA 2LQMA 2DCHX 1VDEA 4UN9G 5A74A 2JNQA 2VBJA 1AM2A 3C0XA 5A0WA 2KEQA 4UN7A 5A78A 1JVAA 2LWYA 5A0MA 1T9JA 4Z20A 4UN7G 3E54A 4O1SA 1LWSA 4UT0A 3HYJA 3MISA 2JMZA 4LOXA 3IFJA 1G9ZA 2XE0A 4D6NA 2EX5A 3OOLA 2VS7A 1MI8A 4O1RA 2VBNA 3EH8A 2VBJB 4LQ0A 4AAFA 5A72A 5E5SA 2IN9A 1G9YA 4UN8A 1GPPA 2IN8A 4E2UA 1B24A 2CW8A 5A0MB 4AQUA 1M5XA 4UNAA 4OZ6A 4YISA 1N3FA 1ZD7A 3KO2A 1BP7A 1T9IA 4UN8G 2VBLA 2VBLB 4AADA 5E67A 5A77A 1U0CA 1R7MA 5I0AA 2QOJZ 5AKMA 3MIPA 2XE0B 3IGDA 2LCJA 4EFJA 3UVFA 3FD2A 4AAEA 3OORA 1N3EA 2VBNB 1AT0A 4D6OA 2VS8A 1UM2A 3R7PA 4KL6A 3C0WA 3HYIA 3NZMA 1EF0A 4YITA 4AABA 3MXBA 5AKFA 5E63A 1LWTA 4AAGA 4KL5A 2I3PA 4UNCA 2FLDA
chains in the Genus database with same CATH superfamily
4DOZA 4DL4A 2WE6A 5HLGA 1XNRH 1IGNA 3VSKA 3C3WA 4BBSG 1I7NA 4BE1A 4IHWA 5K08A 2LLKA 3W3CA 5BOXA 1W36C 1IXSB 1XGSA 4CA0A 1WJFA 4HG2A 2X1DA 2XGCA 4HSTA 3A0BC 4I0AA 2EZHA 1JTXA 4DJAA 5JH7F 2XAGA 3DP7A 1MJAA 1BJZA 1RYSA 5KHDA 1ERDA 2YL2A 2JUCA 5GTHC 4RS8A 5EZHA 1DPRA 2DU9A 1GSOA 3I9V2 1I50J 4NBQA 4DBQA 2EINH 3L2QA 2AQEA 3GLKA 1U6GA 1OFCX 4JYKA 5FKMA 2JTVA 3GZ6A 3CUQC 1Z05A 2A3SA 1P4WA 4RGUA 5E8GA 1GUUA 4AYBA 1IOWA 4YAKB 3DU5A 3RKWA 1I6XA 4CZCA 1G2HA 3GTGA 1YIJI 2CQKA 5JI6A 2E2HA 3O8HA 1YLFA 3LNQA 1RK6A 4L9NA 3OYEA 2M4GA 2WV1A 1O7LA 2ISYA 2W84A 2QENA 2FMLA 4IL6C 1ZR2A 3JRGA 4UCSA 2R7FA 3ZQFA 2ZXIA 4GXOA 2PVPA 4EBDA 3LA3A 4KN4X 2Z5UA 3FXLA 1FMWA 2RREA 4YFNF 5HVQC 1WCMA 4NXMH 5DG8A 2KRFA 4EATA 5FPOA 3H3ZA 4DR5H 4OMZA 1HNXH 1V5GA 2CO5A 5FFXA 4IQJA 2DA3A 4UN7G 3FM3A 5DLFA 5KFVA 3F23A 4I01A 2DYRH 2M3AA 3KP3A 3ROUA 5DM6F 3IL2A 4UNOA 3RZOJ 4J9NA 3CCYA 2K40A 1XN7A 5HBRB 4ZDLA 4OIRF 1HLVA 4Z6YA 5KFKA 2DOFA 1RJRA 2E5NA 4Y3OA 1IDZA 2A68F 3BABA 4J0MA 1W7PA 2IGMA 5EEHA 1NHAA 4DR6H 2COMA 3BR5A 4CCNA 1BXRA 1RPWA 3GFIA 2E71A 3IP4B 4AWXB 2YCHA 4LIUA 2PJRB 2M87A 2HYFA 2XKOA 3LQRA 3D5LA 2L02A 2YSRA 1GSAA 4ECXA 1LPQA 1C0WA 3OWTA 1VQPI 5A0MB 2CW8A 2LOOA 5J2UF 2NS0A 2KJBA 3WTSC 4YISA 1BP7A 2KZVA 5JFRA 2MYSA 2VQFH 1Q1HA 3ZP5A 2R8KA 1PP8F 2R82A 2V4QA 1VQ9I 2V6CA 5LMNH 2BVLA 2IEKA 4L5IA 2RGVA 3TO7A 3L00A 2DMTA 3OYLA 3RKQA 2OTJI 2DXIA 1UHSA 5AKMA 3TIGA 4DUZH 2Y9ZA 3GTMA 3WG9A 2PFBA 3TW6A 1R4MB 1FNNA 1I3QA 2IGKA 3VODA 1MBHA 1TZLA 2DWCA 1LE8B 2QCOA 2VKHA 3K0LA 4W97A 4A2UA 2BY3A 4AYBN 5D8LB 3CO7C 1YITI 3JAMZ 2UZKA 2IS1A 1TWHA 1M0WA 4B3XA 2WV0A 5L3GA 2QBYB 6PAXA 4QWAA 2VASA 5CVVA 2UUZA 3Q9SA 4QW9A 5IYCJ 2R8GA 3H9JA 5FLXZ 3I3LA 2ESNA 4FTHA 5KFXA 1KA8A 4EEQA 2W9CA 2GXAA 3CDLA 5KG2A 1IN6A 2OZ6A 2ZFUA 2R86A 4AAGA 4HYEA 4CICA 2DN0A 5AIQA 4HR7A 2A6EF 1VTNC 1W0TA 2YX7A 1U5TC 2PI0A 2K9NA 2B63J 2FLDA 1Y14B 2V59A 4DR7H 3PO3G 4BBSJ 2TRTA 3MEXA 4XICA 2J5OA 4B8XA 5BS6A 1YOVB 4DV7H 1XPXA 3GIIA 3T0YA 3PM1A 1WI3A 2HKXA 4IHVA 3MMYB 3U1DA 4LG0A 5GADJ 1D8KA 1P9QC 2UU9H 1FOWA 2AXLA 2Z2SB 2XF7A 4ECRA 2BGCA 3DQVC 3JR9A 2KSWA 2W6ZA 5HS7A 4M7EA 2DT5A 4A3KG 4YFXF 2NU8B 4ED1A 2G7UA 1NK2P 1R71A 4NXNH 2WAQA 3U21A 5F9LA 1V5FA 1TWHJ 1WSUA 4BNCA 1RC9A 5D5WB 3QYFA 1R1UA 5C3EG 3V6JA 4R7RA 4RLQA 3AG1H 2E1NA 2IPQX 1ETOA 4YIRX 1J75A 4G6QA 4BQAA 4O3SA 3WNZA 3MFIA 5BNGA 2V1XA 4M3DA 5D6FA 1YX5A 2DQLA 3GTKA 1T38A 4XLAA 4F4ZA 3F21A 3QPSA 4UHTA 4IO9F 1HDDC 4RA2A 4IRHA 2JNQA 2NU9B 3K70C 4BKXA 1HDPA 4UY8I 3KLOA 1JDEA 3N43B 2KEQA 1JHHA 5GONF 5D6EA 2E60A 2ZDHA 4O3PA 3RSNA 3JRWA 2IA2A 4RGSA 1S9HA 2HWVA 4WCGA 2VI6A 5L3CA 3KCCA 2H8WA 4LIVA 4QIWA 3FHZA 2M0CA 4XNFA 5FFZA 2LR8A 1BC8C 3OSFA 2CG4A 4C3HJ 1R49A 1KU2A 3W2WA 2W70A 2MBFA 4M72A 3R0JA 2MD0A 4FISA 3G6EI 3CJTB 1FTZA 1O4XA 1RIOH 5ICCA 4L9TA 3L2CA 1SEUA 1IV6A 4PWQA 2W1OA 4KMFA 2HOSA 2JPBA 4M3GA 2Z3YA 4ENJA 4A3LG 1XGOA 2J9GA 4Y8VB 2AQ4A 3A2KA 3GIPA 1KBLA 1SFKA 1Y6IA 2JK3A 3EH8A 3Q2OA 2H1KA 2PMHA 3K9TA 2BHZA 3ECHA 4RAZA 2V79A 2BOLA 2DMPA 1FOKA 3CMEI 4BWSC 4YB8B 2UXDH 3PW0A 3GEZA 4BHPA 2W82A 3MKZA 3BZCA 4DW6A 4U7CA 4A3MG 3MIPA 1EZ1A 2AO9A 3HRTA 1QZZA 1OWTA 1ZG3A 4LJZF 2SCUB 3C1DA 5EWFA 2GQQA 5F0HA 3K4MA 3G1OA 1BR4A 3J81K 2P7CB 2VC0A 4LFAH 3F8FA 2XD4A 3HTUA 2WAQN 2K9MA 2FXAA 1W7PB 2O0YA 1WVRA 3GO5A 1GLNA 1D8JA 4NUBA 1XG1A 5GPAA 3M1CA 1T39A 2W7OA 1LDJA 1XS9A 2VUGA 3LSRA 3IV5A 1VQ8I 2YU9A 5DD8A 3CC7I 3OYGA 4A2AA 2Y0MA 1TT5B 2CUFA 2LKSA 2MA3A 4KYWA 3BG5A 2MGQA 5J4VA 2IP4A 1J5EH 1PK8A 4LG3A 3HGGA 5AKFA 1YJWI 4FS2A 2JRMA 5KFCA 5J40A 4RZQA 1R5HA 3GYHX 5KFOA 2HDWA 3GTJJ 1FEXA 3ONQA 2W9BA 2XRLA 2ZXHA 1R7JA 1HW2A 3JSNA 5KFWA 2R7ZA 4E2TA 2DLLA 4QPOA 3PO3J 4NLGA 1WHUA 4QIWN 4J01A 2HVRA 4MO7A 4E7KA 3H9QA 2W9AA 4LFCH 4V2FA 4EJTA 2AB5A 4HDUA 1UHMA 1BGWA 3LAJA 1FBUA 4BJ6C 1DDNA 2UXNA 1JHFA 4QWQA 3F3XA 2M30A 4APMA 3GV7B 4I50F 1O7FA 3QU6A 2UUBH 4U0YA 4A3KJ 3O2PE 2VBYA 3H0GG 3HPGA 3EDPA 3RDIA 2BBYA 1JT6A 4L1KA 2HJWA 2W9CB 4CGZA 1Y1WA 1IG7A 3FXKA 3S3OA 2CQ7A 2MLGA 2L54A 3HC7A 2IMWP 5C3EJ 4CH7A 4LK0F 5KG4A 2Y69H 3KE2A 5IT3A 1AOYA 2RNJA 4F7ZA 1TNTA 2L7KA 4M71A 1I5ZA 4DYQA 2X0SA 3LQQA 3K69A 2BQRA 2JA5A 3R6SA 3LAPA 4O2BF 1E4FT 4C2TA 1D1BA 2IN0A 2LQMA 2FLLA 1I6UA 1U2WA 4LSXA 5FJ8J 4BGDA 3L2UA 2XVCA 3C2BA 4NC6A 4LG0B 4XR6A 5AONA 1ZLKA 1MW7A 2JT1A 1REPC 2B0LA 2VKEA 5A78A 4UB6C 4UVAA 2R7SA 3HSEA 3MQ0A 2W8LA 2UWMA 3P9IA 2ELHA 4MV3A 5DYMA 5HDNA 3HL2A 2K9SA 4CO8A 1C30A 1FJGH 2YS7A 5D8KB 2LY9A 1EA3A 1VKZA 4Q45A 4UB8C 4AIJA 4EFEA 3RYRA 2KDOA 3TGNA 4DUYH 4K2EA 5LOVF 1W5TA 3MN2A 4XOPA 4ZZDA 1ZRDA 2X48A 1MJ9A 3PUFA 3HHHA 5T14A 1BBYA 3IRRA 5KFJA 4A3LJ 4X66H 4PSWA 3UNGC 3FZVA 1H0MA 2XC9A 4XIDA 1IBMH 3DLAA 5ICEA 3WE3A 2R5ZA 1X1PA 3I4NJ 1DIKA 4DV1H 2J6UA 4XORA 1I27A 3T1HH 5JUMA 2NU6B 4ECUA 2RQPA 4LOCA 1X4PA 1DGRM 5CVRA 1ZD7A 1E4EA 1ZKGA 4A3MJ 1SFOA 1X58A 5HDKA 2OUMA 1KJ9A 5A77A 3FWEA 4AIDA 1ZN2A 2FU4A 4HF2A 2Z1DA 1WJEA 3BDDA 3S3NA 2QOJZ 2VQEH 3T5HA 3HOWG 2NU7B 3X2QH 1JUMA 3N44B 2HYGD 4DNCA 4E7HA 4E70A 2CMPA 4A3GG 3DKYA 1QA6A 3H0DA 2EA2A 4OAYA 3J7AK 3HKZE 1SD7A 2FOKA 3KHRA 4DV2H 3TEDA 4WXHA 2RDIA 3PNYA 1MH4A 3OSGA 1G59A 3FXUA 1W4MA 3G71I 3E5XA 2AGOA 1UAAA 2XGEA 4X62H 2FSWA 2W25A 4RGRA 2R93G 5KFIA 4CZZA 2X1CA 2VJ5A 3NEUA 2XPWA 1LWTA 5E63A 3TIIA 2KFDA 1EH8A 4M6VA 1PX2A 3RTRA 3WHBA 4AM3A 1SMYF 3S2HJ 4PJMA 3MD2A 3RAXA 1T94A 1ZRFA 4F91B 1VI0A 2KIQA 3GBGA 4E7LA 3H5NA 1T6SA 4FX4A 4N9HA 1AF5A 1MD0A 2CKZB 4MAMA 3M4OJ 3Q5FA 3OUUA 3H5RA 1GHCA 2R8IA 2C2RA 3G8CA 4A3CG 4AU7A 4Z1XA 5TRDA 2D45A 3H0GJ 2FJ1A 1BR1A 3N05A 2O8KA 4RGXA 2OZUA 5E1WA 4FS1A 3OTOH 4U7DA 2ME0A 2CRGA 1ZQ3P 2NOJB 1JI8A 3G2BA 2IA6A 2NVXA 3K1MA 4EV0A 4UCUA 2GZWA 3REOA 2YZMA 2R7DA 1TC3C 2EZIA 4FASD 4EVIA 2W9BB 1FKAH 3OYNA 4CCLA 3R5FA 1QZEA 2DA6A 2E34A 2FB9A 5C1PA 2VL8A 5L1KA 3WTXC 4UN9G 2JUGA 3EUKL 2GXGA 3ZMSA 1NTCA 4YRVA 4JI8H 3ASOH 3K10A 3CTAA 4XLNF 4B48A 4DV5H 2EK5A 3SQNA 1J7KA 4PGGA 1YW8A 2WDTA 4BYYA 1IDYA 5F64A 3K7AJ 3JRIA 5JQWA 1CS0A 2PQ8A 3LP8A 2XGQA 4Y15A 1SYXB 4EFBA 3H40A 4KUMA 2Q0OA 4V19K 1J59A 3S93A 2ESHA 2TDXA 1LB2A 2QWWA 3IN5A 4ED3A 4E6KG 1FP2A 3E3VA 1W93A 4HQMA 4DLKA 4KZSA 1VZ0A 2BV6A 1ZELA 4ZTFA 2VBNA 3B73A 4E4HA 3HOTA 4TUYF 3GW2A 3S16J 1YW9A 1DGWY 1IUFA 3T1BA 3V7CA 1BJTA 2AQFA 1JKPC 3NAUA 4HQ6A 4XOTA 2V9KA 4AAFA 2LNBA 1KONA 1X1DA 3P7NA 5J1YA 1ACIA 2IN9A 5E5SA 2R7VA 3HSFA 1G9YA 4A2BA 4AQUA 1X3WB 2MH2A 2EFNA 1TQPA 2O3FA 5D5XB 2XROA 2VQGA 2JMWA 1KU7A 1T9IA 1T0FA 2F5CA 4BS9A 4G9YA 2R7RA 1G3WA 4XLHA 5CVIA 4A69C 1RK5A 3UQ8A 1RYRA 4ZHQF 2K9QA 1BJAA 2F2EA 3MAJA 5DUKA 2W24A 1YJ9I 2BQUA 2WY7Q 1R1TA 1M7JA 4O6JA 4A3GJ 1MMSA 4GCVA 4Q48A 1I3AA 2X6OA 4MV9A 2QQBA 3BQZA 1W36D 1N25A 5CAEB 5KG6A 2R5ZB 3PUBA 2K7LA 2VS8A 4DL6A 4JV5H 1AWCA 2ZC2A 4LD5A 3TOBA 1D5YA 3F8CA 1EJ9A 2QGUA 2FBHA 1RNLA 3PJRA 4JP0A 5ILSA 2JA7G 2R93J 4IHXA 2DBBA 2E7WA 2CFXA 3E7LA 4YITA 2UVWA 2F4OB 1E4EB 5M3FJ 2JWTA 3COAC 1S68A 1ZQ7A 3CVZA 2ZXJA 4RAGA 4BE2A 4JI4H 3OMYA 3IWZA 2KDZA 4ZYDA 5C4JJ 2X6WA 1T33A 4ED7A 4ED6A 3SDGA 5ICFA 1OLTA 5KFDA 3JAMW 1JKRC 4I0BA 9ANTA 2ECCA 4LF4H 1R6RA 2O03A 5TJJA 1U9NA 5I47A 2PMZE 4OIQF 5IP9G 5F0CA 1POGA 1A35A 5L1JA 2ZJTA 2GXBA 1IRZA 5FLXW 3K2AA 3ZOBA 4XX0B 3D1NI 1OQYA 3P9CA 3VFZA 1YTYA 3S32A 1QNTA 3VEPA 2A07F 4A3CJ 2I80A 4MFDA 3BJYA 4IX7A 5AK9A 1BA5A 1Y1VG 2XV4S 1E0EA 5J1RA 4KT6A 1ZDEA 3JRXA 5KFPA 4F4XA 3N6XA 3U2RA 2CWEA 4XRFA 1V5EA 3IAS2 3MZ8A 1MJBA 3C0FB 3JRDA 1KQ9A 5KG1A 1FX7A 1QQIA 2K3PA 1Q1VA 2OF7A 4DR2H 4FETA 4Q47A 3RKXA 2DCHX 1S8NA 1YRNA 1T3NA 1BI0A 2JVGA 2IS2A 1IW7F 1U8RA 3C0XA 3SI8A 2BY1A 4EEFG 3JCUC 4P55A 3IRQA 4X1EA 2W6PA 4BQNA 3DPTA 3H36A 4D9JA 4HQEA 4LGWA 5H6QA 3BWGA 5E1XA 1HKQA 1Z2OX 5KFQA 3KP6A 3H3VH 1K1QA 4F92B 3MKWB 2QM3A 1EYZA 5IP6A 1JDBB 3Q8QB 4XL9A 4JX4A 3TDZC 3OYDA 1RR8C 4BE0A 4XN0A 2LREA 2RKHA 1ULYA 3KZIC 3ZRGA 4I7HA 1ZLJA 4LH7A 4RBOA 2J6SA 5KT4A 1YIOA 3MFKA 3BC8A 3OUZA 4TQRA 3HPHA 4QLCU 1GLVA 1LDDA 5FLMG 3K4BA 2V1NA 4A3FG 2X51A 3LFUA 3QZ7A 3RB4A 2DFHA 5CQEA 4ENKA 3PQJA 4QTRA 2WB1E 2GOXB 4KN7X 2M1BA 2R4GA 1X3ZB 1YYVA 4IPAA 2Q1ZB 4FBTA 4U6PA 3LOCA 3I4MG 2EIMH 4UN8G 4I76A 3OHAA 4ZTJA 4JI2H 3N41B 2EB7A 2MCTA 3H4DA 2DPIA 4EMSA 1ZHQA 1ORKA 3T5KA 3HJEA 3WODF 2VPQA 3E6DA 1AA7A 5B3SH 1H8AC 2BVMA 2BY0A 2CSOA 2E35A 4IXAA 1N77A 2P0AA 2K86A 3E6CC 2LCJA 3I55I 1FC3A 4HRIA 5DS9A 2VBNB 2KJCA 1IC8A 1O57A 2F4VH 1Y0NA 1KU9A 2G7HA 2A5WA 2O7OA 2F4LA 3EUHC 1RZ4A 5LRRA 4ZDOA 3R7PA 1XDUA 2HVQA 2JA7J 2A61A 1X1BA 1ZTRA 2G9WA 3A03A 3WGHA 5FKNA 2CH0A 4AVPA 3L2WA 2JEGA 3IH4A 2JSPA 2LTPA 5EG0A 5K5OA 2NNYA 3V8KA 4F52A 2ZMEA 2ZNYA 3V7RA 3OYBA 4XYMB 3BTCA 3CMYA 3CCEI 4B44A 4KT5C 2E2JJ 2EZLA 3MX9A 1P8KZ 4B09A 4GO1A 1USSA 3KEOA 3LA2A 4ZYEA 3C2GA 5IP9J 1PYVA 1B59A 3LSMA 1I50A 2DPJA 2DIKA 2M5WA 3ZN1A 5HLIA 4TV8F 3PSIA 1ENHA 4TV9F 1D0ZA 2L2OA 4UV9A 3LMLA 5KT2A 4EYHB 3KEQA 1Y1VJ 1NG7A 2CS3A 2XCAA 2YX4A 1N48A 1JGGA 3QP5A 4HLYA 1PDNC 2OV7A 5HODA 1R36A 1IN8A 2IJLA 2P0WA 5BQTA 5DQIA 2FLNA 5KFYA 3HKZN 1BIBA 2ZJ2A 1OCTC 4P1WA 2LDUA 2FPPB 2R8HA 3F22A 4UNBA 3S1RJ 3KPHA 1DQUA 3PFIA 3QPTA 3QWLA 2Y0SN 3FHNA 4XRMA 4I98B 2I8DA 3Q0WA 1ZR4A 1XC5A 2EIKH 2FRHA 4MV1A 3FXJA 4RB3C 3RB3A 1N34H 2NYXA 4CC6A 3SJMA 1XX5A 1SCUB 1MGTA 2W85A 1QPIA 4YBZB 2WAEA 4A3EG 1OYYA 3ZQQA 3DTEA 4RU9A 1P2FA 1TWFJ 2XSJC 3HYJA 1T36A 4A3DJ 2JMZA 2L3DA 3S15J 2DT7B 4LX3A 4WD3A 1AKHA 4O3OA 1MZBA 2E1OA 1N78A 3H1CA 2PEXA 3GZNB 2NVYJ 3DV8A 4B4CA 2A69F 4DYCA 3HB9A 1I39A 3J7ZI 1LQ1A 3AYHB 4EYIB 2LH9A 4MNUA 4A6EA 1YRNB 3FKIG 3U1KA 2M34A 1A04A 5FLMJ 3RIRA 2HGCA 1J5YA 1FP1D 4RNOA 3QYBA 1J0RA 2R7QA 4A3FJ 1S3JA 4BJTA 3EYYA 3JAMK 2YW2A 4MEXF 1B8IA 3FBIB 1B24A 4AIHA 2R7WA 1S9FA 3KIOA 3QZ8A 3MWEA 3KO2A 1KGSA 4KIBA 4A93J 4B3AA 3DBHB 3I4MJ 1KC7A 2MC3A 3WGIA 5E67A 2CV1A 3ECOA 3CJNA 4KA4A 2R3SA 3K5IA 5DG7A 2BZTA 2XIGA 2DPUA 4IRCA 2KIMA 1X1CA 4L5JA 3AKZA 4I55F 2XPVA 3WTVC 1WWXA 5KKNB 3DPUA 1V4YA 1HA8A 4J9OA 5C5JA 2L7FP 4Y52J 3JW4A 5F1JA 1V54H 4LF8H 3T1YH 2KZGA 4R1HA 4ON0A 2L4AA 4IOCF 3DEEA 1I7LA 1BC7C 3L2PA 2P7VB 2ISZA 1OCOH 2JA6G 1G3YA 4OU0A 2B63A 1XCVA 2FPIB 4KL5A 2D1VA 5JLXA 4Q43A 4HDVA 1R4NB 3QPHA 2ME6A 2YZGA 2VJIA 2Y31A 3I56I 2VUMG 2KLOA 2KT0A 3G1MA 1SD6A 4BL0B 1KQ0A 1QRYA 4IZOA 4ZOLF 1A9XA 4MFEA 1D0XA 3NGDA 1IRXA 2EA4A 4GRIA 5IYDJ 3KETA 2BW3A 2A05A 2CQXA 1TLHB 3OYJA 1VQMI 2GAUA 2RF4A 1MH3A 3TW7A 1X19A 2Z16A 3E1SA 2LF8A 3HUGA 4EBEA 1S0MA 2M2EA 4ECZA 4I09A 5CJ9A 3WG7H 4KNYA 3W6KB 1N56A 3D5RC 1G6NA 4U7BA 3HSRA 1DP3A 3W6JB 3MXAA 4R8HA 4EGYA 1ZARA 2DTZA 1KU3A 1XMKA 4HPQA 3PW7A 3GIKA 5EG0B 3V4GA 2OTLI 1F1ZA 3F6VA 4PFPA 4IEJA 4M9XA 3OYAA 1T95A 1T98A 3CP2A 4PZJA 1PUFA 2ZMEB 1T08B 1OR7A 4KJZA 3S17J 2CW0F 5CQGA 4IF4A 1NH3A 3ETHA 4BY1G 3M9OB 4F55A 3OS0A 2HNHA 1AM2A 3TQNA 4FBUA 5LFAA 3V6HA 2OA4A 1SFUA 2VPRA 4LF7H 1WR2A 4UN7A 2F5VA 3VYSB 2Y2ZA 4WXDA 1LVAA 4AVZA 5J47A 1F5TA 2IT0A 1T9JA 4A3EJ 5HV6A 4B3RH 3RV3A 1WH5A 3M9NB 2XDVA 1K78A 4ED0A 3SHFA 4JI7H 2PMZN 2B9SA 2JEJA 2GOMA 1K83J 4RNNA 3ERMA 1OR7C 3OOLA 5A2QK 3SFZA 2PN1A 1F9NA 1ZREA 4YY3H 3PSFA 1O3QA 2DCEA 5HS8A 3I64A 2VIXA 4Y17A 3FKIJ 1ZAOA 1SVOA 2ADUA 3OL4A 5CVJA 2GPSA 4FX0A 4G6TB 3VYRB 3K3PA 2BQ3A 2LY1A 3LA7A 2PG4A 5GAHJ 4LQ0A 4LITA 4Q44A 2C22A 3Q3SA 3KHHA 2K9LA 3EYIA 3CCMI 2RNGA 3KP2A 1DP7P 1QZYA 4UNAA 4PJJA 2V58A 3JTHA 3I71A 2XHKA 2DTRA 2R7UA 1BI3A 1FMVA 2DYSH 3OV8A 2FPGB 1WPKA 2EZKA 5DG9A 3RB6A 2WC2A 3TQTA 4IRIA 2VC1A 1AKHB 3HOSA 4J9QA 3K4KA 4EGZA 4OOIA 2FX0A 3FXOA 1S5LC 4AAEA 4JV2A 1DGSA 1ETYA 5EDNA 3BA8A 1OYWA 1IO2A 2DI3A 3M9AA 2MFZA 3GV8B 4M6YA 1G4DA 4EM1A 4IR9A 3ML6A 4D7NA 1UM2A 4WWCA 3OYHA 3OS2A 4AC0A 3A01A 1E17A 3HYIA 1B8IB 2UUAH 2NVTJ 2JA6J 3AAFA 2KP6A 1ZGWA 3GTJA 1VQ6I 2ZDGA 4JI1H 1RRJA 1R22A 2VUMJ 2IS6A 3RPUD 3RCOA 1K1SA 2FMYA 3ABUA 1K4TA 1U0DA 1DFAA 2QKMB 5AIPA 1L0OC 2DW4A 4FM9A 1HW1A 3JTGA 1X2NA 2L7MP 4XK4A 3TO6A 5C1OA 2DFIA 3ZMVA 5E17F 5F0FA 2WTFA 2QK4A 1TT0A 3Q1KA 2XF5A 3VB2A 2P4WA 1FLIA 2DJIA 2LF7A 2Q2EA 3OR1C 1MNEA 1G3SA 1OCPA 1FBSA 3GCMA 3KLNA 4A0ZA 4GYGA 3FM5A 1EUCB 4LFBH 2Y9YA 2JQ7A 3HOXG 1VQLI 3UR3C 3H92A 2HS5A 3WGGA 3FXRA 2C35B 4RUAA 2COBA 2VKDA 5F08A 3ZR8X 1UC8A 5IYZF 2VA3A 2BW3B 4XLEA 5D1PA 4JX5A 2W8KA 3MWMA 4RZRA 4G7HF 4CDGA 5CKTA 1STZA 3CF2A 1Z7LA 2ZB9A 3HUGB 4F93B 2LD5A 5EWGA 5EYRA 2VBWA 5CA1F 3S14J 2H8RA 2HDCA 4AIKA 4UCOA 5F9NA 3EETA 1D5VA 3ZQLA 5IY5H 1YS6A 2O5RA 1XD7A 2ZSHB 4N4OB 1ON1A 4PDKA 4X0GA 1ZHSA 3BR2A 3LSTA 4P9FA 1GO3E 5B5EC 2LP0A 4BQOA 3I53A 2W57A 1SC7A 3Q0VA 1PUFB 1SANA 3ZGKA 3S1NJ 1GGOA 2YUSA 2C28A 2XC7A 4Q8EA 5L1LA 1P4XA 3CO6C 3BQ1A 4NQWA 3ZQ7A 4LK1F 2EIJH 4II2A 5DEQA 3M7GA 2E1MB 2FMAA 4DIQA 4YELA 1GXPA 2AXTC 4IHTA 2MABA 5IYBG 5EGOA 3H9GA 3OOPA 2L9NA 2MSYA 2QVOA 2RN7A 3R0AA 5KK1A 2E19A 4CCJA 3J81Z 3K1NA 1IF1A 4I4TF 2UVVA 2ELKA 2DOEA 3ZQIA 3VWBA 1U0CA 1K78B 2DQRA 2D5VA 1Y8RB 3U9TA 3GTQA 3VMMA 2XAJA 2VT3A 4YIFA 1DPUA 3CLQA 2E36A 2E5LH 3I0TA 1YE9A 3HG9A 2FBIA 3DEUA 1B72A 3IG0A 5H20A 4BDZA 2EV0A 2RGRA 1M0TA 3V7SA 1V51A 2F4IA 2Z9OA 4IHYA 1VNDA 3BJAA 4DV0H 1ETWA 2JVHA 1VQ5I 4U88A 4WXCA 4O2AF 2UUCH 4YFKF 1CGPA 1IXCA 1UMQA 1GSHA 3I58A 4KL6A 2DK5A 2HVSA 1TWAJ 4J00A 3MFHA 1FYKA 4XRSG 2JEFA 2VBZA 4BY7G 1B9MA 2HZTA 3T8TA 2UVRA 2ZCWA 3CC2I 1RKWA 2PMUA 2I3PA 5BMZA 4UVCA 3GTPJ 4YR2A 2YPRA 4RB2C 4M3BA 3R60A 3G4SI 1PUEE 1EF4A 5EDWA 3A1YA 2CW7A 3CMAI 2XGPA 4BHCA 5HOOA 3ZXSA 2FF4A 5E3NA 3BA9A 1YJNI 3D5SC 2R8JA 2RV8A 3H0GA 5K1YA 3ZMTA 4CSWA 2GM4A 4EEYA 1ZHFA 2X0LA 3BPXA 5LA6F 4RMNA 2DFFA 2M8GX 3KYDB 4IHSA 5DV5A 1YX3A 4UFZA 3A01B 5EZGA 2FK3A 1UNNC 1VF9A 4EJVA 3BOQA 1CQJB 4CHUA 1EH7A 1D1CA 2BXZA 2MLKA 4IWYA 5JHFA 2KIFA 4KITB 4HYKA 3QOEA 3HOYG 1HCRA 2R7NA 4OWRB 4GIGA 4O5VA 3GLLA 2M0MA 1UHWA 3PNTA 5LYJF 1X2MA 1Z3XA 2Z99A 4ZZLA 2P5LC 4XLPF 2R7TA 1Z67A 3C7JA 5LGUA 3JSPA 5E3OA 3E6MA 4HLXA 5CYVA 2GA2A 2HYJA 3BR0A 4PJLA 1XGMA 2CUEA 4BUPA 2A5YB 1OMIA 3N40P 2IRFG 1FSEA 5DLGA 3C18A 2GIZA 3KFWX 4TV7A 1Z21A 3W2AA 2Q2EB 1IV8A 4KIFA 4RM3A 1HC8A 4Z20A 3E54A 1BNCA 4QJFA 4BBRG 4GC6A 4P96A 2F6CA 4RNMA 2R7LA 1XDSA 3LSKA 4O1SA 3TO9A 2LK2A 5CA0F 3CP8A 1D3YA 3W2VA 1GDTA 3J80W 2FD5A 3DXJF 2QA4I 3WU1B 3F8MA 4F4WA 4BXUA 1JKJB 3SEQA 2UXCH 4ECWA 1P6RA 3H3VK 3GIJA 5C44G 4X6AJ 2VQLA 4E7ZA 4O3QA 5J1UA 1DUXC 3SZPA 2QSGX 1MI8A 1L3LA 3ZMDA 5LEJA 1EKEA 4OX9H 1DU0A 4XRSA 3I5UA 4J19A 2IBKA 3JRFA 5IYBJ 4MIMA 3VPBA 4OZ6A 2L01A 1HSJA 3UKGA 1H88C 3RGZA 3I12A 5KFGA 3PNVA 3VPRA 1W0UA 3F6OA 3OYMA 4E7IA 3FKJA 2YRWA 2R6FA 5LLQA 5E20A 2V6EA 3LSHA 4YJ3F 1U9OA 3GTOJ 3V6KA 2NUAB 4CYCA 3BCAA 5M5WJ 2YS9A 5KAFC 5BR8H 4HNTA 4ZYHA 4ZDPA 4ZC3A 3VSLA 5LGNA 4NHJA 4J9MA 3PVXA 4MEYF 3RV4A 5D1OA 2KIUA 1N3EA 1GV5A 4NQWB 3HXLA 4XLFA 3RQIA 2CV2A 4TQSA 2R93A 5LP6F 2RC4A 4H4KC 1MNMC 2QQ9A 3GVAA 4C5CA 1AUVA 5BPIA 1JUPA 5EGOB 2VLAA 4KDPA 1S97A 4BY7J 2LKXA 4ZJZA 1ZRCA 1LEBA 3RKYA 5HLTA 4J9KA 1OISA 3L09A 1NK3P 4M3EA 3WO0A 3HRMA 1N75A 2F5DA 3HOWJ 2DA7A 4YAJB 1MNDA 1O3TA 1V55H 1GT0C 3EPGA 1B72B 1IAWA 1U3EM 5DM7F 1UFMA 1APLC 2A6TA 3BG3A 3Q8PB 2VJJA 2XCLA 1BIAA 3GZ5A 5D4RA 2M05A 4UVBA 2HTJA 2HQ5A 4Z1ZA 4P9UA 1J9IA 4AYBE 3KAKA 3R5XA 3SZGA 1WH2A 3SZTA 2VE8A 3DLLF 4A5NA 2OCEA 3P5JA 1BW5A 4WF2A 1FIAA 3KHGA 3CCUI 3QQYA 3R23A 5L9XA 3DF8A 4HV6A 3J7AO 4EG0A 1ETVA 1T0FC 2DO7A 3S2DJ 4FU0A 3F8NA 5J6XA 2L8LA 1LNWA 3M07A 5KG5A 4EBCA 3HOYJ 3D0SA 3GTLJ 1HR0H 4UN9A 5HDGA 3ZMZA 1IBKH 1WJ5A 3OIPA 2WY8Q 1YS7A 1PP7U 4ZQIA 4WX9A 2I3QA 3HEFA 1S0NA 4IRKA 4JOMA 4BXFA 2VBJA 5K7HA 1AUXA 3HGYA 3QU3A 2LMDA 5L3EA 1Z9CA 2P5VA 4LF5H 2L9SA 5HLHA 3PW5A 1HQCA 2KQRA 5JLWA 1Y56A 4BBRJ 2VB6A 1S7AA 2BXYA 2ACJA 1A5JA 2R84A 1B9NA 1YQAA 4DR4H 1SFEA 1UG2A 3LSIA 3M4IA 4J9PA 5D5VB 2EBIA 1N32H 1KJQA 4U0VA 2WAFA 5KNLA 1TWGJ 1S03G 3Q0UA 3RB0A 1FJLA 2A6HF 5C44J 3N42B 3PO2G 4E7SA 2EV6A 2PBZA 3MR3A 3GIMA 4LF9H 4B43A 1BM9A 2HPMA 2YR2A 1ZG5A 4B3TH 1FPQA 3FBNB 3M8JA 4AUXA 5TGTA 1Z91A 2OD5A 3M1EA 2VPSA 1XCBA 5HS9A 3OS1A 1SFXA 5A72A 1H89C 4QWEA 2K4BA 4CCOA 2LBFA 1BW6A 2JZYA 1O3RA 1GPPA 3EPIA 5KFMA 1OCCH 1XGNA 5B1BH 1TW2A 3BT9A 4EM2A 2H09A 2LKPA 4C3JJ 3RGXA 2VBLB 3ZCOA 1XB4A 2V9VA 1ETXA 2DT6A 1F36A 5KCMA 2W6QA 1K6YA 1W1WE 5IWAH 5TISC 5ED4A 2VE9A 1GVDA 4MA0A 5BPHA 3KYCB 1SVMA 2QKLB 5E18F 2X1EA 1HOMA 4YR3A 4LLGF 5H80A 4ENNA 4R8UA 4JI3H 2LC2A 5EEAA 1TAEA 2XASA 4ZH4F 2HXOA 5KFAA 5DTDA 2XUBA 1FBQA 1W7PD 1Z6TA 3IAM2 2JA7A 1S72I 3FK6A 3TQ1A 3G6VA 4WBNF 3OYCA 3HKZA 4EJOA 5GTIC 3QPLA 4Q0YA 4UCVA 5ICGA 3N4MA 2E1CA 4HEA2 3H4BA 3CESA 2WYOA 3DF7A 3JZIA 3ZQGA 3BTJA 3M8FA 3MXBA 2O6GE 3R4KA 2Q2TA 2Y0SA 1JE8A 1WZ2A 4BJ5C 3RJPA 3F0CA 2OU2A 2V1DA 3WTYC 5KT3A 2W71A 1NG6A 3A4CA 5GP9A 4R79A 1TWCJ 5KT5A 1WSCA 4MV4A 2VBOA 4CYCB 4DV6H 2V4JC 5DCFA 1KJJA 1ONVA 3BCBA 4BH9A 3SXYA 2C6YA 4ESFA 1VQ4I 3FMQA 3K6GA 2GPWA 2WAQE 5D1OB 4O4IF 2NVQJ 4XBFA 1SEIA 1IZ1A 1Y1VA 3GWZA 2RDJA 5AKNA 2EH3A 1VS0A 5LD2C 3KX2A 3CLOA 1WQ2A 2X4HA 1WJAA 2FOWA 1WRJA 4IRGA 3S1MJ 2IP2A 2VT2A 4AD9A 4YHXA 4OIOF 2F5FA 4K0KH 4G7OF 4XLCA 4HV5A 1E3PA 5BMVF 2PN6A 3LL7A 5J8CA 1A31A 2QSHX 2P81A 4EQQA 2JRTA 3KAJA 3CCSI 2CGPA 3A0HC 5DUIA 3IC7A 4D5FA 5A74A 4RDUA 3K3VA 4Q8FA 1JX4A 2MD5A 4BDYA 2FK2A 3GV5B 4QIWE 3KZYA 3FMSA 2DAOA 2PX9A 3IH2A 1DU6A 1I94H 2YRXA 4Z2YA 1K6OA 3K70D 4A6DA 1FSHA 1O3SA 4HSRA 1TWFA 3ETJA 5JVLA 5KFFA 3RUPA 1WCMG 1QPMA 3RBDA 3FK7A 4MHGA 2UXBH 4LOXA 2MW8A 3IFJA 3QOPA 3R5HA 1K79A 2NVYA 1HSTA 1RETA 3BG9A 5DD4A 1HKSA 2ZMEC 1JKQC 4ME6A 5IP7G 4O3MA 1JKOC 3K4NA 3RYPA 1VQ7I 5L3FA 2LSOA 3J80Z 1OCZH 4B3SH 4CXFA 3BQYA 4KHPH 2ZO4A 4GGGA 4J9RA 1BR2A 2VBXA 1T2KA 2N8GA 1KJ8A 2VBJB 2HFHA 5FO5A 4C2MJ 3EQLF 1Z6RA 5J4YA 2R7MA 2B7EA 2E5ZA 1WJCA 2HTSA 1XSDA 2GIVA 2W6OA 2FNAA 4GDFA 4UN8A 4E2UA 1EUDB 1FZPB 3TL4X 2C2EA 1PVEA 2BE5F 1LVKA 3CUQA 1USTA 3U9GA 3G3ZA 3QAHA 3HOVG 1RI7A 4IAJA 4DL2A 5EF6A 1HKTA 3O6BB 2KKOA 1IN4A 5KG0A 4L9VA 3MWDA 2YS6A 5E3MA 1P4AA 4ED2A 4B3MH 5D4SA 3UVFA 4XSXF 2W4SA 2VOBA 2CZGA 4IHJF 4DL3A 4JYAH 1MBJA 3CJQB 4A0YA 3OORA 1ZK8A 3IKTA 3S1QJ 1AT0A 4QW8A 5DGBA 4MV6A 2H6CA 3J81W 5EEGA 3ORRA 3F8BA 1TTYA 1MBFA 2LBFB 5L3BA 3E5UA 4ANJA 5IT9Z 1KYWA 3FDYA 3JRHA 2LVSA 2HOEA 4LLNA 5FLXK 2AU0A 4UUTA 4OIPF 5F1RA 2ECBA 4XMYA 4UNCA 2DDAA 1WKMA 2OCCH 2H94A 1G3TA 1LFBA 2DLNA 2WADA 4HX4A 5KFEA 2V7FA 3ABKH 2FKLA 2AS5F 3OIQA 4L0ZB 3WO1A 2R7OA 4HW0A 5KFZA 4R8UB 5KFBA 1TP4A 1FOXA 3HZJA 3ERED 2M8EA 4C5AA 5LRSA 1SD5A 2K5CA 5FKKA 4A12A 4BXXG 3L2RA 2PMZA 4MA5A 1MMGA 4HF1A 1DQ3A 4O3NA 3QP6A 3OYKA 3L9FA 4JV1A 2NNNA 2H6BA 4XKWA 5E5OA 1B04A 5LL6b 1W96A 3MXBB 3E5QA 2UXXA 4KISA 2DODA 3MKYB 1JTYA 4BACA 2V1UA 4J9LA 2K4JA 3ZQCA 2OJED 3DBLB 3K2ZA 3RZDJ 2XAQA 1E2XA 3BTIA 3PQKA 3PL8A 2NVUB 2H27A 2X6YA 4XKCA 3OHBA 2VBOB 2QEXI 1BN5A 1MMNA 3GTGJ 5EOYA 2E2HJ 1A0IA 1XMAA 1PJRA 2IAIA 4MQ9F 3BY6A 4N9IA 4F4YA 4GYIA 5A0WA 2JJ7A 4BEHA 2HQAA 2VQHA 2X85A 2D1HA 2VXDA 4XYLB 2Y75A 3PN1A 4Y7NJ 2NXNB 4A3BG 2M7BA 3DWLE 2FJZA 5E8IA 5IPAA 2CYYA 1WCMJ 3WE2A 3WTTC 2STWA 1LWSA 4YG2F 3P9KA 5HNFA 4GLXA 3J7AY 1K83A 3ZN0A 2XGDA 2ID3A 1U5TA 2XE0A 4ECTA 2FQ3A 4Y4RA 2JN6A 2QQAA 4I6ZA 4DZPA 3DPLC 1IRGA 2EJRA 3RPQA 2EX5A 1P7JA 1R5GA 3MZYA 3FKIA 4A0XA 5IP7J 4J9SA 1N33H 3K1PA 1QGPA 2QYOA 1MSEC 4IQ4A 4QSHA 4G8XA 4M6XA 5CB4F 5LBQA 3OYIA 1XMXA 4ENMA 3ORQA 4L0YB 3MZHA 4DL5A 1OYIA 2IS4A 4JX6A 2FUG2 1M5XA 2L9RA 3CZ6A 3SFIA 4HNVA 3WU0A 3BROA 4JBAA 2KRCA 3NWTA 5FD6A 3SYTA 1YFHA 2WB1A 4JK1X 5KT7A 2ZNZA 2EILH 2BEOA 3HOVJ 4C2UA 2WA0A 3ZQHA 4D5CA 5LHIA 1N36H 3N97A 1WGXA 4PCQA 5K5QA 3HRSA 3IGDA 2ATLA 2Q2UA 2JA8G 2HQNA 3KEYA 3SDBA 3GTMJ 2QLZA 4RB1A 1CE8A 2V5AA 3HM5A 4O4LF 3HOZG 1I3QJ 1WFXA 2CQYA 2E1MC 2VN2A 5K2MA 5FGMA 4D6OA 3T5JA 2JA6A 2P6TA 1IBLH 4MTDA 2ASDA 1WI9A 4XKVA 5KFTA 4L9JA 2VUMA 2ASLA 2KRHA 3JSOA 3K4JA 4MGRA 3RFCA 3CUQB 4FCYA 3IWFA 1VQOI 2DMQA 3OR2C 4GFBA 1OKRA 2MH9A 3B02A 3BQ0A 1Z7UA 1L2ZA 1Z2NX 2OLSA 1VBGA 4RUCA 3KP5A 1OJLA 4IVNA 1FIPA 4EJWA 3K4CA 1TQMA 1UZCA 3LFKA 3CDIA 3PIOF 3KHLA 3IHUA 2AHQA 2R7ZG 1ETQA 4U87A 5FJ8G 1YO5C 3H3UA 2OQGA 1TA8A 2OAZA 2IMZA 1D0YA 4HF0A 3PW4A 4OAZA 1X1AA 1V9PA 1UCRA 4BXXJ 2FQ4A 3C2HA 4II3A 5F6FA 4EJUA 5JVGF 1QVUA 2CU7A 2IVMA 2LRDA 5EJCA 5DQHA 2YYAA 3L7WA 1GYFA 1JIHA 4G3IA 3G6XA 1UG0A 2YZNA 3IUOA 5FRNA 2DMNA 2OC6A 4CC5A 1YG2A 1Y1WG 4X65H 4FT8A 2VJ4A 4G6DA 2IA1A 1YW7A 5BPDA 2UVUA 5DDGA 1SAUA 3BPVA 4YEJA 3DU6A 2D2WA 3NARA 3RBEA 3DBRB 2JA5G 3DKWA 1VAJA 2TCTA 1ETKA 3DCFA 3JREA 1KJIA 3MJFA 4ECSA 1T56A 2WB1N 5BPFA 1TL8A 3I4NG 1LEAA 2ZXWH 2W48A 2EQRA 4I02A 3T5XA 3GTKJ 1X9NA 1Y8QB 3RQ4A 1FYLA 2CV0A 2ELJA 2M4KA 4M74A 4RLFA 2HKOA 4C5BA 4DL7A 1JVAA 4A3BJ 3QODA 4M73A 3B6CA 2HI3A 2HGSA 2R0QC 2ZJPF 1GXQA 3BQ2A 1MKMA 5K5RA 4UT0A 1U0JA 3CF5F 4YIIA 2O8XA 1BOAA 4OMYA 2XPUA 1GV2A 4LH6A 1G9ZA 5A2QZ 5KFUA 2XAFA 1JJ8C 3CMMA 4EM0B 2FEZA 2XCPA 2JA2A 4NC8A 3V8JA 2DJNA 5D8DA 4UCTA 2XAHA 4PJ0C 4BY1J 1RR7A 1W5SA 3V4ZA 4DZJA 3FMRA 3LMMA 3OYFA 3TINA 3EPZA 2H1LA 1FYMA 1I1SA 3MR6A 2ASJA 2Z33A 5FROA 3JRBA 3VPCA 4BEHB 2DPDA 2RQQA 3CC4I 1TW3A 4QWDA 5D5UB 3TDUC 2R92G 3V4SA 5K7FA 2ZFWA 1LFUP 2V26A 4B47A 1RUOA 2K85A 2XRNA 2RDPA 4LFUA 3DFGA 3RI4A 1BL0A 3L2VA 3KALA 4G94A 4AADA 1MIJA 2LYCA 3QYEA 2L7ZA 1M6VA 2DA5A 5H2FC 1UJ8A 1S10A 4BQQA 1U5TB 1TQIA 4BAYA 2PBIA 2XE0B 3FMAA 4QWCA 2Q8KA 3BR6A 3GQCA 2JA8J 3N8DA 1MDMA 4LMYA 4LLLA 4XM3A 3PR4A 5KG7A 2K02A 1B33N 2R7KA 3GFLA 2EFWA 1LDKB 1MBGA 3HOZJ 2KISA 1YHQI 1EHIA 2BYVE 1J2XA 3PZPA 1QBJA 3U9SA 4EGJA 1TWAA 2HPIA 4LF6H 5ILVA 3QFFA 2FA5A 4A3JG 2M45A 2EFOA 2YU9J 2DFEA 4ABZA 1H9GA 2XKPA 4ZI7F 3ASNH 4BU2A 4XKBA 3GTPA 2BY2A 4PFOA 2WBMA 2OQRA 4HBLA 2W7PA 2QQ8A 1K61A 3L4JA 5H6RA 2VODA 3O8GA 1FT9A 1Z3YA 4KIGA 3AG4H 2F48A 2KMUA 2NOGA 2R5YA 1JXLA 3K5HA 1ZH5A 4CCMA 3WHCA 2R7ZJ 1IOVA 3T5LA 4WK8F 5LHHA 3NQOA 5JVDF 2F4MB 1IUYA 1E3HA 1TNSA 4UXNA 5FKOA 1EV7A 1UELB 1Z0XA 4C3IJ 4ZYAA 1B6SA 2I10A 1DV2A 4ECQA 1AN7A 4V2GA 1XNQH 1B1BA 3BZ6A 3PIPF 3FISA 5M5YJ 3M3YJ 2AGQA 2VR1A 1JGSA 5EWEA 4DR3H 4DYRA 5L1IA 1Y1WJ 3ABLH 3TP0A 2V9WA 4XQFA 4DV3H 1ON2A 5E1ZB 4EGQA 5KFRA 1S0OA 5FD5A 4M9SA 3G73A 4RAFA 3M9MB 1LUJB 1V4RA 2K3FA 4IJAA 2W7NA 2JA5J 3CUOA 1Y39A 2ZSIB 1VFCA 4I2OA 2LFBA 5FB2A 4B1RA 3QQAA 2R92A 4KICA 1BI2A 1KYZA 2J6TA 1MBEA 3FIWA 5KVRA 1M1EB 3K4LA 5KFNA 2R7XA 2JPCA 2XSDC 3LSJA 4MTEA 5ILUA 2E2IA 1ODDA 3FXQA 4HAMA 1R00A 4PSXA 3CDHA 2L5QA 1UB9A 1IXRC 2EPFA 3RJ0A 4YQWA 3VPDA 5FRMA 1Z1DA 1EH6A 3ISPA 3HOXJ 4NNJA 5C4XG 1FOYA 4L5EA 1KQ8A 2ID6A 3GFJA 2P6SA 5FLVA 1JUSA 3L4KA 4G12A 3OY9A 3BR1A 1KEEA 4GKJH 4M9ZA 2FBKA 2IXSA 1V3FA 1ZETA 2MG4A 2ZBKA 2VPLA 2DDBA 3BZKA 3BAAA 4IWXA 3BP8A 2Y0SE 3BLYA 1ZGJA 5IOZA 2EFQA 1WJDA 2R92J 4O3RA 2IN8A 4PUSA 3CCVI 4A3IG 1KZHA 3M8EA 5LHGA 1N3FA 3RPUA 3CQZA 1Z2PX 2QYZA 2IBDA 2E2IJ 3DTIA 3L1PA 2VONA 2VBLA 3PW2A 3GTOA 3F72A 4XZ3B 3TBIA 1HF0A 2E7XA 1SFOJ 4DGWB 4S05A 3OSPA 2ICWG 1S7EA 3CCQI 2P5KA 4EFJA 5KFSA 1SVLA 2HXIA 1CF7A 4E7JA 2GA1A 4MQVA 4JI6H 1DV1A 3VDXA 1BOBA 4IKFA 4F50A 2V4RA 1QHHD 2FE3A 2HDDA 2IGOA 2DOAA 2L9VA 3E6BA 2W6NA 3NRVA 2KHMA 4QFQA 1A6IA 2QZ8A 3GX4X 3E97A 4A3JJ 3C0WA 4KMUX 4W1UA 1CQIB 2GBYA 1D1AA 3AG3H 5EZYF 2OBPA 2WTEA 4JI5H 1IN7A 4PK4A 2HR3A 3WTZA 2M9HA 4IZZA 5KAIC 3CQZJ 5J3LA 2QUFA 1I6HJ 3CCLI 1MDMB 1Y0UA 4JQFA 3RF2A 4X64H 3GLXA 4ITVA 3MR2A 2CQNA 3LSGA 4PJNA 3HOUG 3LWFA 2L4MA 3I59A 1XDNA 4JV0A 2JSCA 3F9KA 4HX8A 5C8YF 2V9PA 4IOAF 3SE7A 4XSZF 1UC9A 5IT9W 1R1VA 5KX5F 5JHUA 1RESA 4D7MA 1G8XA 1C3OA 3GILA 3R61A 1U78A 2O7MA 1O75A 3VOEA 1HW5A 3V8LA 1K4SA 3GTLA 2DA2A 2XB5A 4C9YA 4ETSA 5DCMA 4O4HF 2KPMA 4DQ2A 4UUSA 5DQGA 1RKTA 1RJPA 5GAGJ 3Q9VA 2NVXJ 2VXZA 3MCZA 2HQRA 2R5YB 4UV8A 2R85A 1R9TA 5HNHA 4H0EA 4MLOA 4XN3A 3G1LA 3Q8SB 3KTMA 4DR1H 2ZM6H 2C2DA 2UV1A 1XMOH 4RAYA 3ELKA 3SEZA 1HNZH 4PDBA 3S2WA 1HBXG 2RVCA 1JJ6C 3HTSB 2DA4A 2PLYA 5L3DA 2LG4A 2EV5A 4E4TA 2LWYA 3LSPA 3T8RA 4IR1A 1I1GA 1IN5A 2CFOA 3BG6A 2DK8A 1T8IA 1P7IA 4KFCA 3ULQB 3B6AA 4NDLA 4S04A 2MC4A 3FX3A 4D0PA 1MBKA 1TWGA 3J7YJ 3MISA 3HIFA 4UCRA 4YP3A 3TP3A 2I5UA 5C4XJ 2XAUA 4D6NA 4FHTA 5DGAA 4HZFA 1S6LA 4HA8A 4IRDA 3WU2C 5GAEJ 1CQTA 2ZJRF 4F3QA 3AL0C 4O1RA 3FF5A 2L0KA 3LWBA 1R9TJ 5J2TF 4XONA 1FWZA 3GFMA 3S3MA 3DTKA 5IOYA 4S0HB 5B66C 5KFHA 2F5EA 1FY7A 4A3IJ 3HRUA 1QVTA 1SD4A 5JR3A 4ECYA 1XTAA 2G0EA 5JVTA 3KYLA 2XF6A 4PGHA 3MVPA 3V42A 2I87A 3Q8RB 3GXOA 3KP7A 4FE7A 5FPRA 3FDSA 1WJBA 1S7OA 2X6XA 3OOUA 1ITYA 2QSFX 5KT6A 4YR0A 3TOAA 1B6RA 4YHHH 1K7AA 3FD2A 1R23A 5K7ZA 2VOPA 3IH3A 2FNPA 1MSFC 4HNUA 1JXSA 4CYDA 4ZYGA 2LY2A 3JRAA 3BJ6A 5GPCA 2I8CA 3E5NA 4ESJA 3MKLA 1MMDA 5CVUA 2Y48A 3HHGA 4A5MA 3NZMA 3H35A 4JUZA 4RB0A 4RM2A 2STTA 3IKVA 4AABA 4GKKH 2BHYA 2AGPA 2WWYA 2VQDA 1W5CC 2C00A 1TWCA 4M9UA 2DMUA 1MMAA 1XSVA 1YI2I 2DZDA 3E0JB 2OWOA 4CUGA 3FXMA 3VYUB 4FQGA 1P92A 4AQXA 4ESBA 4BHBA 1RUNA 3KXYT 5LGTA 2GWRA 3HDDA 3RAQA 5ERIA 2GLTA 1SAXA 1F4KA 1CF7B 3BR3A 2HHHH 2ZDQA 3HOUJ 1QU3A 2VA2A 3GUDA 4LB5A 1MOWA 3I4PA 4I99C 4YJ2F 3BJOA 3GMEA 4N4NB 4LB6B 4Q5SF 2OPTA 1Z77A 2HEOA 3ABTA 2X9DA 1E4GT 2VQCA 2CUZA 3CCJI 1P8LA 1XSXA 5M5XJ 2ETHA 1AHDP 1FVIA 4N0BA 2FLPA 2RAEA 2YU3A 4U0WA 1B4AA 4ECVA 4DV4H 4A3DG 3OIOA 1F43A 4QWBA 4DBRA 4ED8A 1X4OA 4NC7A 3I54A 2EFPA 1B6AA 2DA1A 1S29A 2CJJA 2QF7A 3WTWC 3G6YA 3OSNA 3WTUC 4FE4A 3AG2H 1ZG1A 2W6MA 4MV8A 2CUJA 1H9TA 1BI1A 3BG7A 1VDEA 3AFHA 4JI0H 3GIQA 5M3MJ 5F27A 3J80K 5J8FA 2NRAC 1RJQA 3I59B 3OL3A 3EUHA 2PJRA 5E79C 3CD6I 1XMQH 2BR0A 5A0MA 3PFYA 3UFXB 3PR5B 3EUAA 4Y33A 2VOOA 2FP4B 2JEIA 4A93G 1AU7A 2FK1A 5F04A 2GLOA 4P5OA 1VQKI 1ULZA 1VBHA 3S8PA 4GC7A 1HXDA 3A02A 4CCKA 4Q4ZF 2HOTA 3ABMH 4NB5A 1SMTA 1JT0A 5DCMB 1LFPA 2OH2A 1QHGA 1WH7A 1ZGAA 4M3FA 3H5AA 4UUSB 1LKXA 3CCRI 3RTXA 3RIZA 1LJ9A 2O9LA 1A36A 1LE8A 4QPQA 3ZPLA 1VQNI 1ZYRF 5LMUH 4Y13A 2VS7A 2P8TA 4C2MA 1A6QA 2O61A 3AL0B 5KG3A 1HNWH 2Y30A 2HOAA 3O3KA 2ZJQF 2HU9A 2QBYA 1JLLB 5LXTF 2R87A 4HX7A 2EWNA 3MR5A 3TMOA 4C30A 3TKYA 1R58A 2ZKZA 2XGXA 1QO0D 2PJPA 2HZDA 2IGNA 3ESWB 4L18B 5FKLA 3HBLA 3GF2A 5A2QW 1OCRH 5CPRB 3JSLA 2NAZA 2XB0X 5IT9K 2IW5A 1R7MA 2IA0A 5I0AA 5B1AH 2CQQA 2VKVA 2ALZA 5IYDG 4AQYH 1U8BA 2K27A 1R5ID 4UUVA 4MV7A 3CJRB 3PO2J 1OPCA 2M7AA 3ZMUA 4HOBA 2W00A 4LSAA 1FTTA 3KP4A 3DKXA 3W6VA 5CLSA 3VYTB 3KZZA 1X3UA 3DEWA 2J5PA 3H20A 3BTLA 4G7ZF 5IYCG 1GVJA 1E3OC 1EF0A 5KFLA 2NS8A 1IRFA 1J09A 1IJWC 2NS7A 3JRCA 2KL4A 1TBXA 5LEKA 3NWSA 3GTQJ 3GIDA 4D1QA 4ASNA 3QRFF 2B63G 4OINF 5E3LA
chains in the Genus database with same CATH topology
4DOZA 4RB2C 2WE6A 1XNRH 1OLTA 3VSKA 3A1YA 2CW7A 4BE1A 3JAMW 3K4CA 3W3CA 5K08A 1W36C 4LF4H 1R6RA 2O03A 4U87A 4CA0A 3ZXSA 5HOOA 1WJFA 4HG2A 3BA9A 1TA8A 2X1DA 2ZJTA 3D5SC 4HSTA 2IMZA 1D0YA 5FLXW 4OAZA 4DJAA 4CSWA 1X1AA 1V9PA 3S32A 3C2HA 5KHDA 1ERDA 4RMNA 4IX7A 4II3A 2LRDA 3I9V2 5AK9A 1YX3A 4DBQA 4UFZA 1E0EA 1GYFA 3L2QA 4KT6A 2AQEA 1ZDEA 1UG0A 3IUOA 5FRNA 2OC6A 4CC5A 3N6XA 4AYBA 1D1CA 1V5EA 3IAS2 4X65H 5JHFA 3DU5A 3C0FB 4KITB 2VJ4A 3QOEA 4CZCA 4OWRB 4GIGA 2K3PA 1SAUA 4YEJA 2M0MA 3PNTA 3OYEA 4DR2H 3DU6A 1Z3XA 2M4GA 4FETA 2DCHX 2R7TA 2JVGA 2IS2A 3C0XA 4UCSA 2ZXIA 4PJLA 4BUPA 1X9NA 3RQ4A 3N40P 2CV0A 2ELJA 1FMWA 2M4KA 2RREA 4RLFA 5HVQC 4NXMH 1JVAA 4BQNA 3DPTA 1Z21A 3QODA 2Q2EB 4RM3A 4D9JA 4EATA 3W2AA 1V5GA 4IQJA 4Z20A 4UN7G 3E54A 2HGSA 4DR5H 2F6CA 1HNXH 3LSKA 4O1SA 4UT0A 1Z2OX 1U0JA 3CP8A 3W2VA 2M3AA 4F92B 3MKWB 3J80W 4XL9A 3OYDA 1G9ZA 4LH6A 4ZDLA 3SEQA 2UXCH 3CMMA 4BE0A 4XN0A 2JA2A 2LREA 4NC8A 2E5NA 4Y3OA 3BABA 2VQLA 4J0MA 3ZRGA 2IGMA 4I7HA 4E7ZA 4LH7A 4DR6H 3OYFA 3LMMA 3BC8A 4CCNA 3EPZA 1MI8A 3HPHA 4OX9H 5FROA 3IP4B 4BEHB 3K4BA 2V1NA 2X51A 2YCHA 4LIUA 2RQQA 3LFUA 2PJRB 3T1HH 3D5LA 5CQEA 3OWTA 5A0MB 2GOXB 2V26A 2CW8A 2LOOA 4B47A 2R4GA 4OZ6A 4YISA 1BP7A 2KZVA 2MYSA 2Q1ZB 2VQFH 3RGZA 3L2VA 4UN8G 3KALA 4AADA 3PNVA 2LYCA 3OYMA 3QYEA 4ZTJA 4E7IA 3N41B 2MCTA 4JI2H 3FKJA 5LMNH 2BVLA 1ZHQA 5AKMA 3MIPA 2RGVA 4BQQA 3OYLA 4DUZH 2DXIA 2V6EA 1AA7A 2XE0B 3LSHA 3FMAA 2BVMA 1N77A 3BCAA 2LCJA 4LMYA 5BR8H 4XM3A 4HNTA 2IGKA 1TZLA 4ZDPA 4ZC3A 3VSLA 1LDKB 2VKHA 4HRIA 5D1OA 2IS1A 1N3EA 4NQWB 4XLFA 3HXLA 2VBNB 2CV2A 2F4VH 1M0WA 4B3XA 2A5WA 2HPIA 4H4KC 3EUHC 4LF6H 2VASA 2UUZA 4ZDOA 3R7PA 3H9JA 3I3LA 4EEQA 2HVQA 1X1BA 2VLAA 2CH0A 3L2WA 4BU2A 2ZFUA 4XKBA 4ZJZA 4PFOA 4AAGA 2JSPA 2WBMA 5HLTA 3L4JA 4F52A 2FLDA 4DR7H 3OYBA 1N75A 1Z3YA 4B44A 2KMUA 3MX9A 1P8KZ 1MNDA 4CCMA 4DV7H 3MMYB 3C2GA 1PYVA 2UU9H 1P9QC 3LSMA 2A6TA 2Z2SB 2XF7A 2VJJA 1UELB 3DQVC 2KSWA 4M7EA 4ZYAA 3PSIA 1D0ZA 2L2OA 3LMLA 4Z1ZA 4NXNH 2WAQA 3U21A 3KAKA 3SZGA 1WH2A 1V5FA 1NG7A 1AN7A 1XNQH 2CS3A 3QYFA 3QQYA 4R7RA 4RLQA 2OV7A 4DR3H 1T0FC 2P0WA 3F8NA 2L8LA 4XQFA 4DV3H 1HR0H 4UN9A 4P1WA 1IBKH 1WJ5A 5FD5A 4UNBA 3OIPA 1YX5A 2WY8Q 1DQUA 2I3QA 4XLAA 3FHNA 2W7NA 2ZSIB 2JNQA 2I8DA 3K70C 4JOMA 4BXFA 2VBJA 3N43B 2KEQA 3K4LA 2E60A 2R7XA 3RSNA 4RB3C 1N34H 1S9HA 4MTEA 4CC6A 4LF5H 2L9SA 4PSXA 2WAEA 2L5QA 2KQRA 1Y56A 4LIVA 2VB6A 3ZQQA 3RJ0A 3DTEA 4XNFA 2XSJC 3HYJA 5FRMA 4DR4H 3LSIA 3M4IA 2JMZA 3W2WA 1N32H 4NNJA 2DT7B 2WAFA 5KNLA 2MD0A 1S03G 3L4KA 1N78A 1MZBA 3N42B 2W1OA 3OY9A 4E7SA 4GKJH 4LF9H 1XMOH 2IXSA 4B43A 2LH9A 2HPMA 3A2KA 4PDBA 2VPLA 1SFKA 1Y6IA 4B3TH 3EH8A 3M8JA 3FBNB 3QYBA 5TGTA 2R7QA 2VPSA 3BAAA 3OS1A 3BLYA 4BJTA 5A72A 3EYYA 4RAZA 1WJDA 2BOLA 4CCOA 2LBFA 3FBIB 4PUSA 2R7WA 1GPPA 2IN8A 1B24A 4BWSC 1N3FA 2UXDH 3KO2A 2W82A 3MKZA 1Z2PX 3RGXA 2VBLB 3DTIA 3ZCOA 2VBLA 5E67A 2CV1A 2DT6A 5KCMA 3TBIA 3K4MA 1K6YA 1BR4A 2XIGA 4DGWB 5IWAH 4LFAH 2K9MA 2QKLB 1X1CA 2X1EA 4EFJA 4JI3H 3AKZA 2LC2A 1TAEA 1GLNA 4E7JA 4NUBA 4JI6H 3M1CA 3DPUA 3VDXA 1BOBA 4IKFA 2VUGA 1HA8A 3IAM2 1QHHD 1Z2NX 2FE3A 2IGOA 2DOAA 3OYGA 4A2AA 3OYCA 3HKZA 2KHMA 4UCVA 4Q0YA 3T1YH 4LF8H 3C0WA 3L2PA 4HEA2 3DEEA 3CESA 1J5EH 1D1AA 2WYOA 3DF7A 3MXBA 4LG3A 5AKFA 4JI5H 2Q2TA 4KL5A 2Y0SA 4PK4A 4BJ5C 4RZQA 2VJIA 2HDWA 1NG6A 4IZZA 3A4CA 3ONQA 2KLOA 4R79A 2ZXHA 4BL0B 3JSNA 4E2TA 1D0XA 4QPOA 1IRXA 4GRIA 2VBOA 4DV6H 4J01A 2V4JC 2HVRA 4JQFA 3BCBA 2BW3A 3H9QA 3OYJA 4E7KA 4ITVA 3RF2A 2AB5A 3LSGA 4PJNA 1X19A 1BGWA 2Z16A 3K6GA 3E1SA 4BJ6C 1XDNA 5D1OB 3F9KA 1SEIA 4APMA 5IT9W 5AKNA 1VS0A 2UUBH 3HPGA 3KX2A 5LD2C 1G8XA 1WJAA 3D5RC 4U7BA 3S3OA 1DP3A 3HC7A 2O7MA 1O75A 3MXAA 4CH7A 4HPQA 4C9YA 4YHXA 4ETSA 4PFPA 4K0KH 2L7KA 4XLCA 3OYAA 1T95A 3CP2A 2KPMA 3LL7A 1E4FT 4KJZA 4C2TA 2VXZA 5CQGA 1D1BA 2IN0A 2LQMA 3KAJA 1I6UA 5HNHA 4MLOA 4XN3A 4F55A 3OS0A 5A74A 3K3VA 2ZM6H 4DR1H 2UV1A 4LSXA 4RAYA 2HNHA 3SEZA 4BGDA 3L2UA 1AM2A 1HNZH 4BDYA 5LFAA 4XR6A 4LF7H 1MW7A 4UN7A 2F5VA 2LG4A 1I94H 3VYSB 5A78A 3K70D 2LWYA 2R7SA 4HSRA 4AVZA 1T9JA 2UWMA 2CFOA 3BG6A 4B3RH 3HL2A 2XDVA 2MC4A 1FJGH 1EA3A 3MISA 4JI7H 4UCRA 4EFEA 2UXBH 4LOXA 3IFJA 2KDOA 4DUYH 2XAUA 4D6NA 4XOPA 2GOMA 1OR7C 3OOLA 3K4NA 4YY3H 4KHPH 4B3SH 3PSFA 2DCEA 4X66H 4PSWA 2VIXA 3UNGC 4F3QA 3AL0C 1BR2A 4O1RA 1IBMH 3DLAA 3OL4A 2VBJB 4G6TB 3VYRB 4DV1H 4XORA 4XONA 2LY1A 3S3MA 3DTKA 4LQ0A 4LITA 2E5ZA 1WJCA 2K9LA 4UN8A 4E2UA 1X4PA 1DGRM 2RNGA 3TL4X 4UNAA 4PJJA 1ZD7A 1LVKA 3KYLA 2XF6A 3V42A 2R7UA 1FMVA 2OUMA 5A77A 5FPRA 2Z1DA 1WJEA 3S3NA 2QOJZ 2VQEH 4IAJA 1WJBA 2X6XA 3OOUA 3HOSA 3N44B 3K4KA 4E7HA 4B3MH 2CMPA 3UVFA 4YHHH 2W4SA 3FD2A 3DKYA 2VOBA 3H0DA 4OAYA 3J7AK 4AAEA 4JYAH 4HNUA 3CJQB 3OORA 1DGSA 4DV2H 2LY2A 3BA8A 1AT0A 2MFZA 3PNYA 1G59A 3J81W 1UM2A 1MMDA 1UAAA 3OYHA 3OS2A 4X62H 3HYIA 2UUAH 3NZMA 2X1CA 3H35A 2LBFB 2VJ5A 4RB0A 4RM2A 4ANJA 4AABA 2KP6A 3FDYA 4GKKH 5E63A 1LWTA 4JI1H 1MMAA 4XMYA 4UNCA 2IS6A 3E0JB 3RTRA 3RPUD 3RCOA 2OWOA 2WADA 4CUGA 4PJMA 3MD2A 3VYUB 2V7FA 1DFAA 4AQXA 1U0DA 2QKMB 3OIQA 3KXYT 4F91B 2R7OA 3GBGA 3H5NA 4E7LA 4FM9A 1AF5A 2HHHH 1QU3A 2K5CA 3H5RA 1MOWA 3L2RA 1TT0A 2PMZA 2XF5A 4N4NB 4AU7A 4Z1XA 1MMGA 2DJIA 3OR1C 1DQ3A 4X64H 1BR1A 3OYKA 1MNEA 3N05A 1E4GT 2VQCA 2CUZA 4XKWA 1B04A 5E5OA 1P8LA 3OTOH 5LL6b 3MXBB 2NOJB 1FVIA 1JI8A 4KISA 4LFBH 3MKYB 4DV4H 4BACA 3G2BA 3UR3C 4DBRA 1X4OA 4NC7A 4UCUA 4FASD 3PL8A 1FKAH 2VKDA 3OYNA 4CCLA 2X6YA 4XKCA 2VBOB 3ZR8X 1MMNA 2CUJA 2VL8A 3BG7A 2BW3B 3AFHA 4XLEA 1VDEA 1PJRA 4UN9G 2JUGA 1A0IA 5D1PA 3EUKL 3MWMA 4JI0H 4YRVA 4JI8H 5A0WA 5CKTA 2HQAA 3K10A 4BEHA 3CF2A 2VQHA 3OL3A 2X85A 1Z7LA 3HUGB 2PJRA 4F93B 2VXDA 1XMQH 3PN1A 4B48A 2M7BA 3DWLE 5A0MA 4UCOA 3PFYA 4DV5H 2WDTA 3EUAA 4Y33A 2O5RA 2ZSHB 4N4OB 1LWSA 4P5OA 3S8PA 5HNFA 4X0GA 4GLXA 3J7AY 4CCKA 1ZHSA 1SYXB 4EFBA 4BQOA 2XE0A 3S93A 1LFPA 4Y4RA 5FPOA 1QHGA 2EX5A 3DPLC 2W57A 3H5AA 3RTXA 1LKXA 4E6KG 3ZGKA 3RIZA 1N33H 5LMUH 4QPQA 2XC7A 2VS7A 1VZ0A 1ZELA 4ZTFA 2VBNA 4IQ4A 4E4HA 4II2A 3HOTA 3AL0B 1HNWH 2E1MB 3OYIA 1DGWY 2HU9A 1BJTA 4DIQA 2AQFA 4YELA 4XOTA 2V9KA 4AAFA 1KONA 1X1DA 3TMOA 2MABA 2IS4A 4C30A 2IN9A 2R7VA 2FUG2 5E5SA 1G9YA 1M5XA 4A2BA 2HZDA 2IGNA 3CZ6A 3H9GA 4AQUA 5A2QW 2L9NA 5CPRB 4UCTA 3JSLA 2VQGA 1T9IA 4CCJA 2R7RA 4BS9A 2KRCA 3NWTA 4XLHA 3SYTA 3VWBA 2WB1A 1U0CA 5FD6A 3UQ8A 1R7MA 5I0AA 4C2UA 2WA0A 4LFCH 1N36H 2WY7Q 3IGDA 4AQYH 2Q2UA 2E5LH 3KEYA 4MV7A 3CJRB 1YE9A 3HG9A 3IG0A 3SDBA 2M7AA 4BDZA 4RB1A 2RGRA 2W00A 1M0TA 4MV9A 4LSAA 2F4IA 1W36D 3DKXA 1WFXA 3VYTB 2E1MC 4DV0H 2JVHA 3PUBA 5EOYA 4D6OA 2VS8A 2UUCH 4JV5H 3H20A 3PJRA 1IBLH 4KL6A 4MTDA 2HVSA 4J00A 4XKVA 1EF0A 4YITA 2KRHA 1J09A 3K4JA 1S68A 3CVZA 2KL4A 4BE2A 2I3PA 3OR2C 3NWSA 4JI4H 4D1QA 3OMYA 1L2ZA 2X6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQX A;  1U0D A;  1DFA A;  4E2T A;  2CW7 A;  2VBO A;  5K08 A;  3MX9 A;  1P8K Z;  2AB5 A;  1AF5 A;  2IMZ A;  1MOW A;  5AKN A;  4Z1X A;  1DQ3 A;  4Z1Z A;  5AK9 A;  1ZDE A;  5E5O A;  2O7M A;  3QQY A;  3MXB B;  3MXA A;  4YHX A;  2L8L A;  4GIG A;  4UN9 A;  4UNB A;  2VBO B;  2IN0 A;  2I3Q A;  2LQM A;  2DCH X;  1VDE A;  4UN9 G;  5A74 A;  2JNQ A;  2VBJ A;  1AM2 A;  3C0X A;  5A0W A;  2KEQ A;  4UN7 A;  5A78 A;  1JVA A;  2LWY A;  5A0M A;  1T9J A;  4Z20 A;  4UN7 G;  3E54 A;  4O1S A;  1LWS A;  4UT0 A;  3HYJ A;  3MIS A;  2JMZ A;  4LOX A;  3IFJ A;  1G9Z A;  2XE0 A;  4D6N A;  2EX5 A;  3OOL A;  2VS7 A;  1MI8 A;  4O1R A;  2VBN A;  3EH8 A;  2VBJ B;  4LQ0 A;  4AAF A;  5A72 A;  5E5S A;  2IN9 A;  1G9Y A;  4UN8 A;  1GPP A;  2IN8 A;  4E2U A;  1B24 A;  2CW8 A;  5A0M B;  4AQU A;  1M5X A;  4UNA A;  4OZ6 A;  4YIS A;  1N3F A;  1ZD7 A;  3KO2 A;  1BP7 A;  1T9I A;  4UN8 G;  2VBL A;  2VBL B;  4AAD A;  5E67 A;  5A77 A;  1U0C A;  1R7M A;  5I0A A;  2QOJ Z;  5AKM A;  3MIP A;  2XE0 B;  3IGD A;  2LCJ A;  4EFJ A;  3UVF A;  3FD2 A;  4AAE A;  3OOR A;  1N3E A;  2VBN B;  1AT0 A;  4D6O A;  2VS8 A;  1UM2 A;  3R7P A;  4KL6 A;  3C0W A;  3HYI A;  3NZM A;  1EF0 A;  4YIT A;  4AAB A;  3MXB A;  5AKF A;  5E63 A;  1LWT A;  4AAG A;  4KL5 A;  2I3P A;  4UNC A;  2FLD A; 
#chains in the Genus database with same CATH topology
 4DOZ A;  4DL4 A;  2WE6 A;  5HLG A;  1XNR H;  1IGN A;  3VSK A;  3C3W A;  4BBS G;  1I7N A;  4BE1 A;  4IHW A;  5K08 A;  2LLK A;  3W3C A;  5BOX A;  1W36 C;  1IXS B;  1XGS A;  4CA0 A;  1WJF A;  4HG2 A;  2X1D A;  2XGC A;  4HST A;  3A0B C;  4I0A A;  2EZH A;  1JTX A;  4DJA A;  5JH7 F;  2XAG A;  3DP7 A;  1MJA A;  1BJZ A;  1RYS A;  5KHD A;  1ERD A;  2YL2 A;  2JUC A;  5GTH C;  4RS8 A;  5EZH A;  1DPR A;  2DU9 A;  1GSO A;  3I9V 2;  1I50 J;  4NBQ A;  4DBQ A;  2EIN H;  3L2Q A;  2AQE A;  3GLK A;  1U6G A;  1OFC X;  4JYK A;  5FKM A;  2JTV A;  3GZ6 A;  3CUQ C;  1Z05 A;  2A3S A;  1P4W A;  4RGU A;  5E8G A;  1GUU A;  4AYB A;  1IOW A;  4YAK B;  3DU5 A;  3RKW A;  1I6X A;  4CZC A;  1G2H A;  3GTG A;  1YIJ I;  2CQK A;  5JI6 A;  2E2H A;  3O8H A;  1YLF A;  3LNQ A;  1RK6 A;  4L9N A;  3OYE A;  2M4G A;  2WV1 A;  1O7L A;  2ISY A;  2W84 A;  2QEN A;  2FML A;  4IL6 C;  1ZR2 A;  3JRG A;  4UCS A;  2R7F A;  3ZQF A;  2ZXI A;  4GXO A;  2PVP A;  4EBD A;  3LA3 A;  4KN4 X;  2Z5U A;  3FXL A;  1FMW A;  2RRE A;  4YFN F;  5HVQ C;  1WCM A;  4NXM H;  5DG8 A;  2KRF A;  4EAT A;  5FPO A;  3H3Z A;  4DR5 H;  4OMZ A;  1HNX H;  1V5G A;  2CO5 A;  5FFX A;  4IQJ A;  2DA3 A;  4UN7 G;  3FM3 A;  5DLF A;  5KFV A;  3F23 A;  4I01 A;  2DYR H;  2M3A A;  3KP3 A;  3ROU A;  5DM6 F;  3IL2 A;  4UNO A;  3RZO J;  4J9N A;  3CCY A;  2K40 A;  1XN7 A;  5HBR B;  4ZDL A;  4OIR F;  1HLV A;  4Z6Y A;  5KFK A;  2DOF A;  1RJR A;  2E5N A;  4Y3O A;  1IDZ A;  2A68 F;  3BAB A;  4J0M A;  1W7P A;  2IGM A;  5EEH A;  1NHA A;  4DR6 H;  2COM A;  3BR5 A;  4CCN A;  1BXR A;  1RPW A;  3GFI A;  2E71 A;  3IP4 B;  4AWX B;  2YCH A;  4LIU A;  2PJR B;  2M87 A;  2HYF A;  2XKO A;  3LQR A;  3D5L A;  2L02 A;  2YSR A;  1GSA A;  4ECX A;  1LPQ A;  1C0W A;  3OWT A;  1VQP I;  5A0M B;  2CW8 A;  2LOO A;  5J2U F;  2NS0 A;  2KJB A;  3WTS C;  4YIS A;  1BP7 A;  2KZV A;  5JFR A;  2MYS A;  2VQF H;  1Q1H A;  3ZP5 A;  2R8K A;  1PP8 F;  2R82 A;  2V4Q A;  1VQ9 I;  2V6C A;  5LMN H;  2BVL A;  2IEK A;  4L5I A;  2RGV A;  3TO7 A;  3L00 A;  2DMT A;  3OYL A;  3RKQ A;  2OTJ I;  2DXI A;  1UHS A;  5AKM A;  3TIG A;  4DUZ H;  2Y9Z A;  3GTM A;  3WG9 A;  2PFB A;  3TW6 A;  1R4M B;  1FNN A;  1I3Q A;  2IGK A;  3VOD A;  1MBH A;  1TZL A;  2DWC A;  1LE8 B;  2QCO A;  2VKH A;  3K0L A;  4W97 A;  4A2U A;  2BY3 A;  4AYB N;  5D8L B;  3CO7 C;  1YIT I;  3JAM Z;  2UZK A;  2IS1 A;  1TWH A;  1M0W A;  4B3X A;  2WV0 A;  5L3G A;  2QBY B;  6PAX A;  4QWA A;  2VAS A;  5CVV A;  2UUZ A;  3Q9S A;  4QW9 A;  5IYC J;  2R8G A;  3H9J A;  5FLX Z;  3I3L A;  2ESN A;  4FTH A;  5KFX A;  1KA8 A;  4EEQ A;  2W9C A;  2GXA A;  3CDL A;  5KG2 A;  1IN6 A;  2OZ6 A;  2ZFU A;  2R86 A;  4AAG A;  4HYE A;  4CIC A;  2DN0 A;  5AIQ A;  4HR7 A;  2A6E F;  1VTN C;  1W0T A;  2YX7 A;  1U5T C;  2PI0 A;  2K9N A;  2B63 J;  2FLD A;  1Y14 B;  2V59 A;  4DR7 H;  3PO3 G;  4BBS J;  2TRT A;  3MEX A;  4XIC A;  2J5O A;  4B8X A;  5BS6 A;  1YOV B;  4DV7 H;  1XPX A;  3GII A;  3T0Y A;  3PM1 A;  1WI3 A;  2HKX A;  4IHV A;  3MMY B;  3U1D A;  4LG0 A;  5GAD J;  1D8K A;  1P9Q C;  2UU9 H;  1FOW A;  2AXL A;  2Z2S B;  2XF7 A;  4ECR A;  2BGC A;  3DQV C;  3JR9 A;  2KSW A;  2W6Z A;  5HS7 A;  4M7E A;  2DT5 A;  4A3K G;  4YFX F;  2NU8 B;  4ED1 A;  2G7U A;  1NK2 P;  1R71 A;  4NXN H;  2WAQ A;  3U21 A;  5F9L A;  1V5F A;  1TWH J;  1WSU A;  4BNC A;  1RC9 A;  5D5W B;  3QYF A;  1R1U A;  5C3E G;  3V6J A;  4R7R A;  4RLQ A;  3AG1 H;  2E1N A;  2IPQ X;  1ETO A;  4YIR X;  1J75 A;  4G6Q A;  4BQA A;  4O3S A;  3WNZ A;  3MFI A;  5BNG A;  2V1X A;  4M3D A;  5D6F A;  1YX5 A;  2DQL A;  3GTK A;  1T38 A;  4XLA A;  4F4Z A;  3F21 A;  3QPS A;  4UHT A;  4IO9 F;  1HDD C;  4RA2 A;  4IRH A;  2JNQ A;  2NU9 B;  3K70 C;  4BKX A;  1HDP A;  4UY8 I;  3KLO A;  1JDE A;  3N43 B;  2KEQ A;  1JHH A;  5GON F;  5D6E A;  2E60 A;  2ZDH A;  4O3P A;  3RSN A;  3JRW A;  2IA2 A;  4RGS A;  1S9H A;  2HWV A;  4WCG A;  2VI6 A;  5L3C A;  3KCC A;  2H8W A;  4LIV A;  4QIW A;  3FHZ A;  2M0C A;  4XNF A;  5FFZ A;  2LR8 A;  1BC8 C;  3OSF A;  2CG4 A;  4C3H J;  1R49 A;  1KU2 A;  3W2W A;  2W70 A;  2MBF A;  4M72 A;  3R0J A;  2MD0 A;  4FIS A;  3G6E I;  3CJT B;  1FTZ A;  1O4X A;  1RIO H;  5ICC A;  4L9T A;  3L2C A;  1SEU A;  1IV6 A;  4PWQ A;  2W1O A;  4KMF A;  2HOS A;  2JPB A;  4M3G A;  2Z3Y A;  4ENJ A;  4A3L G;  1XGO A;  2J9G A;  4Y8V B;  2AQ4 A;  3A2K A;  3GIP A;  1KBL A;  1SFK A;  1Y6I A;  2JK3 A;  3EH8 A;  3Q2O A;  2H1K A;  2PMH A;  3K9T A;  2BHZ A;  3ECH A;  4RAZ A;  2V79 A;  2BOL A;  2DMP A;  1FOK A;  3CME I;  4BWS C;  4YB8 B;  2UXD H;  3PW0 A;  3GEZ A;  4BHP A;  2W82 A;  3MKZ A;  3BZC A;  4DW6 A;  4U7C A;  4A3M G;  3MIP A;  1EZ1 A;  2AO9 A;  3HRT A;  1QZZ A;  1OWT A;  1ZG3 A;  4LJZ F;  2SCU B;  3C1D A;  5EWF A;  2GQQ A;  5F0H A;  3K4M A;  3G1O A;  1BR4 A;  3J81 K;  2P7C B;  2VC0 A;  4LFA H;  3F8F A;  2XD4 A;  3HTU A;  2WAQ N;  2K9M A;  2FXA A;  1W7P B;  2O0Y A;  1WVR A;  3GO5 A;  1GLN A;  1D8J A;  4NUB A;  1XG1 A;  5GPA A;  3M1C A;  1T39 A;  2W7O A;  1LDJ A;  1XS9 A;  2VUG A;  3LSR A;  3IV5 A;  1VQ8 I;  2YU9 A;  5DD8 A;  3CC7 I;  3OYG A;  4A2A A;  2Y0M A;  1TT5 B;  2CUF A;  2LKS A;  2MA3 A;  4KYW A;  3BG5 A;  2MGQ A;  5J4V A;  2IP4 A;  1J5E H;  1PK8 A;  4LG3 A;  3HGG A;  5AKF A;  1YJW I;  4FS2 A;  2JRM A;  5KFC A;  5J40 A;  4RZQ A;  1R5H A;  3GYH X;  5KFO A;  2HDW A;  3GTJ J;  1FEX A;  3ONQ A;  2W9B A;  2XRL A;  2ZXH A;  1R7J A;  1HW2 A;  3JSN A;  5KFW A;  2R7Z A;  4E2T A;  2DLL A;  4QPO A;  3PO3 J;  4NLG A;  1WHU A;  4QIW N;  4J01 A;  2HVR A;  4MO7 A;  4E7K A;  3H9Q A;  2W9A A;  4LFC H;  4V2F A;  4EJT A;  2AB5 A;  4HDU A;  1UHM A;  1BGW A;  3LAJ A;  1FBU A;  4BJ6 C;  1DDN A;  2UXN A;  1JHF A;  4QWQ A;  3F3X A;  2M30 A;  4APM A;  3GV7 B;  4I50 F;  1O7F A;  3QU6 A;  2UUB H;  4U0Y A;  4A3K J;  3O2P E;  2VBY A;  3H0G G;  3HPG A;  3EDP A;  3RDI A;  2BBY A;  1JT6 A;  4L1K A;  2HJW A;  2W9C B;  4CGZ A;  1Y1W A;  1IG7 A;  3FXK A;  3S3O A;  2CQ7 A;  2MLG A;  2L54 A;  3HC7 A;  2IMW P;  5C3E J;  4CH7 A;  4LK0 F;  5KG4 A;  2Y69 H;  3KE2 A;  5IT3 A;  1AOY A;  2RNJ A;  4F7Z A;  1TNT A;  2L7K A;  4M71 A;  1I5Z A;  4DYQ A;  2X0S A;  3LQQ A;  3K69 A;  2BQR A;  2JA5 A;  3R6S A;  3LAP A;  4O2B F;  1E4F T;  4C2T A;  1D1B A;  2IN0 A;  2LQM A;  2FLL A;  1I6U A;  1U2W A;  4LSX A;  5FJ8 J;  4BGD A;  3L2U A;  2XVC A;  3C2B A;  4NC6 A;  4LG0 B;  4XR6 A;  5AON A;  1ZLK A;  1MW7 A;  2JT1 A;  1REP C;  2B0L A;  2VKE A;  5A78 A;  4UB6 C;  4UVA A;  2R7S A;  3HSE A;  3MQ0 A;  2W8L A;  2UWM A;  3P9I A;  2ELH A;  4MV3 A;  5DYM A;  5HDN A;  3HL2 A;  2K9S A;  4CO8 A;  1C30 A;  1FJG H;  2YS7 A;  5D8K B;  2LY9 A;  1EA3 A;  1VKZ A;  4Q45 A;  4UB8 C;  4AIJ A;  4EFE A;  3RYR A;  2KDO A;  3TGN A;  4DUY H;  4K2E A;  5LOV F;  1W5T A;  3MN2 A;  4XOP A;  4ZZD A;  1ZRD A;  2X48 A;  1MJ9 A;  3PUF A;  3HHH A;  5T14 A;  1BBY A;  3IRR A;  5KFJ A;  4A3L J;  4X66 H;  4PSW A;  3UNG C;  3FZV A;  1H0M A;  2XC9 A;  4XID A;  1IBM H;  3DLA A;  5ICE A;  3WE3 A;  2R5Z A;  1X1P A;  3I4N J;  1DIK A;  4DV1 H;  2J6U A;  4XOR A;  1I27 A;  3T1H H;  5JUM A;  2NU6 B;  4ECU A;  2RQP A;  4LOC A;  1X4P A;  1DGR M;  5CVR A;  1ZD7 A;  1E4E A;  1ZKG A;  4A3M J;  1SFO A;  1X58 A;  5HDK A;  2OUM A;  1KJ9 A;  5A77 A;  3FWE A;  4AID A;  1ZN2 A;  2FU4 A;  4HF2 A;  2Z1D A;  1WJE A;  3BDD A;  3S3N A;  2QOJ Z;  2VQE H;  3T5H A;  3HOW G;  2NU7 B;  3X2Q H;  1JUM A;  3N44 B;  2HYG D;  4DNC A;  4E7H A;  4E70 A;  2CMP A;  4A3G G;  3DKY A;  1QA6 A;  3H0D A;  2EA2 A;  4OAY A;  3J7A K;  3HKZ E;  1SD7 A;  2FOK A;  3KHR A;  4DV2 H;  3TED A;  4WXH A;  2RDI A;  3PNY A;  1MH4 A;  3OSG A;  1G59 A;  3FXU A;  1W4M A;  3G71 I;  3E5X A;  2AGO A;  1UAA A;  2XGE A;  4X62 H;  2FSW A;  2W25 A;  4RGR A;  2R93 G;  5KFI A;  4CZZ A;  2X1C A;  2VJ5 A;  3NEU A;  2XPW A;  1LWT A;  5E63 A;  3TII A;  2KFD A;  1EH8 A;  4M6V A;  1PX2 A;  3RTR A;  3WHB A;  4AM3 A;  1SMY F;  3S2H J;  4PJM A;  3MD2 A;  3RAX A;  1T94 A;  1ZRF A;  4F91 B;  1VI0 A;  2KIQ A;  3GBG A;  4E7L A;  3H5N A;  1T6S A;  4FX4 A;  4N9H A;  1AF5 A;  1MD0 A;  2CKZ B;  4MAM A;  3M4O J;  3Q5F A;  3OUU A;  3H5R A;  1GHC A;  2R8I A;  2C2R A;  3G8C A;  4A3C G;  4AU7 A;  4Z1X A;  5TRD A;  2D45 A;  3H0G J;  2FJ1 A;  1BR1 A;  3N05 A;  2O8K A;  4RGX A;  2OZU A;  5E1W A;  4FS1 A;  3OTO H;  4U7D A;  2ME0 A;  2CRG A;  1ZQ3 P;  2NOJ B;  1JI8 A;  3G2B A;  2IA6 A;  2NVX A;  3K1M A;  4EV0 A;  4UCU A;  2GZW A;  3REO A;  2YZM A;  2R7D A;  1TC3 C;  2EZI A;  4FAS D;  4EVI A;  2W9B B;  1FKA H;  3OYN A;  4CCL A;  3R5F A;  1QZE A;  2DA6 A;  2E34 A;  2FB9 A;  5C1P A;  2VL8 A;  5L1K A;  3WTX C;  4UN9 G;  2JUG A;  3EUK L;  2GXG A;  3ZMS A;  1NTC A;  4YRV A;  4JI8 H;  3ASO H;  3K10 A;  3CTA A;  4XLN F;  4B48 A;  4DV5 H;  2EK5 A;  3SQN A;  1J7K A;  4PGG A;  1YW8 A;  2WDT A;  4BYY A;  1IDY A;  5F64 A;  3K7A J;  3JRI A;  5JQW A;  1CS0 A;  2PQ8 A;  3LP8 A;  2XGQ A;  4Y15 A;  1SYX B;  4EFB A;  3H40 A;  4KUM A;  2Q0O A;  4V19 K;  1J59 A;  3S93 A;  2ESH A;  2TDX A;  1LB2 A;  2QWW A;  3IN5 A;  4ED3 A;  4E6K G;  1FP2 A;  3E3V A;  1W93 A;  4HQM A;  4DLK A;  4KZS A;  1VZ0 A;  2BV6 A;  1ZEL A;  4ZTF A;  2VBN A;  3B73 A;  4E4H A;  3HOT A;  4TUY F;  3GW2 A;  3S16 J;  1YW9 A;  1DGW Y;  1IUF A;  3T1B A;  3V7C A;  1BJT A;  2AQF A;  1JKP C;  3NAU A;  4HQ6 A;  4XOT A;  2V9K A;  4AAF A;  2LNB A;  1KON A;  1X1D A;  3P7N A;  5J1Y A;  1ACI A;  2IN9 A;  5E5S A;  2R7V A;  3HSF A;  1G9Y A;  4A2B A;  4AQU A;  1X3W B;  2MH2 A;  2EFN A;  1TQP A;  2O3F A;  5D5X B;  2XRO A;  2VQG A;  2JMW A;  1KU7 A;  1T9I A;  1T0F A;  2F5C A;  4BS9 A;  4G9Y A;  2R7R A;  1G3W A;  4XLH A;  5CVI A;  4A69 C;  1RK5 A;  3UQ8 A;  1RYR A;  4ZHQ F;  2K9Q A;  1BJA A;  2F2E A;  3MAJ A;  5DUK A;  2W24 A;  1YJ9 I;  2BQU A;  2WY7 Q;  1R1T A;  1M7J A;  4O6J A;  4A3G J;  1MMS A;  4GCV A;  4Q48 A;  1I3A A;  2X6O A;  4MV9 A;  2QQB A;  3BQZ A;  1W36 D;  1N25 A;  5CAE B;  5KG6 A;  2R5Z B;  3PUB A;  2K7L A;  2VS8 A;  4DL6 A;  4JV5 H;  1AWC A;  2ZC2 A;  4LD5 A;  3TOB A;  1D5Y A;  3F8C A;  1EJ9 A;  2QGU A;  2FBH A;  1RNL A;  3PJR A;  4JP0 A;  5ILS A;  2JA7 G;  2R93 J;  4IHX A;  2DBB A;  2E7W A;  2CFX A;  3E7L A;  4YIT A;  2UVW A;  2F4O B;  1E4E B;  5M3F J;  2JWT A;  3COA C;  1S68 A;  1ZQ7 A;  3CVZ A;  2ZXJ A;  4RAG A;  4BE2 A;  4JI4 H;  3OMY A;  3IWZ A;  2KDZ A;  4ZYD A;  5C4J J;  2X6W A;  1T33 A;  4ED7 A;  4ED6 A;  3SDG A;  5ICF A;  1OLT A;  5KFD A;  3JAM W;  1JKR C;  4I0B A;  9ANT A;  2ECC A;  4LF4 H;  1R6R A;  2O03 A;  5TJJ A;  1U9N A;  5I47 A;  2PMZ E;  4OIQ F;  5IP9 G;  5F0C A;  1POG A;  1A35 A;  5L1J A;  2ZJT A;  2GXB A;  1IRZ A;  5FLX W;  3K2A A;  3ZOB A;  4XX0 B;  3D1N I;  1OQY A;  3P9C A;  3VFZ A;  1YTY A;  3S32 A;  1QNT A;  3VEP A;  2A07 F;  4A3C J;  2I80 A;  4MFD A;  3BJY A;  4IX7 A;  5AK9 A;  1BA5 A;  1Y1V G;  2XV4 S;  1E0E A;  5J1R A;  4KT6 A;  1ZDE A;  3JRX A;  5KFP A;  4F4X A;  3N6X A;  3U2R A;  2CWE A;  4XRF A;  1V5E A;  3IAS 2;  3MZ8 A;  1MJB A;  3C0F B;  3JRD A;  1KQ9 A;  5KG1 A;  1FX7 A;  1QQI A;  2K3P A;  1Q1V A;  2OF7 A;  4DR2 H;  4FET A;  4Q47 A;  3RKX A;  2DCH X;  1S8N A;  1YRN A;  1T3N A;  1BI0 A;  2JVG A;  2IS2 A;  1IW7 F;  1U8R A;  3C0X A;  3SI8 A;  2BY1 A;  4EEF G;  3JCU C;  4P55 A;  3IRQ A;  4X1E A;  2W6P A;  4BQN A;  3DPT A;  3H36 A;  4D9J A;  4HQE A;  4LGW A;  5H6Q A;  3BWG A;  5E1X A;  1HKQ A;  1Z2O X;  5KFQ A;  3KP6 A;  3H3V H;  1K1Q A;  4F92 B;  3MKW B;  2QM3 A;  1EYZ A;  5IP6 A;  1JDB B;  3Q8Q B;  4XL9 A;  4JX4 A;  3TDZ C;  3OYD A;  1RR8 C;  4BE0 A;  4XN0 A;  2LRE A;  2RKH A;  1ULY A;  3KZI C;  3ZRG A;  4I7H A;  1ZLJ A;  4LH7 A;  4RBO A;  2J6S A;  5KT4 A;  1YIO A;  3MFK A;  3BC8 A;  3OUZ A;  4TQR A;  3HPH A;  4QLC U;  1GLV A;  1LDD A;  5FLM G;  3K4B A;  2V1N A;  4A3F G;  2X51 A;  3LFU A;  3QZ7 A;  3RB4 A;  2DFH A;  5CQE A;  4ENK A;  3PQJ A;  4QTR A;  2WB1 E;  2GOX B;  4KN7 X;  2M1B A;  2R4G A;  1X3Z B;  1YYV A;  4IPA A;  2Q1Z B;  4FBT A;  4U6P A;  3LOC A;  3I4M G;  2EIM H;  4UN8 G;  4I76 A;  3OHA A;  4ZTJ A;  4JI2 H;  3N41 B;  2EB7 A;  2MCT A;  3H4D A;  2DPI A;  4EMS A;  1ZHQ A;  1ORK A;  3T5K A;  3HJE A;  3WOD F;  2VPQ A;  3E6D A;  1AA7 A;  5B3S H;  1H8A C;  2BVM A;  2BY0 A;  2CSO A;  2E35 A;  4IXA A;  1N77 A;  2P0A A;  2K86 A;  3E6C C;  2LCJ A;  3I55 I;  1FC3 A;  4HRI A;  5DS9 A;  2VBN B;  2KJC A;  1IC8 A;  1O57 A;  2F4V H;  1Y0N A;  1KU9 A;  2G7H A;  2A5W A;  2O7O A;  2F4L A;  3EUH C;  1RZ4 A;  5LRR A;  4ZDO A;  3R7P A;  1XDU A;  2HVQ A;  2JA7 J;  2A61 A;  1X1B A;  1ZTR A;  2G9W A;  3A03 A;  3WGH A;  5FKN A;  2CH0 A;  4AVP A;  3L2W A;  2JEG A;  3IH4 A;  2JSP A;  2LTP A;  5EG0 A;  5K5O A;  2NNY A;  3V8K A;  4F52 A;  2ZME A;  2ZNY A;  3V7R A;  3OYB A;  4XYM B;  3BTC A;  3CMY A;  3CCE I;  4B44 A;  4KT5 C;  2E2J J;  2EZL A;  3MX9 A;  1P8K Z;  4B09 A;  4GO1 A;  1USS A;  3KEO A;  3LA2 A;  4ZYE A;  3C2G A;  5IP9 J;  1PYV A;  1B59 A;  3LSM A;  1I50 A;  2DPJ A;  2DIK A;  2M5W A;  3ZN1 A;  5HLI A;  4TV8 F;  3PSI A;  1ENH A;  4TV9 F;  1D0Z A;  2L2O A;  4UV9 A;  3LML A;  5KT2 A;  4EYH B;  3KEQ A;  1Y1V J;  1NG7 A;  2CS3 A;  2XCA A;  2YX4 A;  1N48 A;  1JGG A;  3QP5 A;  4HLY A;  1PDN C;  2OV7 A;  5HOD A;  1R36 A;  1IN8 A;  2IJL A;  2P0W A;  5BQT A;  5DQI A;  2FLN A;  5KFY A;  3HKZ N;  1BIB A;  2ZJ2 A;  1OCT C;  4P1W A;  2LDU A;  2FPP B;  2R8H A;  3F22 A;  4UNB A;  3S1R J;  3KPH A;  1DQU A;  3PFI A;  3QPT A;  3QWL A;  2Y0S N;  3FHN A;  4XRM A;  4I98 B;  2I8D A;  3Q0W A;  1ZR4 A;  1XC5 A;  2EIK H;  2FRH A;  4MV1 A;  3FXJ A;  4RB3 C;  3RB3 A;  1N34 H;  2NYX A;  4CC6 A;  3SJM A;  1XX5 A;  1SCU B;  1MGT A;  2W85 A;  1QPI A;  4YBZ B;  2WAE A;  4A3E G;  1OYY A;  3ZQQ A;  3DTE A;  4RU9 A;  1P2F A;  1TWF J;  2XSJ C;  3HYJ A;  1T36 A;  4A3D J;  2JMZ A;  2L3D A;  3S15 J;  2DT7 B;  4LX3 A;  4WD3 A;  1AKH A;  4O3O A;  1MZB A;  2E1O A;  1N78 A;  3H1C A;  2PEX A;  3GZN B;  2NVY J;  3DV8 A;  4B4C A;  2A69 F;  4DYC A;  3HB9 A;  1I39 A;  3J7Z I;  1LQ1 A;  3AYH B;  4EYI B;  2LH9 A;  4MNU A;  4A6E A;  1YRN B;  3FKI G;  3U1K A;  2M34 A;  1A04 A;  5FLM J;  3RIR A;  2HGC A;  1J5Y A;  1FP1 D;  4RNO A;  3QYB A;  1J0R A;  2R7Q A;  4A3F J;  1S3J A;  4BJT A;  3EYY A;  3JAM K;  2YW2 A;  4MEX F;  1B8I A;  3FBI B;  1B24 A;  4AIH A;  2R7W A;  1S9F A;  3KIO A;  3QZ8 A;  3MWE A;  3KO2 A;  1KGS A;  4KIB A;  4A93 J;  4B3A A;  3DBH B;  3I4M J;  1KC7 A;  2MC3 A;  3WGI A;  5E67 A;  2CV1 A;  3ECO A;  3CJN A;  4KA4 A;  2R3S A;  3K5I A;  5DG7 A;  2BZT A;  2XIG A;  2DPU A;  4IRC A;  2KIM A;  1X1C A;  4L5J A;  3AKZ A;  4I55 F;  2XPV A;  3WTV C;  1WWX A;  5KKN B;  3DPU A;  1V4Y A;  1HA8 A;  4J9O A;  5C5J A;  2L7F P;  4Y52 J;  3JW4 A;  5F1J A;  1V54 H;  4LF8 H;  3T1Y H;  2KZG A;  4R1H A;  4ON0 A;  2L4A A;  4IOC F;  3DEE A;  1I7L A;  1BC7 C;  3L2P A;  2P7V B;  2ISZ A;  1OCO H;  2JA6 G;  1G3Y A;  4OU0 A;  2B63 A;  1XCV A;  2FPI B;  4KL5 A;  2D1V A;  5JLX A;  4Q43 A;  4HDV A;  1R4N B;  3QPH A;  2ME6 A;  2YZG A;  2VJI A;  2Y31 A;  3I56 I;  2VUM G;  2KLO A;  2KT0 A;  3G1M A;  1SD6 A;  4BL0 B;  1KQ0 A;  1QRY A;  4IZO A;  4ZOL F;  1A9X A;  4MFE A;  1D0X A;  3NGD A;  1IRX A;  2EA4 A;  4GRI A;  5IYD J;  3KET A;  2BW3 A;  2A05 A;  2CQX A;  1TLH B;  3OYJ A;  1VQM I;  2GAU A;  2RF4 A;  1MH3 A;  3TW7 A;  1X19 A;  2Z16 A;  3E1S A;  2LF8 A;  3HUG A;  4EBE A;  1S0M A;  2M2E A;  4ECZ A;  4I09 A;  5CJ9 A;  3WG7 H;  4KNY A;  3W6K B;  1N56 A;  3D5R C;  1G6N A;  4U7B A;  3HSR A;  1DP3 A;  3W6J B;  3MXA A;  4R8H A;  4EGY A;  1ZAR A;  2DTZ A;  1KU3 A;  1XMK A;  4HPQ A;  3PW7 A;  3GIK A;  5EG0 B;  3V4G A;  2OTL I;  1F1Z A;  3F6V A;  4PFP A;  4IEJ A;  4M9X A;  3OYA A;  1T95 A;  1T98 A;  3CP2 A;  4PZJ A;  1PUF A;  2ZME B;  1T08 B;  1OR7 A;  4KJZ A;  3S17 J;  2CW0 F;  5CQG A;  4IF4 A;  1NH3 A;  3ETH A;  4BY1 G;  3M9O B;  4F55 A;  3OS0 A;  2HNH A;  1AM2 A;  3TQN A;  4FBU A;  5LFA A;  3V6H A;  2OA4 A;  1SFU A;  2VPR A;  4LF7 H;  1WR2 A;  4UN7 A;  2F5V A;  3VYS B;  2Y2Z A;  4WXD A;  1LVA A;  4AVZ A;  5J47 A;  1F5T A;  2IT0 A;  1T9J A;  4A3E J;  5HV6 A;  4B3R H;  3RV3 A;  1WH5 A;  3M9N B;  2XDV A;  1K78 A;  4ED0 A;  3SHF A;  4JI7 H;  2PMZ N;  2B9S A;  2JEJ A;  2GOM A;  1K83 J;  4RNN A;  3ERM A;  1OR7 C;  3OOL A;  5A2Q K;  3SFZ A;  2PN1 A;  1F9N A;  1ZRE A;  4YY3 H;  3PSF A;  1O3Q A;  2DCE A;  5HS8 A;  3I64 A;  2VIX A;  4Y17 A;  3FKI J;  1ZAO A;  1SVO A;  2ADU A;  3OL4 A;  5CVJ A;  2GPS A;  4FX0 A;  4G6T B;  3VYR B;  3K3P A;  2BQ3 A;  2LY1 A;  3LA7 A;  2PG4 A;  5GAH J;  4LQ0 A;  4LIT A;  4Q44 A;  2C22 A;  3Q3S A;  3KHH A;  2K9L A;  3EYI A;  3CCM I;  2RNG A;  3KP2 A;  1DP7 P;  1QZY A;  4UNA A;  4PJJ A;  2V58 A;  3JTH A;  3I71 A;  2XHK A;  2DTR A;  2R7U A;  1BI3 A;  1FMV A;  2DYS H;  3OV8 A;  2FPG B;  1WPK A;  2EZK A;  5DG9 A;  3RB6 A;  2WC2 A;  3TQT A;  4IRI A;  2VC1 A;  1AKH B;  3HOS A;  4J9Q A;  3K4K A;  4EGZ A;  4OOI A;  2FX0 A;  3FXO A;  1S5L C;  4AAE A;  4JV2 A;  1DGS A;  1ETY A;  5EDN A;  3BA8 A;  1OYW A;  1IO2 A;  2DI3 A;  3M9A A;  2MFZ A;  3GV8 B;  4M6Y A;  1G4D A;  4EM1 A;  4IR9 A;  3ML6 A;  4D7N A;  1UM2 A;  4WWC A;  3OYH A;  3OS2 A;  4AC0 A;  3A01 A;  1E17 A;  3HYI A;  1B8I B;  2UUA H;  2NVT J;  2JA6 J;  3AAF A;  2KP6 A;  1ZGW A;  3GTJ A;  1VQ6 I;  2ZDG A;  4JI1 H;  1RRJ A;  1R22 A;  2VUM J;  2IS6 A;  3RPU D;  3RCO A;  1K1S A;  2FMY A;  3ABU A;  1K4T A;  1U0D A;  1DFA A;  2QKM B;  5AIP A;  1L0O C;  2DW4 A;  4FM9 A;  1HW1 A;  3JTG A;  1X2N A;  2L7M P;  4XK4 A;  3TO6 A;  5C1O A;  2DFI A;  3ZMV A;  5E17 F;  5F0F A;  2WTF A;  2QK4 A;  1TT0 A;  3Q1K A;  2XF5 A;  3VB2 A;  2P4W A;  1FLI A;  2DJI A;  2LF7 A;  2Q2E A;  3OR1 C;  1MNE A;  1G3S A;  1OCP A;  1FBS A;  3GCM A;  3KLN A;  4A0Z A;  4GYG A;  3FM5 A;  1EUC B;  4LFB H;  2Y9Y A;  2JQ7 A;  3HOX G;  1VQL I;  3UR3 C;  3H92 A;  2HS5 A;  3WGG A;  3FXR A;  2C35 B;  4RUA A;  2COB A;  2VKD A;  5F08 A;  3ZR8 X;  1UC8 A;  5IYZ F;  2VA3 A;  2BW3 B;  4XLE A;  5D1P A;  4JX5 A;  2W8K A;  3MWM A;  4RZR A;  4G7H F;  4CDG A;  5CKT A;  1STZ A;  3CF2 A;  1Z7L A;  2ZB9 A;  3HUG B;  4F93 B;  2LD5 A;  5EWG A;  5EYR A;  2VBW A;  5CA1 F;  3S14 J;  2H8R A;  2HDC A;  4AIK A;  4UCO A;  5F9N A;  3EET A;  1D5V A;  3ZQL A;  5IY5 H;  1YS6 A;  2O5R A;  1XD7 A;  2ZSH B;  4N4O B;  1ON1 A;  4PDK A;  4X0G A;  1ZHS A;  3BR2 A;  3LST A;  4P9F A;  1GO3 E;  5B5E C;  2LP0 A;  4BQO A;  3I53 A;  2W57 A;  1SC7 A;  3Q0V A;  1PUF B;  1SAN A;  3ZGK A;  3S1N J;  1GGO A;  2YUS A;  2C28 A;  2XC7 A;  4Q8E A;  5L1L A;  1P4X A;  3CO6 C;  3BQ1 A;  4NQW A;  3ZQ7 A;  4LK1 F;  2EIJ H;  4II2 A;  5DEQ A;  3M7G A;  2E1M B;  2FMA A;  4DIQ A;  4YEL A;  1GXP A;  2AXT C;  4IHT A;  2MAB A;  5IYB G;  5EGO A;  3H9G A;  3OOP A;  2L9N A;  2MSY A;  2QVO A;  2RN7 A;  3R0A A;  5KK1 A;  2E19 A;  4CCJ A;  3J81 Z;  3K1N A;  1IF1 A;  4I4T F;  2UVV A;  2ELK A;  2DOE A;  3ZQI A;  3VWB A;  1U0C A;  1K78 B;  2DQR A;  2D5V A;  1Y8R B;  3U9T A;  3GTQ A;  3VMM A;  2XAJ A;  2VT3 A;  4YIF A;  1DPU A;  3CLQ A;  2E36 A;  2E5L H;  3I0T A;  1YE9 A;  3HG9 A;  2FBI A;  3DEU A;  1B72 A;  3IG0 A;  5H20 A;  4BDZ A;  2EV0 A;  2RGR A;  1M0T A;  3V7S A;  1V51 A;  2F4I A;  2Z9O A;  4IHY A;  1VND A;  3BJA A;  4DV0 H;  1ETW A;  2JVH A;  1VQ5 I;  4U88 A;  4WXC A;  4O2A F;  2UUC H;  4YFK F;  1CGP A;  1IXC A;  1UMQ A;  1GSH A;  3I58 A;  4KL6 A;  2DK5 A;  2HVS A;  1TWA J;  4J00 A;  3MFH A;  1FYK A;  4XRS G;  2JEF A;  2VBZ A;  4BY7 G;  1B9M A;  2HZT A;  3T8T A;  2UVR A;  2ZCW A;  3CC2 I;  1RKW A;  2PMU A;  2I3P A;  5BMZ A;  4UVC A;  3GTP J;  4YR2 A;  2YPR A;  4RB2 C;  4M3B A;  3R60 A;  3G4S I;  1PUE E;  1EF4 A;  5EDW A;  3A1Y A;  2CW7 A;  3CMA I;  2XGP A;  4BHC A;  5HOO A;  3ZXS A;  2FF4 A;  5E3N A;  3BA9 A;  1YJN I;  3D5S C;  2R8J A;  2RV8 A;  3H0G A;  5K1Y A;  3ZMT A;  4CSW A;  2GM4 A;  4EEY A;  1ZHF A;  2X0L A;  3BPX A;  5LA6 F;  4RMN A;  2DFF A;  2M8G X;  3KYD B;  4IHS A;  5DV5 A;  1YX3 A;  4UFZ A;  3A01 B;  5EZG A;  2FK3 A;  1UNN C;  1VF9 A;  4EJV A;  3BOQ A;  1CQJ B;  4CHU A;  1EH7 A;  1D1C A;  2BXZ A;  2MLK A;  4IWY A;  5JHF A;  2KIF A;  4KIT B;  4HYK A;  3QOE A;  3HOY G;  1HCR A;  2R7N A;  4OWR B;  4GIG A;  4O5V A;  3GLL A;  2M0M A;  1UHW A;  3PNT A;  5LYJ F;  1X2M A;  1Z3X A;  2Z99 A;  4ZZL A;  2P5L C;  4XLP F;  2R7T A;  1Z67 A;  3C7J A;  5LGU A;  3JSP A;  5E3O A;  3E6M A;  4HLX A;  5CYV A;  2GA2 A;  2HYJ A;  3BR0 A;  4PJL A;  1XGM A;  2CUE A;  4BUP A;  2A5Y B;  1OMI A;  3N40 P;  2IRF G;  1FSE A;  5DLG A;  3C18 A;  2GIZ A;  3KFW X;  4TV7 A;  1Z21 A;  3W2A A;  2Q2E B;  1IV8 A;  4KIF A;  4RM3 A;  1HC8 A;  4Z20 A;  3E54 A;  1BNC A;  4QJF A;  4BBR G;  4GC6 A;  4P96 A;  2F6C A;  4RNM A;  2R7L A;  1XDS A;  3LSK A;  4O1S A;  3TO9 A;  2LK2 A;  5CA0 F;  3CP8 A;  1D3Y A;  3W2V A;  1GDT A;  3J80 W;  2FD5 A;  3DXJ F;  2QA4 I;  3WU1 B;  3F8M A;  4F4W A;  4BXU A;  1JKJ B;  3SEQ A;  2UXC H;  4ECW A;  1P6R A;  3H3V K;  3GIJ A;  5C44 G;  4X6A J;  2VQL A;  4E7Z A;  4O3Q A;  5J1U A;  1DUX C;  3SZP A;  2QSG X;  1MI8 A;  1L3L A;  3ZMD A;  5LEJ A;  1EKE A;  4OX9 H;  1DU0 A;  4XRS A;  3I5U A;  4J19 A;  2IBK A;  3JRF A;  5IYB J;  4MIM A;  3VPB A;  4OZ6 A;  2L01 A;  1HSJ A;  3UKG A;  1H88 C;  3RGZ A;  3I12 A;  5KFG A;  3PNV A;  3VPR A;  1W0U A;  3F6O A;  3OYM A;  4E7I A;  3FKJ A;  2YRW A;  2R6F A;  5LLQ A;  5E20 A;  2V6E A;  3LSH A;  4YJ3 F;  1U9O A;  3GTO J;  3V6K A;  2NUA B;  4CYC A;  3BCA A;  5M5W J;  2YS9 A;  5KAF C;  5BR8 H;  4HNT A;  4ZYH A;  4ZDP A;  4ZC3 A;  3VSL A;  5LGN A;  4NHJ A;  4J9M A;  3PVX A;  4MEY F;  3RV4 A;  5D1O A;  2KIU A;  1N3E A;  1GV5 A;  4NQW B;  3HXL A;  4XLF A;  3RQI A;  2CV2 A;  4TQS A;  2R93 A;  5LP6 F;  2RC4 A;  4H4K C;  1MNM C;  2QQ9 A;  3GVA A;  4C5C A;  1AUV A;  5BPI A;  1JUP A;  5EGO B;  2VLA A;  4KDP A;  1S97 A;  4BY7 J;  2LKX A;  4ZJZ A;  1ZRC A;  1LEB A;  3RKY A;  5HLT A;  4J9K A;  1OIS A;  3L09 A;  1NK3 P;  4M3E A;  3WO0 A;  3HRM A;  1N75 A;  2F5D A;  3HOW J;  2DA7 A;  4YAJ B;  1MND A;  1O3T A;  1V55 H;  1GT0 C;  3EPG A;  1B72 B;  1IAW A;  1U3E M;  5DM7 F;  1UFM A;  1APL C;  2A6T A;  3BG3 A;  3Q8P B;  2VJJ A;  2XCL A;  1BIA A;  3GZ5 A;  5D4R A;  2M05 A;  4UVB A;  2HTJ A;  2HQ5 A;  4Z1Z A;  4P9U A;  1J9I A;  4AYB E;  3KAK A;  3R5X A;  3SZG A;  1WH2 A;  3SZT A;  2VE8 A;  3DLL F;  4A5N A;  2OCE A;  3P5J A;  1BW5 A;  4WF2 A;  1FIA A;  3KHG A;  3CCU I;  3QQY A;  3R23 A;  5L9X A;  3DF8 A;  4HV6 A;  3J7A O;  4EG0 A;  1ETV A;  1T0F C;  2DO7 A;  3S2D J;  4FU0 A;  3F8N A;  5J6X A;  2L8L A;  1LNW A;  3M07 A;  5KG5 A;  4EBC A;  3HOY J;  3D0S A;  3GTL J;  1HR0 H;  4UN9 A;  5HDG A;  3ZMZ A;  1IBK H;  1WJ5 A;  3OIP A;  2WY8 Q;  1YS7 A;  1PP7 U;  4ZQI A;  4WX9 A;  2I3Q A;  3HEF A;  1S0N A;  4IRK A;  4JOM A;  4BXF A;  2VBJ A;  5K7H A;  1AUX A;  3HGY A;  3QU3 A;  2LMD A;  5L3E A;  1Z9C A;  2P5V A;  4LF5 H;  2L9S A;  5HLH A;  3PW5 A;  1HQC A;  2KQR A;  5JLW A;  1Y56 A;  4BBR J;  2VB6 A;  1S7A A;  2BXY A;  2ACJ A;  1A5J A;  2R84 A;  1B9N A;  1YQA A;  4DR4 H;  1SFE A;  1UG2 A;  3LSI A;  3M4I A;  4J9P A;  5D5V B;  2EBI A;  1N32 H;  1KJQ A;  4U0V A;  2WAF A;  5KNL A;  1TWG J;  1S03 G;  3Q0U A;  3RB0 A;  1FJL A;  2A6H F;  5C44 J;  3N42 B;  3PO2 G;  4E7S A;  2EV6 A;  2PBZ A;  3MR3 A;  3GIM A;  4LF9 H;  4B43 A;  1BM9 A;  2HPM A;  2YR2 A;  1ZG5 A;  4B3T H;  1FPQ A;  3FBN B;  3M8J A;  4AUX A;  5TGT A;  1Z91 A;  2OD5 A;  3M1E A;  2VPS A;  1XCB A;  5HS9 A;  3OS1 A;  1SFX A;  5A72 A;  1H89 C;  4QWE A;  2K4B A;  4CCO A;  2LBF A;  1BW6 A;  2JZY A;  1O3R A;  1GPP A;  3EPI A;  5KFM A;  1OCC H;  1XGN A;  5B1B H;  1TW2 A;  3BT9 A;  4EM2 A;  2H09 A;  2LKP A;  4C3J J;  3RGX A;  2VBL B;  3ZCO A;  1XB4 A;  2V9V A;  1ETX A;  2DT6 A;  1F36 A;  5KCM A;  2W6Q A;  1K6Y A;  1W1W E;  5IWA H;  5TIS C;  5ED4 A;  2VE9 A;  1GVD A;  4MA0 A;  5BPH A;  3KYC B;  1SVM A;  2QKL B;  5E18 F;  2X1E A;  1HOM A;  4YR3 A;  4LLG F;  5H80 A;  4ENN A;  4R8U A;  4JI3 H;  2LC2 A;  5EEA A;  1TAE A;  2XAS A;  4ZH4 F;  2HXO A;  5KFA A;  5DTD A;  2XUB A;  1FBQ A;  1W7P D;  1Z6T A;  3IAM 2;  2JA7 A;  1S72 I;  3FK6 A;  3TQ1 A;  3G6V A;  4WBN F;  3OYC A;  3HKZ A;  4EJO A;  5GTI C;  3QPL A;  4Q0Y A;  4UCV A;  5ICG A;  3N4M A;  2E1C A;  4HEA 2;  3H4B A;  3CES A;  2WYO A;  3DF7 A;  3JZI A;  3ZQG A;  3BTJ A;  3M8F A;  3MXB A;  2O6G E;  3R4K A;  2Q2T A;  2Y0S A;  1JE8 A;  1WZ2 A;  4BJ5 C;  3RJP A;  3F0C A;  2OU2 A;  2V1D A;  3WTY C;  5KT3 A;  2W71 A;  1NG6 A;  3A4C A;  5GP9 A;  4R79 A;  1TWC J;  5KT5 A;  1WSC A;  4MV4 A;  2VBO A;  4CYC B;  4DV6 H;  2V4J C;  5DCF A;  1KJJ A;  1ONV A;  3BCB A;  4BH9 A;  3SXY A;  2C6Y A;  4ESF A;  1VQ4 I;  3FMQ A;  3K6G A;  2GPW A;  2WAQ E;  5D1O B;  4O4I F;  2NVQ J;  4XBF A;  1SEI A;  1IZ1 A;  1Y1V A;  3GWZ A;  2RDJ A;  5AKN A;  2EH3 A;  1VS0 A;  5LD2 C;  3KX2 A;  3CLO A;  1WQ2 A;  2X4H A;  1WJA A;  2FOW A;  1WRJ A;  4IRG A;  3S1M J;  2IP2 A;  2VT2 A;  4AD9 A;  4YHX A;  4OIO F;  2F5F A;  4K0K H;  4G7O F;  4XLC A;  4HV5 A;  1E3P A;  5BMV F;  2PN6 A;  3LL7 A;  5J8C A;  1A31 A;  2QSH X;  2P81 A;  4EQQ A;  2JRT A;  3KAJ A;  3CCS I;  2CGP A;  3A0H C;  5DUI A;  3IC7 A;  4D5F A;  5A74 A;  4RDU A;  3K3V A;  4Q8F A;  1JX4 A;  2MD5 A;  4BDY A;  2FK2 A;  3GV5 B;  4QIW E;  3KZY A;  3FMS A;  2DAO A;  2PX9 A;  3IH2 A;  1DU6 A;  1I94 H;  2YRX A;  4Z2Y A;  1K6O A;  3K70 D;  4A6D A;  1FSH A;  1O3S A;  4HSR A;  1TWF A;  3ETJ A;  5JVL A;  5KFF A;  3RUP A;  1WCM G;  1QPM A;  3RBD A;  3FK7 A;  4MHG A;  2UXB H;  4LOX A;  2MW8 A;  3IFJ A;  3QOP A;  3R5H A;  1K79 A;  2NVY A;  1HST A;  1RET A;  3BG9 A;  5DD4 A;  1HKS A;  2ZME C;  1JKQ C;  4ME6 A;  5IP7 G;  4O3M A;  1JKO C;  3K4N A;  3RYP A;  1VQ7 I;  5L3F A;  2LSO A;  3J80 Z;  1OCZ H;  4B3S H;  4CXF A;  3BQY A;  4KHP H;  2ZO4 A;  4GGG A;  4J9R A;  1BR2 A;  2VBX A;  1T2K A;  2N8G A;  1KJ8 A;  2VBJ B;  2HFH A;  5FO5 A;  4C2M J;  3EQL F;  1Z6R A;  5J4Y A;  2R7M A;  2B7E A;  2E5Z A;  1WJC A;  2HTS A;  1XSD A;  2GIV A;  2W6O A;  2FNA A;  4GDF A;  4UN8 A;  4E2U A;  1EUD B;  1FZP B;  3TL4 X;  2C2E A;  1PVE A;  2BE5 F;  1LVK A;  3CUQ A;  1UST A;  3U9G A;  3G3Z A;  3QAH A;  3HOV G;  1RI7 A;  4IAJ A;  4DL2 A;  5EF6 A;  1HKT A;  3O6B B;  2KKO A;  1IN4 A;  5KG0 A;  4L9V A;  3MWD A;  2YS6 A;  5E3M A;  1P4A A;  4ED2 A;  4B3M H;  5D4S A;  3UVF A;  4XSX F;  2W4S A;  2VOB A;  2CZG A;  4IHJ F;  4DL3 A;  4JYA H;  1MBJ A;  3CJQ B;  4A0Y A;  3OOR A;  1ZK8 A;  3IKT A;  3S1Q J;  1AT0 A;  4QW8 A;  5DGB A;  4MV6 A;  2H6C A;  3J81 W;  5EEG A;  3ORR A;  3F8B A;  1TTY A;  1MBF A;  2LBF B;  5L3B A;  3E5U A;  4ANJ A;  5IT9 Z;  1KYW A;  3FDY A;  3JRH A;  2LVS A;  2HOE A;  4LLN A;  5FLX K;  2AU0 A;  4UUT A;  4OIP F;  5F1R A;  2ECB A;  4XMY A;  4UNC A;  2DDA A;  1WKM A;  2OCC H;  2H94 A;  1G3T A;  1LFB A;  2DLN A;  2WAD A;  4HX4 A;  5KFE A;  2V7F A;  3ABK H;  2FKL A;  2AS5 F;  3OIQ A;  4L0Z B;  3WO1 A;  2R7O A;  4HW0 A;  5KFZ A;  4R8U B;  5KFB A;  1TP4 A;  1FOX A;  3HZJ A;  3ERE D;  2M8E A;  4C5A A;  5LRS A;  1SD5 A;  2K5C A;  5FKK A;  4A12 A;  4BXX G;  3L2R A;  2PMZ A;  4MA5 A;  1MMG A;  4HF1 A;  1DQ3 A;  4O3N A;  3QP6 A;  3OYK A;  3L9F A;  4JV1 A;  2NNN A;  2H6B A;  4XKW A;  5E5O A;  1B04 A;  5LL6 b;  1W96 A;  3MXB B;  3E5Q A;  2UXX A;  4KIS A;  2DOD A;  3MKY B;  1JTY A;  4BAC A;  2V1U A;  4J9L A;  2K4J A;  3ZQC A;  2OJE D;  3DBL B;  3K2Z A;  3RZD J;  2XAQ A;  1E2X A;  3BTI A;  3PQK A;  3PL8 A;  2NVU B;  2H27 A;  2X6Y A;  4XKC A;  3OHB A;  2VBO B;  2QEX I;  1BN5 A;  1MMN A;  3GTG J;  5EOY A;  2E2H J;  1A0I A;  1XMA A;  1PJR A;  2IAI A;  4MQ9 F;  3BY6 A;  4N9I A;  4F4Y A;  4GYI A;  5A0W A;  2JJ7 A;  4BEH A;  2HQA A;  2VQH A;  2X85 A;  2D1H A;  2VXD A;  4XYL B;  2Y75 A;  3PN1 A;  4Y7N J;  2NXN B;  4A3B G;  2M7B A;  3DWL E;  2FJZ A;  5E8I A;  5IPA A;  2CYY A;  1WCM J;  3WE2 A;  3WTT C;  2STW A;  1LWS A;  4YG2 F;  3P9K A;  5HNF A;  4GLX A;  3J7A Y;  1K83 A;  3ZN0 A;  2XGD A;  2ID3 A;  1U5T A;  2XE0 A;  4ECT A;  2FQ3 A;  4Y4R A;  2JN6 A;  2QQA A;  4I6Z A;  4DZP A;  3DPL C;  1IRG A;  2EJR A;  3RPQ A;  2EX5 A;  1P7J A;  1R5G A;  3MZY A;  3FKI A;  4A0X A;  5IP7 J;  4J9S A;  1N33 H;  3K1P A;  1QGP A;  2QYO A;  1MSE C;  4IQ4 A;  4QSH A;  4G8X A;  4M6X A;  5CB4 F;  5LBQ A;  3OYI A;  1XMX A;  4ENM A;  3ORQ A;  4L0Y B;  3MZH A;  4DL5 A;  1OYI A;  2IS4 A;  4JX6 A;  2FUG 2;  1M5X A;  2L9R A;  3CZ6 A;  3SFI A;  4HNV A;  3WU0 A;  3BRO A;  4JBA A;  2KRC A;  3NWT A;  5FD6 A;  3SYT A;  1YFH A;  2WB1 A;  4JK1 X;  5KT7 A;  2ZNZ A;  2EIL H;  2BEO A;  3HOV J;  4C2U A;  2WA0 A;  3ZQH A;  4D5C A;  5LHI A;  1N36 H;  3N97 A;  1WGX A;  4PCQ A;  5K5Q A;  3HRS A;  3IGD A;  2ATL A;  2Q2U A;  2JA8 G;  2HQN A;  3KEY A;  3SDB A;  3GTM J;  2QLZ A;  4RB1 A;  1CE8 A;  2V5A A;  3HM5 A;  4O4L F;  3HOZ G;  1I3Q J;  1WFX A;  2CQY A;  2E1M C;  2VN2 A;  5K2M A;  5FGM A;  4D6O A;  3T5J A;  2JA6 A;  2P6T A;  1IBL H;  4MTD A;  2ASD A;  1WI9 A;  4XKV A;  5KFT A;  4L9J A;  2VUM A;  2ASL A;  2KRH A;  3JSO A;  3K4J A;  4MGR A;  3RFC A;  3CUQ B;  4FCY A;  3IWF A;  1VQO I;  2DMQ A;  3OR2 C;  4GFB A;  1OKR A;  2MH9 A;  3B02 A;  3BQ0 A;  1Z7U A;  1L2Z A;  1Z2N X;  2OLS A;  1VBG A;  4RUC A;  3KP5 A;  1OJL A;  4IVN A;  1FIP A;  4EJW A;  3K4C A;  1TQM A;  1UZC A;  3LFK A;  3CDI A;  3PIO F;  3KHL A;  3IHU A;  2AHQ A;  2R7Z G;  1ETQ A;  4U87 A;  5FJ8 G;  1YO5 C;  3H3U A;  2OQG A;  1TA8 A;  2OAZ A;  2IMZ A;  1D0Y A;  4HF0 A;  3PW4 A;  4OAZ A;  1X1A A;  1V9P A;  1UCR A;  4BXX J;  2FQ4 A;  3C2H A;  4II3 A;  5F6F A;  4EJU A;  5JVG F;  1QVU A;  2CU7 A;  2IVM A;  2LRD A;  5EJC A;  5DQH A;  2YYA A;  3L7W A;  1GYF A;  1JIH A;  4G3I A;  3G6X A;  1UG0 A;  2YZN A;  3IUO A;  5FRN A;  2DMN A;  2OC6 A;  4CC5 A;  1YG2 A;  1Y1W G;  4X65 H;  4FT8 A;  2VJ4 A;  4G6D A;  2IA1 A;  1YW7 A;  5BPD A;  2UVU A;  5DDG A;  1SAU A;  3BPV A;  4YEJ A;  3DU6 A;  2D2W A;  3NAR A;  3RBE A;  3DBR B;  2JA5 G;  3DKW A;  1VAJ A;  2TCT A;  1ETK A;  3DCF A;  3JRE A;  1KJI A;  3MJF A;  4ECS A;  1T56 A;  2WB1 N;  5BPF A;  1TL8 A;  3I4N G;  1LEA A;  2ZXW H;  2W48 A;  2EQR A;  4I02 A;  3T5X A;  3GTK J;  1X9N A;  1Y8Q B;  3RQ4 A;  1FYL A;  2CV0 A;  2ELJ A;  2M4K A;  4M74 A;  4RLF A;  2HKO A;  4C5B A;  4DL7 A;  1JVA A;  4A3B J;  3QOD A;  4M73 A;  3B6C A;  2HI3 A;  2HGS A;  2R0Q C;  2ZJP F;  1GXQ A;  3BQ2 A;  1MKM A;  5K5R A;  4UT0 A;  1U0J A;  3CF5 F;  4YII A;  2O8X A;  1BOA A;  4OMY A;  2XPU A;  1GV2 A;  4LH6 A;  1G9Z A;  5A2Q Z;  5KFU A;  2XAF A;  1JJ8 C;  3CMM A;  4EM0 B;  2FEZ A;  2XCP A;  2JA2 A;  4NC8 A;  3V8J A;  2DJN A;  5D8D A;  4UCT A;  2XAH A;  4PJ0 C;  4BY1 J;  1RR7 A;  1W5S A;  3V4Z A;  4DZJ A;  3FMR A;  3LMM A;  3OYF A;  3TIN A;  3EPZ A;  2H1L A;  1FYM A;  1I1S A;  3MR6 A;  2ASJ A;  2Z33 A;  5FRO A;  3JRB A;  3VPC A;  4BEH B;  2DPD A;  2RQQ A;  3CC4 I;  1TW3 A;  4QWD A;  5D5U B;  3TDU C;  2R92 G;  3V4S A;  5K7F A;  2ZFW A;  1LFU P;  2V26 A;  4B47 A;  1RUO A;  2K85 A;  2XRN A;  2RDP A;  4LFU A;  3DFG A;  3RI4 A;  1BL0 A;  3L2V A;  3KAL A;  4G94 A;  4AAD A;  1MIJ A;  2LYC A;  3QYE A;  2L7Z A;  1M6V A;  2DA5 A;  5H2F C;  1UJ8 A;  1S10 A;  4BQQ A;  1U5T B;  1TQI A;  4BAY A;  2PBI A;  2XE0 B;  3FMA A;  4QWC A;  2Q8K A;  3BR6 A;  3GQC A;  2JA8 J;  3N8D A;  1MDM A;  4LMY A;  4LLL A;  4XM3 A;  3PR4 A;  5KG7 A;  2K02 A;  1B33 N;  2R7K A;  3GFL A;  2EFW A;  1LDK B;  1MBG A;  3HOZ J;  2KIS A;  1YHQ I;  1EHI A;  2BYV E;  1J2X A;  3PZP A;  1QBJ A;  3U9S A;  4EGJ A;  1TWA A;  2HPI A;  4LF6 H;  5ILV A;  3QFF A;  2FA5 A;  4A3J G;  2M45 A;  2EFO A;  2YU9 J;  2DFE A;  4ABZ A;  1H9G A;  2XKP A;  4ZI7 F;  3ASN H;  4BU2 A;  4XKB A;  3GTP A;  2BY2 A;  4PFO A;  2WBM A;  2OQR A;  4HBL A;  2W7P A;  2QQ8 A;  1K61 A;  3L4J A;  5H6R A;  2VOD A;  3O8G A;  1FT9 A;  1Z3Y A;  4KIG A;  3AG4 H;  2F48 A;  2KMU A;  2NOG A;  2R5Y A;  1JXL A;  3K5H A;  1ZH5 A;  4CCM A;  3WHC A;  2R7Z J;  1IOV A;  3T5L A;  4WK8 F;  5LHH A;  3NQO A;  5JVD F;  2F4M B;  1IUY A;  1E3H A;  1TNS A;  4UXN A;  5FKO A;  1EV7 A;  1UEL B;  1Z0X A;  4C3I J;  4ZYA A;  1B6S A;  2I10 A;  1DV2 A;  4ECQ A;  1AN7 A;  4V2G A;  1XNQ H;  1B1B A;  3BZ6 A;  3PIP F;  3FIS A;  5M5Y J;  3M3Y J;  2AGQ A;  2VR1 A;  1JGS A;  5EWE A;  4DR3 H;  4DYR A;  5L1I A;  1Y1W J;  3ABL H;  3TP0 A;  2V9W A;  4XQF A;  4DV3 H;  1ON2 A;  5E1Z B;  4EGQ A;  5KFR A;  1S0O A;  5FD5 A;  4M9S A;  3G73 A;  4RAF A;  3M9M B;  1LUJ B;  1V4R A;  2K3F A;  4IJA A;  2W7N A;  2JA5 J;  3CUO A;  1Y39 A;  2ZSI B;  1VFC A;  4I2O A;  2LFB A;  5FB2 A;  4B1R A;  3QQA A;  2R92 A;  4KIC A;  1BI2 A;  1KYZ A;  2J6T A;  1MBE A;  3FIW A;  5KVR A;  1M1E B;  3K4L A;  5KFN A;  2R7X A;  2JPC A;  2XSD C;  3LSJ A;  4MTE A;  5ILU A;  2E2I A;  1ODD A;  3FXQ A;  4HAM A;  1R00 A;  4PSX A;  3CDH A;  2L5Q A;  1UB9 A;  1IXR C;  2EPF A;  3RJ0 A;  4YQW A;  3VPD A;  5FRM A;  1Z1D A;  1EH6 A;  3ISP A;  3HOX J;  4NNJ A;  5C4X G;  1FOY A;  4L5E A;  1KQ8 A;  2ID6 A;  3GFJ A;  2P6S A;  5FLV A;  1JUS A;  3L4K A;  4G12 A;  3OY9 A;  3BR1 A;  1KEE A;  4GKJ H;  4M9Z A;  2FBK A;  2IXS A;  1V3F A;  1ZET A;  2MG4 A;  2ZBK A;  2VPL A;  2DDB A;  3BZK A;  3BAA A;  4IWX A;  3BP8 A;  2Y0S E;  3BLY A;  1ZGJ A;  5IOZ A;  2EFQ A;  1WJD A;  2R92 J;  4O3R A;  2IN8 A;  4PUS A;  3CCV I;  4A3I G;  1KZH A;  3M8E A;  5LHG A;  1N3F A;  3RPU A;  3CQZ A;  1Z2P X;  2QYZ A;  2IBD A;  2E2I J;  3DTI A;  3L1P A;  2VON A;  2VBL A;  3PW2 A;  3GTO A;  3F72 A;  4XZ3 B;  3TBI A;  1HF0 A;  2E7X A;  1SFO J;  4DGW B;  4S05 A;  3OSP A;  2ICW G;  1S7E A;  3CCQ I;  2P5K A;  4EFJ A;  5KFS A;  1SVL A;  2HXI A;  1CF7 A;  4E7J A;  2GA1 A;  4MQV A;  4JI6 H;  1DV1 A;  3VDX A;  1BOB A;  4IKF A;  4F50 A;  2V4R A;  1QHH D;  2FE3 A;  2HDD A;  2IGO A;  2DOA A;  2L9V A;  3E6B A;  2W6N A;  3NRV A;  2KHM A;  4QFQ A;  1A6I A;  2QZ8 A;  3GX4 X;  3E97 A;  4A3J J;  3C0W A;  4KMU X;  4W1U A;  1CQI B;  2GBY A;  1D1A A;  3AG3 H;  5EZY F;  2OBP A;  2WTE A;  4JI5 H;  1IN7 A;  4PK4 A;  2HR3 A;  3WTZ A;  2M9H A;  4IZZ A;  5KAI C;  3CQZ J;  5J3L A;  2QUF A;  1I6H J;  3CCL I;  1MDM B;  1Y0U A;  4JQF A;  3RF2 A;  4X64 H;  3GLX A;  4ITV A;  3MR2 A;  2CQN A;  3LSG A;  4PJN A;  3HOU G;  3LWF A;  2L4M A;  3I59 A;  1XDN A;  4JV0 A;  2JSC A;  3F9K A;  4HX8 A;  5C8Y F;  2V9P A;  4IOA F;  3SE7 A;  4XSZ F;  1UC9 A;  5IT9 W;  1R1V A;  5KX5 F;  5JHU A;  1RES A;  4D7M A;  1G8X A;  1C3O A;  3GIL A;  3R61 A;  1U78 A;  2O7M A;  1O75 A;  3VOE A;  1HW5 A;  3V8L A;  1K4S A;  3GTL A;  2DA2 A;  2XB5 A;  4C9Y A;  4ETS A;  5DCM A;  4O4H F;  2KPM A;  4DQ2 A;  4UUS A;  5DQG A;  1RKT A;  1RJP A;  5GAG J;  3Q9V A;  2NVX J;  2VXZ A;  3MCZ A;  2HQR A;  2R5Y B;  4UV8 A;  2R85 A;  1R9T A;  5HNH A;  4H0E A;  4MLO A;  4XN3 A;  3G1L A;  3Q8S B;  3KTM A;  4DR1 H;  2ZM6 H;  2C2D A;  2UV1 A;  1XMO H;  4RAY A;  3ELK A;  3SEZ A;  1HNZ H;  4PDB A;  3S2W A;  1HBX G;  2RVC A;  1JJ6 C;  3HTS B;  2DA4 A;  2PLY A;  5L3D A;  2LG4 A;  2EV5 A;  4E4T A;  2LWY A;  3LSP A;  3T8R A;  4IR1 A;  1I1G A;  1IN5 A;  2CFO A;  3BG6 A;  2DK8 A;  1T8I A;  1P7I A;  4KFC A;  3ULQ B;  3B6A A;  4NDL A;  4S04 A;  2MC4 A;  3FX3 A;  4D0P A;  1MBK A;  1TWG A;  3J7Y J;  3MIS A;  3HIF A;  4UCR A;  4YP3 A;  3TP3 A;  2I5U A;  5C4X J;  2XAU A;  4D6N A;  4FHT A;  5DGA A;  4HZF A;  1S6L A;  4HA8 A;  4IRD A;  3WU2 C;  5GAE J;  1CQT A;  2ZJR F;  4F3Q A;  3AL0 C;  4O1R A;  3FF5 A;  2L0K A;  3LWB A;  1R9T J;  5J2T F;  4XON A;  1FWZ A;  3GFM A;  3S3M A;  3DTK A;  5IOY A;  4S0H B;  5B66 C;  5KFH A;  2F5E A;  1FY7 A;  4A3I J;  3HRU A;  1QVT A;  1SD4 A;  5JR3 A;  4ECY A;  1XTA A;  2G0E A;  5JVT A;  3KYL A;  2XF6 A;  4PGH A;  3MVP A;  3V42 A;  2I87 A;  3Q8R B;  3GXO A;  3KP7 A;  4FE7 A;  5FPR A;  3FDS A;  1WJB A;  1S7O A;  2X6X A;  3OOU A;  1ITY A;  2QSF X;  5KT6 A;  4YR0 A;  3TOA A;  1B6R A;  4YHH H;  1K7A A;  3FD2 A;  1R23 A;  5K7Z A;  2VOP A;  3IH3 A;  2FNP A;  1MSF C;  4HNU A;  1JXS A;  4CYD A;  4ZYG A;  2LY2 A;  3JRA A;  3BJ6 A;  5GPC A;  2I8C A;  3E5N A;  4ESJ A;  3MKL A;  1MMD A;  5CVU A;  2Y48 A;  3HHG A;  4A5M A;  3NZM A;  3H35 A;  4JUZ A;  4RB0 A;  4RM2 A;  2STT A;  3IKV A;  4AAB A;  4GKK H;  2BHY A;  2AGP A;  2WWY A;  2VQD A;  1W5C C;  2C00 A;  1TWC A;  4M9U A;  2DMU A;  1MMA A;  1XSV A;  1YI2 I;  2DZD A;  3E0J B;  2OWO A;  4CUG A;  3FXM A;  3VYU B;  4FQG A;  1P92 A;  4AQX A;  4ESB A;  4BHB A;  1RUN A;  3KXY T;  5LGT A;  2GWR A;  3HDD A;  3RAQ A;  5ERI A;  2GLT A;  1SAX A;  1F4K A;  1CF7 B;  3BR3 A;  2HHH H;  2ZDQ A;  3HOU J;  1QU3 A;  2VA2 A;  3GUD A;  4LB5 A;  1MOW A;  3I4P A;  4I99 C;  4YJ2 F;  3BJO A;  3GME A;  4N4N B;  4LB6 B;  4Q5S F;  2OPT A;  1Z77 A;  2HEO A;  3ABT A;  2X9D A;  1E4G T;  2VQC A;  2CUZ A;  3CCJ I;  1P8L A;  1XSX A;  5M5X J;  2ETH A;  1AHD P;  1FVI A;  4N0B A;  2FLP A;  2RAE A;  2YU3 A;  4U0W A;  1B4A A;  4ECV A;  4DV4 H;  4A3D G;  3OIO A;  1F43 A;  4QWB A;  4DBR A;  4ED8 A;  1X4O A;  4NC7 A;  3I54 A;  2EFP A;  1B6A A;  2DA1 A;  1S29 A;  2CJJ A;  2QF7 A;  3WTW C;  3G6Y A;  3OSN A;  3WTU C;  4FE4 A;  3AG2 H;  1ZG1 A;  2W6M A;  4MV8 A;  2CUJ A;  1H9T A;  1BI1 A;  3BG7 A;  1VDE A;  3AFH A;  4JI0 H;  3GIQ A;  5M3M J;  5F27 A;  3J80 K;  5J8F A;  2NRA C;  1RJQ A;  3I59 B;  3OL3 A;  3EUH A;  2PJR A;  5E79 C;  3CD6 I;  1XMQ H;  2BR0 A;  5A0M A;  3PFY A;  3UFX B;  3PR5 B;  3EUA A;  4Y33 A;  2VOO A;  2FP4 B;  2JEI A;  4A93 G;  1AU7 A;  2FK1 A;  5F04 A;  2GLO A;  4P5O A;  1VQK I;  1ULZ A;  1VBH A;  3S8P A;  4GC7 A;  1HXD A;  3A02 A;  4CCK A;  4Q4Z F;  2HOT A;  3ABM H;  4NB5 A;  1SMT A;  1JT0 A;  5DCM B;  1LFP A;  2OH2 A;  1QHG A;  1WH7 A;  1ZGA A;  4M3F A;  3H5A A;  4UUS B;  1LKX A;  3CCR I;  3RTX A;  3RIZ A;  1LJ9 A;  2O9L A;  1A36 A;  1LE8 A;  4QPQ A;  3ZPL A;  1VQN I;  1ZYR F;  5LMU H;  4Y13 A;  2VS7 A;  2P8T A;  4C2M A;  1A6Q A;  2O61 A;  3AL0 B;  5KG3 A;  1HNW H;  2Y30 A;  2HOA A;  3O3K A;  2ZJQ F;  2HU9 A;  2QBY A;  1JLL B;  5LXT F;  2R87 A;  4HX7 A;  2EWN A;  3MR5 A;  3TMO A;  4C30 A;  3TKY A;  1R58 A;  2ZKZ A;  2XGX A;  1QO0 D;  2PJP A;  2HZD A;  2IGN A;  3ESW B;  4L18 B;  5FKL A;  3HBL A;  3GF2 A;  5A2Q W;  1OCR H;  5CPR B;  3JSL A;  2NAZ A;  2XB0 X;  5IT9 K;  2IW5 A;  1R7M A;  2IA0 A;  5I0A A;  5B1A H;  2CQQ A;  2VKV A;  2ALZ A;  5IYD G;  4AQY H;  1U8B A;  2K27 A;  1R5I D;  4UUV A;  4MV7 A;  3CJR B;  3PO2 J;  1OPC A;  2M7A A;  3ZMU A;  4HOB A;  2W00 A;  4LSA A;  1FTT A;  3KP4 A;  3DKX A;  3W6V A;  5CLS A;  3VYT B;  3KZZ A;  1X3U A;  3DEW A;  2J5P A;  3H20 A;  3BTL A;  4G7Z F;  5IYC G;  1GVJ A;  1E3O C;  1EF0 A;  5KFL A;  2NS8 A;  1IRF A;  1J09 A;  1IJW C;  2NS7 A;  3JRC A;  2KL4 A;  1TBX A;  5LEK A;  3NWS A;  3GTQ J;  3GID A;  4D1Q A;  4ASN A;  3QRF F;  2B63 G;  4OIN F;  5E3L A; 
#chains in the Genus database with same CATH homology
 4DOZ A;  4RB2 C;  2WE6 A;  1XNR H;  1OLT A;  3VSK A;  3A1Y A;  2CW7 A;  4BE1 A;  3JAM W;  3K4C A;  3W3C A;  5K08 A;  1W36 C;  4LF4 H;  1R6R A;  2O03 A;  4U87 A;  4CA0 A;  3ZXS A;  5HOO A;  1WJF A;  4HG2 A;  3BA9 A;  1TA8 A;  2X1D A;  2ZJT A;  3D5S C;  4HST A;  2IMZ A;  1D0Y A;  5FLX W;  4OAZ A;  4DJA A;  4CSW A;  1X1A A;  1V9P A;  3S32 A;  3C2H A;  5KHD A;  1ERD A;  4RMN A;  4IX7 A;  4II3 A;  2LRD A;  3I9V 2;  5AK9 A;  1YX3 A;  4DBQ A;  4UFZ A;  1E0E A;  1GYF A;  3L2Q A;  4KT6 A;  2AQE A;  1ZDE A;  1UG0 A;  3IUO A;  5FRN A;  2OC6 A;  4CC5 A;  3N6X A;  4AYB A;  1D1C A;  1V5E A;  3IAS 2;  4X65 H;  5JHF A;  3DU5 A;  3C0F B;  4KIT B;  2VJ4 A;  3QOE A;  4CZC A;  4OWR B;  4GIG A;  2K3P A;  1SAU A;  4YEJ A;  2M0M A;  3PNT A;  3OYE A;  4DR2 H;  3DU6 A;  1Z3X A;  2M4G A;  4FET A;  2DCH X;  2R7T A;  2JVG A;  2IS2 A;  3C0X A;  4UCS A;  2ZXI A;  4PJL A;  4BUP A;  1X9N A;  3RQ4 A;  3N40 P;  2CV0 A;  2ELJ A;  1FMW A;  2M4K A;  2RRE A;  4RLF A;  5HVQ C;  4NXM H;  1JVA A;  4BQN A;  3DPT A;  1Z21 A;  3QOD A;  2Q2E B;  4RM3 A;  4D9J A;  4EAT A;  3W2A A;  1V5G A;  4IQJ A;  4Z20 A;  4UN7 G;  3E54 A;  2HGS A;  4DR5 H;  2F6C A;  1HNX H;  3LSK A;  4O1S A;  4UT0 A;  1Z2O X;  1U0J A;  3CP8 A;  3W2V A;  2M3A A;  4F92 B;  3MKW B;  3J80 W;  4XL9 A;  3OYD A;  1G9Z A;  4LH6 A;  4ZDL A;  3SEQ A;  2UXC H;  3CMM A;  4BE0 A;  4XN0 A;  2JA2 A;  2LRE A;  4NC8 A;  2E5N A;  4Y3O A;  3BAB A;  2VQL A;  4J0M A;  3ZRG A;  2IGM A;  4I7H A;  4E7Z A;  4LH7 A;  4DR6 H;  3OYF A;  3LMM A;  3BC8 A;  4CCN A;  3EPZ A;  1MI8 A;  3HPH A;  4OX9 H;  5FRO A;  3IP4 B;  4BEH B;  3K4B A;  2V1N A;  2X51 A;  2YCH A;  4LIU A;  2RQQ A;  3LFU A;  2PJR B;  3T1H H;  3D5L A;  5CQE A;  3OWT A;  5A0M B;  2GOX B;  2V26 A;  2CW8 A;  2LOO A;  4B47 A;  2R4G A;  4OZ6 A;  4YIS A;  1BP7 A;  2KZV A;  2MYS A;  2Q1Z B;  2VQF H;  3RGZ A;  3L2V A;  4UN8 G;  3KAL A;  4AAD A;  3PNV A;  2LYC A;  3OYM A;  3QYE A;  4ZTJ A;  4E7I A;  3N41 B;  2MCT A;  4JI2 H;  3FKJ A;  5LMN H;  2BVL A;  1ZHQ A;  5AKM A;  3MIP A;  2RGV A;  4BQQ A;  3OYL A;  4DUZ H;  2DXI A;  2V6E A;  1AA7 A;  2XE0 B;  3LSH A;  3FMA A;  2BVM A;  1N77 A;  3BCA A;  2LCJ A;  4LMY A;  5BR8 H;  4XM3 A;  4HNT A;  2IGK A;  1TZL A;  4ZDP A;  4ZC3 A;  3VSL A;  1LDK B;  2VKH A;  4HRI A;  5D1O A;  2IS1 A;  1N3E A;  4NQW B;  4XLF A;  3HXL A;  2VBN B;  2CV2 A;  2F4V H;  1M0W A;  4B3X A;  2A5W A;  2HPI A;  4H4K C;  3EUH C;  4LF6 H;  2VAS A;  2UUZ A;  4ZDO A;  3R7P A;  3H9J A;  3I3L A;  4EEQ A;  2HVQ A;  1X1B A;  2VLA A;  2CH0 A;  3L2W A;  4BU2 A;  2ZFU A;  4XKB A;  4ZJZ A;  4PFO A;  4AAG A;  2JSP A;  2WBM A;  5HLT A;  3L4J A;  4F52 A;  2FLD A;  4DR7 H;  3OYB A;  1N75 A;  1Z3Y A;  4B44 A;  2KMU A;  3MX9 A;  1P8K Z;  1MND A;  4CCM A;  4DV7 H;  3MMY B;  3C2G A;  1PYV A;  2UU9 H;  1P9Q C;  3LSM A;  2A6T A;  2Z2S B;  2XF7 A;  2VJJ A;  1UEL B;  3DQV C;  2KSW A;  4M7E A;  4ZYA A;  3PSI A;  1D0Z A;  2L2O A;  3LML A;  4Z1Z A;  4NXN H;  2WAQ A;  3U21 A;  3KAK A;  3SZG A;  1WH2 A;  1V5F A;  1NG7 A;  1AN7 A;  1XNQ H;  2CS3 A;  3QYF A;  3QQY A;  4R7R A;  4RLQ A;  2OV7 A;  4DR3 H;  1T0F C;  2P0W A;  3F8N A;  2L8L A;  4XQF A;  4DV3 H;  1HR0 H;  4UN9 A;  4P1W A;  1IBK H;  1WJ5 A;  5FD5 A;  4UNB A;  3OIP A;  1YX5 A;  2WY8 Q;  1DQU A;  2I3Q A;  4XLA A;  3FHN A;  2W7N A;  2ZSI B;  2JNQ A;  2I8D A;  3K70 C;  4JOM A;  4BXF A;  2VBJ A;  3N43 B;  2KEQ A;  3K4L A;  2E60 A;  2R7X A;  3RSN A;  4RB3 C;  1N34 H;  1S9H A;  4MTE A;  4CC6 A;  4LF5 H;  2L9S A;  4PSX A;  2WAE A;  2L5Q A;  2KQR A;  1Y56 A;  4LIV A;  2VB6 A;  3ZQQ A;  3RJ0 A;  3DTE A;  4XNF A;  2XSJ C;  3HYJ A;  5FRM A;  4DR4 H;  3LSI A;  3M4I A;  2JMZ A;  3W2W A;  1N32 H;  4NNJ A;  2DT7 B;  2WAF A;  5KNL A;  2MD0 A;  1S03 G;  3L4K A;  1N78 A;  1MZB A;  3N42 B;  2W1O A;  3OY9 A;  4E7S A;  4GKJ H;  4LF9 H;  1XMO H;  2IXS A;  4B43 A;  2LH9 A;  2HPM A;  3A2K A;  4PDB A;  2VPL A;  1SFK A;  1Y6I A;  4B3T H;  3EH8 A;  3M8J A;  3FBN B;  3QYB A;  5TGT A;  2R7Q A;  2VPS A;  3BAA A;  3OS1 A;  3BLY A;  4BJT A;  5A72 A;  3EYY A;  4RAZ A;  1WJD A;  2BOL A;  4CCO A;  2LBF A;  3FBI B;  4PUS A;  2R7W A;  1GPP A;  2IN8 A;  1B24 A;  4BWS C;  1N3F A;  2UXD H;  3KO2 A;  2W82 A;  3MKZ A;  1Z2P X;  3RGX A;  2VBL B;  3DTI A;  3ZCO A;  2VBL A;  5E67 A;  2CV1 A;  2DT6 A;  5KCM A;  3TBI A;  3K4M A;  1K6Y A;  1BR4 A;  2XIG A;  4DGW B;  5IWA H;  4LFA H;  2K9M A;  2QKL B;  1X1C A;  2X1E A;  4EFJ A;  4JI3 H;  3AKZ A;  2LC2 A;  1TAE A;  1GLN A;  4E7J A;  4NUB A;  4JI6 H;  3M1C A;  3DPU A;  3VDX A;  1BOB A;  4IKF A;  2VUG A;  1HA8 A;  3IAM 2;  1QHH D;  1Z2N X;  2FE3 A;  2IGO A;  2DOA A;  3OYG A;  4A2A A;  3OYC A;  3HKZ A;  2KHM A;  4UCV A;  4Q0Y A;  3T1Y H;  4LF8 H;  3C0W A;  3L2P A;  4HEA 2;  3DEE A;  3CES A;  1J5E H;  1D1A A;  2WYO A;  3DF7 A;  3MXB A;  4LG3 A;  5AKF A;  4JI5 H;  2Q2T A;  4KL5 A;  2Y0S A;  4PK4 A;  4BJ5 C;  4RZQ A;  2VJI A;  2HDW A;  1NG6 A;  4IZZ A;  3A4C A;  3ONQ A;  2KLO A;  4R79 A;  2ZXH A;  4BL0 B;  3JSN A;  4E2T A;  1D0X A;  4QPO A;  1IRX A;  4GRI A;  2VBO A;  4DV6 H;  4J01 A;  2V4J C;  2HVR A;  4JQF A;  3BCB A;  2BW3 A;  3H9Q A;  3OYJ A;  4E7K A;  4ITV A;  3RF2 A;  2AB5 A;  3LSG A;  4PJN A;  1X19 A;  1BGW A;  2Z16 A;  3K6G A;  3E1S A;  4BJ6 C;  1XDN A;  5D1O B;  3F9K A;  1SEI A;  4APM A;  5IT9 W;  5AKN A;  1VS0 A;  2UUB H;  3HPG A;  3KX2 A;  5LD2 C;  1G8X A;  1WJA A;  3D5R C;  4U7B A;  3S3O A;  1DP3 A;  3HC7 A;  2O7M A;  1O75 A;  3MXA A;  4CH7 A;  4HPQ A;  4C9Y A;  4YHX A;  4ETS A;  4PFP A;  4K0K H;  2L7K A;  4XLC A;  3OYA A;  1T95 A;  3CP2 A;  2KPM A;  3LL7 A;  1E4F T;  4KJZ A;  4C2T A;  2VXZ A;  5CQG A;  1D1B A;  2IN0 A;  2LQM A;  3KAJ A;  1I6U A;  5HNH A;  4MLO A;  4XN3 A;  4F55 A;  3OS0 A;  5A74 A;  3K3V A;  2ZM6 H;  4DR1 H;  2UV1 A;  4LSX A;  4RAY A;  2HNH A;  3SEZ A;  4BGD A;  3L2U A;  1AM2 A;  1HNZ H;  4BDY A;  5LFA A;  4XR6 A;  4LF7 H;  1MW7 A;  4UN7 A;  2F5V A;  2LG4 A;  1I94 H;  3VYS B;  5A78 A;  3K70 D;  2LWY A;  2R7S A;  4HSR A;  4AVZ A;  1T9J A;  2UWM A;  2CFO A;  3BG6 A;  4B3R H;  3HL2 A;  2XDV A;  2MC4 A;  1FJG H;  1EA3 A;  3MIS A;  4JI7 H;  4UCR A;  4EFE A;  2UXB H;  4LOX A;  3IFJ A;  2KDO A;  4DUY H;  2XAU A;  4D6N A;  4XOP A;  2GOM A;  1OR7 C;  3OOL A;  3K4N A;  4YY3 H;  4KHP H;  4B3S H;  3PSF A;  2DCE A;  4X66 H;  4PSW A;  2VIX A;  3UNG C;  4F3Q A;  3AL0 C;  1BR2 A;  4O1R A;  1IBM H;  3DLA A;  3OL4 A;  2VBJ B;  4G6T B;  3VYR B;  4DV1 H;  4XOR A;  4XON A;  2LY1 A;  3S3M A;  3DTK A;  4LQ0 A;  4LIT A;  2E5Z A;  1WJC A;  2K9L A;  4UN8 A;  4E2U A;  1X4P A;  1DGR M;  2RNG A;  3TL4 X;  4UNA A;  4PJJ A;  1ZD7 A;  1LVK A;  3KYL A;  2XF6 A;  3V42 A;  2R7U A;  1FMV A;  2OUM A;  5A77 A;  5FPR A;  2Z1D A;  1WJE A;  3S3N A;  2QOJ Z;  2VQE H;  4IAJ A;  1WJB A;  2X6X A;  3OOU A;  3HOS A;  3N44 B;  3K4K A;  4E7H A;  4B3M H;  2CMP A;  3UVF A;  4YHH H;  2W4S A;  3FD2 A;  3DKY A;  2VOB A;  3H0D A;  4OAY A;  3J7A K;  4AAE A;  4JYA H;  4HNU A;  3CJQ B;  3OOR A;  1DGS A;  4DV2 H;  2LY2 A;  3BA8 A;  1AT0 A;  2MFZ A;  3PNY A;  1G59 A;  3J81 W;  1UM2 A;  1MMD A;  1UAA A;  3OYH A;  3OS2 A;  4X62 H;  3HYI A;  2UUA H;  3NZM A;  2X1C A;  3H35 A;  2LBF B;  2VJ5 A;  4RB0 A;  4RM2 A;  4ANJ A;  4AAB A;  2KP6 A;  3FDY A;  4GKK H;  5E63 A;  1LWT A;  4JI1 H;  1MMA A;  4XMY A;  4UNC A;  2IS6 A;  3E0J B;  3RTR A;  3RPU D;  3RCO A;  2OWO A;  2WAD A;  4CUG A;  4PJM A;  3MD2 A;  3VYU B;  2V7F A;  1DFA A;  4AQX A;  1U0D A;  2QKM B;  3OIQ A;  3KXY T;  4F91 B;  2R7O A;  3GBG A;  3H5N A;  4E7L A;  4FM9 A;  1AF5 A;  2HHH H;  1QU3 A;  2K5C A;  3H5R A;  1MOW A;  3L2R A;  1TT0 A;  2PMZ A;  2XF5 A;  4N4N B;  4AU7 A;  4Z1X A;  1MMG A;  2DJI A;  3OR1 C;  1DQ3 A;  4X64 H;  1BR1 A;  3OYK A;  1MNE A;  3N05 A;  1E4G T;  2VQC A;  2CUZ A;  4XKW A;  1B04 A;  5E5O A;  1P8L A;  3OTO H;  5LL6 b;  3MXB B;  2NOJ B;  1FVI A;  1JI8 A;  4KIS A;  4LFB H;  3MKY B;  4DV4 H;  4BAC A;  3G2B A;  3UR3 C;  4DBR A;  1X4O A;  4NC7 A;  4UCU A;  4FAS D;  3PL8 A;  1FKA H;  2VKD A;  3OYN A;  4CCL A;  2X6Y A;  4XKC A;  2VBO B;  3ZR8 X;  1MMN A;  2CUJ A;  2VL8 A;  3BG7 A;  2BW3 B;  3AFH A;  4XLE A;  1VDE A;  1PJR A;  4UN9 G;  2JUG A;  1A0I A;  5D1P A;  3EUK L;  3MWM A;  4JI0 H;  4YRV A;  4JI8 H;  5A0W A;  5CKT A;  2HQA A;  3K10 A;  4BEH A;  3CF2 A;  2VQH A;  3OL3 A;  2X85 A;  1Z7L A;  3HUG B;  2PJR A;  4F93 B;  2VXD A;  1XMQ H;  3PN1 A;  4B48 A;  2M7B A;  3DWL E;  5A0M A;  4UCO A;  3PFY A;  4DV5 H;  2WDT A;  3EUA A;  4Y33 A;  2O5R A;  2ZSH B;  4N4O B;  1LWS A;  4P5O A;  3S8P A;  5HNF A;  4X0G A;  4GLX A;  3J7A Y;  4CCK A;  1ZHS A;  1SYX B;  4EFB A;  4BQO A;  2XE0 A;  3S93 A;  1LFP A;  4Y4R A;  5FPO A;  1QHG A;  2EX5 A;  3DPL C;  2W57 A;  3H5A A;  3RTX A;  1LKX A;  4E6K G;  3ZGK A;  3RIZ A;  1N33 H;  5LMU H;  4QPQ A;  2XC7 A;  2VS7 A;  1VZ0 A;  1ZEL A;  4ZTF A;  2VBN A;  4IQ4 A;  4E4H A;  4II2 A;  3HOT A;  3AL0 B;  1HNW H;  2E1M B;  3OYI A;  1DGW Y;  2HU9 A;  1BJT A;  4DIQ A;  2AQF A;  4YEL A;  4XOT A;  2V9K A;  4AAF A;  1KON A;  1X1D A;  3TMO A;  2MAB A;  2IS4 A;  4C30 A;  2IN9 A;  2R7V A;  2FUG 2;  5E5S A;  1G9Y A;  1M5X A;  4A2B A;  2HZD A;  2IGN A;  3CZ6 A;  3H9G A;  4AQU A;  5A2Q W;  2L9N A;  5CPR B;  4UCT A;  3JSL A;  2VQG A;  1T9I A;  4CCJ A;  2R7R A;  4BS9 A;  2KRC A;  3NWT A;  4XLH A;  3SYT A;  3VWB A;  2WB1 A;  1U0C A;  5FD6 A;  3UQ8 A;  1R7M A;  5I0A A;  4C2U A;  2WA0 A;  4LFC H;  1N36 H;  2WY7 Q;  3IGD A;  4AQY H;  2Q2U A;  2E5L H;  3KEY A;  4MV7 A;  3CJR B;  1YE9 A;  3HG9 A;  3IG0 A;  3SDB A;  2M7A A;  4BDZ A;  4RB1 A;  2RGR A;  2W00 A;  1M0T A;  4MV9 A;  4LSA A;  2F4I A;  1W36 D;  3DKX A;  1WFX A;  3VYT B;  2E1M C;  4DV0 H;  2JVH A;  3PUB A;  5EOY A;  4D6O A;  2VS8 A;  2UUC H;  4JV5 H;  3H20 A;  3PJR A;  1IBL H;  4KL6 A;  4MTD A;  2HVS A;  4J00 A;  4XKV A;  1EF0 A;  4YIT A;  2KRH A;  1J09 A;  3K4J A;  1S68 A;  3CVZ A;  2KL4 A;  4BE2 A;  2I3P A;  3OR2 C;  3NWS A;  4JI4 H;  4D1Q A;  3OMY A;  1L2Z A;  2X6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...