2CW7A

Crystal structure of intein homing endonuclease ii
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
537
structure length
537
Chain Sequence
SILPEEWLPVLEEGEVHFVRIGELIDRMMEENAGKVKREGETEVLEVSGLEVPSFNRRTNKAELKRVKALIRHDYSGKVYTIRLKSGRRIKITSGHSLFSVRNGELVEVTGDELKPGDLVAVPRRLELPERNHVLNLVELLLGTPEEETLDIVMTIPVKGKKNFFKGMLRTLRWIFGEEKRPRTARRYLRHLEDLGYVRLKKIGYEVLDWDSLKNYRRLYEALVENVRYNGNKREYLVEFNSIRDAVGIMPLKELKEWKIGTLNGFRMRKLIEVDESLAKLLGYYVSEGYARKQRNPKNGWSYSVKLYNEDPEVLDDMERLASRFFGKVRRGRNYVEIPKKIGYLLFENMCGVLAENKRIPEFVFTSPKGVRLAFLEGYFIGDGDVHPNKRLRLSTKSELLANQLVLLLNSVGVSAVKLGHDSGVYRVYINEELPFVKLDKKKNAYYSHVIPKEVLSEVFGKVFQKNVSPQTFRKMVEDGRLDPEKAQRLSWLIEGDVVLDRVESVDVEDYDGYVYDLSVEDNENFLVGFGLVYAHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of intein homing endonuclease II encoded in DNA polymerase gene from hyperthermophilic archaeon Thermococcus kodakaraensis strain KOD1
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Endonuclease PI-PkoII
total genus 160
structure length 537
sequence length 537
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2005-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14528 LAGLIDADG_3 LAGLIDADG-like domain
A PF14890 Intein_splicing Intein splicing domain
A PF18714 PI-TkoII_IV DNA polymerase II intein Domain IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1010 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2cw7A02
2.170.16.10 Mainly Beta Beta Complex Endonuclease - Pi-scei; Chain A, domain 1 Hedgehog/Intein (Hint) domain 2cw7A01
3.10.28.10 Alpha Beta Roll Endonuclease I-creI Homing endonucleases 2cw7A03
3.30.1490.210 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2cw7A04
5I0AA 1G9YA 1ZDEA 5AKNA 4YISA 1B24A 1EF0A 3C0WA 2LQMA 2JMZA 2XE0A 3MXAA 1UM2A 5A0WA 2VBNA 4LQ0A 5A77A 1T9JA 4UN7A 2VBJA 5AKFA 4E2TA 2VBNB 5E5SA 4UN8A 2VBLB 2IN0A 2XE0B 1MOWA 4UT0A 3EH8A 2O7MA 4YITA 3MXBB 5E5OA 4Z1XA 2JNQA 3KO2A 2VS7A 4AQUA 1U0CA 5AKMA 4Z1ZA 5A78A 4UNAA 2FLDA 5AK9A 5A0MA 4AABA 2IN8A 3C0XA 2EX5A 2CW7A 1LWTA 2VBJB 2QOJZ 4UN7G 2IMZA 4YHXA 4KL6A 5A74A 1N3FA 3QQYA 4GIGA 2VBLA 4D6NA 2DCHX 1G9ZA 3IGDA 4UNBA 3MISA 4D6OA 2I3QA 2IN9A 2AB5A 4UN9G 2I3PA 4Z20A 1AT0A 5E67A 3R7PA 4O1RA 1U0DA 1DFAA 4AAFA 4UN8G 1VDEA 1DQ3A 3MIPA 2LCJA 1ZD7A 2VS8A 4AQXA 2L8LA 3MX9A 3HYIA 4UN9A 4LOXA 1AM2A 3UVFA 4E2UA 3OOLA 5A72A 2LWYA 3E54A 4AAGA 3NZMA 3OORA 1BP7A 1T9IA 1AF5A 1GPPA 1MI8A 2VBOB 1P8KZ 1R7MA 4KL5A 1N3EA 5A0MB 2VBOA 4AAEA 4UNCA 4OZ6A 3IFJA 4EFJA 1M5XA 3HYJA 4AADA 3MXBA 3FD2A 1JVAA 4O1SA 1LWSA 5E63A 2KEQA 2CW8A 5K08A
chains in the Genus database with same CATH superfamily
2VBXA 5I0AA 2LP0A 4ZYHA 4M6XA 4UUSA 1OCPA 3GIDA 4PDKA 4MO7A 1VQ9I 4NXMH 4JBAA 2UXXA 5FKKA 2UVVA 4BY1G 3CCJI 2ZC2A 1X2NA 5EDNA 3GTGA 3CJQB 2E60A 2QBYA 1YE9A 2LY2A 5EWFA 3ZQCA 1N78A 5DQIA 3N44B 2FNAA 1IN7A 2X51A 3FXOA 5EZYF 4I0AA 4XIDA 4LIUA 3WU2C 2CV1A 3S16J 3HOZG 5DQHA 1EHIA 2EH3A 4YP3A 3I56I 1V3FA 3L2UA 1I3QA 5KFVA 3PO3G 2WAFA 2GA1A 4B44A 3SEQA 1Z3YA 2CJJA 2XRNA 3OL3A 3OOPA 3S1QJ 5KFDA 1RK5A 3LQQA 2QM3A 3H4BA 5L1JA 4ECVA 3BR1A 4R8HA 2ELKA 3HBLA 4DBQA 5LRSA 4B43A 4MEYF 1VQLI 3CCEI 1Y1WJ 2MCTA 2DMQA 4U0VA 3DBLB 3RPUD 3V7SA 2DMUA 4U0YA 1I27A 4Q4ZF 2R7TA 2DOAA 4B3RH 5D6EA 5AKMA 1ZLJA 1CGPA 2WB1A 2XGDA 3N43B 5IT3A 2IA6A 4AM3A 5J3LA 1VZ0A 1S0MA 2QYOA 5FLXW 3GTLA 5IYBG 4JYKA 4YIIA 2DOEA 4ITVA 2WWYA 2VQCA 2DZDA 4M3FA 4PJLA 3EETA 1T8IA 1RC9A 3FXLA 4IEJA 4UCVA 3JSPA 1IXCA 4M9SA 2V5AA 4JI5H 3H4DA 1F43A 5BPFA 5KFNA 1SFXA 2DCHX 2JA7A 1WJEA 3ERED 1W4MA 3MISA 1UHSA 2VIXA 1DGRM 5ICFA 2ECCA 2O5RA 3O2PE 2OZ6A 2WE6A 4XYMB 1TWAJ 4MFDA 1H9GA 4G7OF 4XLCA 4O5VA 2IN9A 1MBEA 2EB7A 3K4JA 2H1LA 4P1WA 1R1VA 4UUTA 5HLIA 3TO6A 4BHBA 3ZXSA 3J80K 1XN7A 2IP2A 3WTSC 1VFCA 4Y52J 5E67A 3MR3A 4IR1A 2OWOA 1R1TA 2UUAH 3RB0A 1VDEA 5KG1A 4XBFA 2HQRA 4XKWA 3RZOJ 5HVQC 1GUUA 4LSXA 3K7AJ 2XSJC 4ME6A 2VN2A 4Q8FA 5L1KA 1Z67A 2R7DA 4NUBA 3OS2A 2W9CB 1S03G 2W9BB 2QSGX 2C28A 2Z3YA 2V9WA 1ZR2A 2NU7B 4KISA 1T94A 5A72A 4G94A 5BPHA 4MV9A 3RYRA 3ECHA 3RGXA 2F4VH 2JA8G 4V2FA 2IS6A 4U7CA 2CUEA 3BG6A 5HDNA 3J81Z 4YBZB 5LA6F 3ZQFA 1X9NA 1BM9A 4JI7H 4IXAA 2CW0F 4P96A 1RKTA 2DPJA 4L5IA 3EQLF 2W9CA 3L00A 2XROA 3GTKJ 2Q2EA 1JT0A 2IJLA 4I0BA 2V26A 2DFEA 1IBKH 2BXYA 3VODA 4XK4A 4BYYA 3ETJA 3MWEA 2FLPA 2PMZN 4J9QA 5LEJA 2GPSA 3JRIA 3R6SA 2HZDA 2NS7A 1FPQA 2EJRA 3M07A 2W71A 1MBJA 2L9SA 1WSUA 2IAIA 1MBFA 1LKXA 4BL0B 3H0DA 2C35B 5KFTA 2GIZA 3DCFA 3U1DA 4IO9F 1FSHA 3I5UA 4BKXA 1PDNC 4YY3H 4A3EG 2L9VA 2UXNA 2YU9J 4A3GG 2ID3A 1DP7P 2OU2A 5LLQA 2WYOA 5DEQA 5KHDA 3MR5A 2VONA 1I6HJ 1FTZA 5KFYA 2JA6A 5CVJA 4BY7J 1JKRC 2F5CA 3GV7B 3GTJA 2ZNZA 1OYIA 3K0LA 4V19K 1W7PD 4MHGA 3IAM2 2W6ZA 4NC6A 3JRCA 5EWGA 4M6YA 1AUVA 4PFPA 2ZJQF 1KJIA 4BDYA 4QJFA 2VUMG 2P5VA 4BE2A 2DA5A 1JDBB 1TW2A 1TAEA 4A3IJ 2PG4A 1IC8A 3Q3SA 2GPWA 2E2HJ 4MAMA 2C00A 3DKYA 2MA3A 1QZYA 1WCMG 4YR0A 4N9IA 5KT5A 2JA7J 2ASLA 1B4AA 1QZEA 2JNQA 2L01A 3T5HA 4YQWA 1XDSA 3I4PA 4W1UA 5D8KB 3AL0C 2HXOA 1KQ8A 2FLDA 1BIAA 1A6QA 3DEUA 3F0CA 3GCMA 4B8XA 2STWA 4ECTA 4HBLA 3ZQHA 1JXSA 1FP2A 2BY0A 1WKMA 1B8IB 2O7OA 4UV9A 1V4YA 2J6SA 4GRIA 1G2HA 4WXHA 2W70A 3S3MA 1PJRA 5FRMA 4OAYA 2PMZE 1LFPA 1DQUA 3CESA 3DV8A 1KC7A 3JTGA 1FMVA 3FBNB 3DU5A 3WTXC 1ZETA 3VSLA 3LA7A 2O6GE 3CDIA 4ECSA 4LFCH 2IGNA 4Y7NJ 4PCQA 2A05A 3IV5A 1ZHQA 1FWZA 2MH2A 2V9PA 4IF4A 5E3NA 4A3GJ 1PVEA 3N4MA 1VQKI 4F3QA 2E71A 2YRXA 4YFNF 2MYSA 4Z20A 1FIPA 1AT0A 3SDBA 1K1QA 3PJRA 3RV3A 4HAMA 4D0PA 4A3KJ 4IHXA 1MNMC 3Q0UA 2GM4A 3ONQA 5D1OA 5JH7F 1EH8A 2MW8A 2OTLI 3GIJA 4XLHA 4E7KA 3M1EA 2OCEA 2Q1ZB 3S1RJ 2MLGA 5C8YF 4J9MA 2XB0X 4F4ZA 2XCPA 4A3IG 4XM3A 3UVFA 2KISA 5LOVF 5JVDF 4AU7A 3HTSB 1S7OA 1N75A 2EPFA 4HZFA 5DD4A 2P6SA 3L4KA 3HOYG 3DLLF 1AF5A 1FJLA 1FYLA 5DUKA 1WJAA 2P7CB 1TQPA 2HPIA 4ZZLA 1HF0A 1HSTA 2VUGA 1N3EA 5IYDJ 2QLZA 4U7BA 1VBHA 3TQNA 4GLXA 1XDUA 2VBOA 4O3SA 1FZPB 2QZ8A 2ZDQA 1G3TA 4IKFA 4DV3H 3ABUA 2YPRA 5ILVA 4B3SH 4ZYDA 3IC7A 2NU6B 2EFPA 4UV8A 5K08A 1QO0D 1FOKA 3OIOA 5JVTA 6PAXA 2ETHA 1ZDEA 1HSJA 3U9SA 1BR2A 3GTMJ 5AKNA 2K02A 1BOBA 5LGTA 1IOVA 3L2VA 2KFDA 1QZZA 3CQZJ 1MJBA 5K5RA 3RDIA 3WO1A 2R6FA 5K5QA 2R8IA 2BW3B 3KZZA 1VQ6I 2L0KA 3H40A 4ECXA 5EZHA 1HDDC 4DUYH 3COAC 1XS9A 4PGHA 3T8RA 2NVTJ 4LF4H 1S10A 3KHGA 3GMEA 2A3SA 2EA2A 1QPMA 1T3NA 2L9NA 1WVRA 1VQNI 4ZH4F 4U6PA 3NARA 4QW8A 3LWFA 1G3YA 2KL4A 2MBFA 2KIUA 2W25A 5M3FJ 4WX9A 4CDGA 3CVZA 2O7MA 5HOOA 3JTHA 1MMDA 3R5HA 3OYDA 2PJRA 2FF4A 1BGWA 4AD9A 2QSHX 5J47A 4AIDA 4BQAA 1FC3A 4P55A 4IL6C 5CB4F 2AGPA 1BL0A 3BWGA 1FEXA 5AK9A 1DIKA 1L2ZA 4ECYA 5A0MA 2XV4S 1G8XA 1WJBA 2VJ4A 2VASA 3A01A 2UVWA 1JUMA 4RA2A 3CCVI 2LTPA 1DV1A 4NBQA 2PJRB 1ERDA 4UN7G 3PN1A 5FPRA 1K83J 1B9MA 5ED4A 5F04A 4I02A 2P4WA 1HC8A 3IG0A 5KX5F 2IP4A 2HDDA 4ABZA 3G73A 3CCUI 1MNDA 1A0IA 1XMKA 2XD4A 2R8HA 5KK1A 4P9UA 4XX0B 2DOFA 3JZIA 1Z3XA 1FOYA 3E7LA 3H9QA 5J40A 1OCCH 2CUJA 2LC2A 4HX8A 3ULQB 3GX4X 4PUSA 2DT6A 1KJ9A 5E1WA 4Y13A 1YW7A 3OYAA 3DF7A 4HF1A 4BBSG 3F8NA 1ZAOA 3PQKA 2M05A 3GLKA 5KT7A 3R4KA 4NC8A 3HOTA 4BEHB 1BI1A 2JA5A 1O3QA 2ZKZA 5D1PA 1OQYA 1P7IA 2OUMA 2DBBA 3ABLH 3EYYA 1QVTA 3T8TA 2UZKA 2R7XA 5EEGA 2VS8A 1HNZH 3MZ8A 3OYKA 1DDNA 2Y30A 1X1PA 1JHHA 2H27A 5DYMA 1AM2A 4LF8H 1E0EA 1U8RA 2OC6A 4C2MA 1RYSA 2V6EA 3E54A 3NWSA 3ZQ7A 1WJCA 4E7HA 3VPCA 5KAIC 1LE8A 3PW7A 3ZGKA 1AOYA 4GC7A 1TZLA 5J2TF 5EEHA 4CUGA 1MBGA 4A3LG 2H1KA 4YIFA 2VLAA 4A6EA 2R85A 2YSRA 3BA8A 2CQQA 4AVPA 1EH7A 4IAJA 3GTPA 3PSFA 1S68A 4ECZA 2PI0A 2L2OA 3BQ0A 1GYFA 1Q1HA 1V54H 2DFIA 5H20A 3VPRA 2ZXJA 3PW4A 3DU6A 3HM5A 2F5FA 3RAQA 4G12A 2ESNA 1VS0A 3VDXA 3V42A 4EVIA 2ZJTA 3QPTA 1XCBA 1N56A 1PUFB 2FLNA 4Y15A 5IYCJ 3JRFA 3FXMA 2FBKA 2Y0SA 3RV4A 4J19A 3DFGA 1V5FA 4AUXA 4RB3C 5CKTA 3ZMSA 2ICWG 4J9KA 2NRAC 4CCOA 1BR1A 3GZ5A 1B72A 5KFFA 1J5YA 4MA0A 5A0WA 5LHGA 3PZPA 1PP7U 3KCCA 4LQ0A 1IN6A 2VBJA 3BY6A 2CU7A 4RMNA 1IF1A 1KYZA 4DV6H 1IN5A 2W7OA 3KYDB 3K2AA 2Z33A 2VBNB 1OCTC 4ANJA 1IN4A 5FLXK 1GV5A 2EINH 1VQ4I 2HOSA 2IEKA 2E19A 2G7UA 3Q0VA 4RBOA 3ISPA 5E5OA 2KRFA 2I8CA 3TQTA 3K2ZA 2R7ZJ 4ED0A 1HKQA 5KFSA 1FVIA 3M1CA 2H8RA 4E70A 1SD6A 2A6TA 5JLWA 1KU7A 2ME0A 1WFXA 3HSFA 4A93J 1Z2NX 2VQEH 1R36A 2EILH 2VKEA 1V51A 4FHTA 2O8XA 1YG2A 4AQYH 2XKOA 3LP8A 3OYLA 4D5CA 2V4RA 2CZGA 2VOPA 5J1UA 1X2MA 1R6RA 3VYUB 2GXAA 1UC8A 3FXKA 3Q8RB 2YX4A 4DL5A 5DM6F 3L09A 2W9AA 5A2QZ 3RTXA 5BOXA 4RM2A 1HW5A 2J9GA 3S32A 1TWFJ 1ZK8A 5FFXA 2HHHH 2DI3A 2E34A 3PO3J 3ETHA 2DDAA 3WGGA 4XQFA 4H4KC 4YEJA 2I10A 1MNEA 1ETXA 3RJ0A 4IR9A 4Q8EA 3BT9A 3ZR8X 1F1ZA 1CF7B 2EZKA 4LMYA 3PR4A 4LX3A 2P5KA 2YUSA 3RKWA 5C4XJ 5E1XA 5LMUH 3HRMA 4RB0A 4UB6C 2JA2A 2I8DA 3CC7I 3ZQIA 4FTHA 4HPQA 1ZGJA 3W6KB 3TO7A 5C4XG 3BTLA 3M9NB 3V4ZA 4MFEA 4ESJA 2NOGA 5KT3A 3GFJA 3JRXA 2Y2ZA 1EUDB 2JSPA 4XKCA 2VJJA 3ZP5A 1SVLA 1K78A 2HZTA 3ASOH 3BA9A 5EG0A 4K2EA 3OORA 2E2JJ 4MV8A 3CUQA 3D5SC 1DP3A 3BJYA 5L1IA 4EJVA 3HOXG 1IV8A 5JHFA 3PM1A 4U87A 2DODA 2K27A 1WJDA 5F0HA 1QHHD 1XGOA 3D5LA 1W0TA 2VUMJ 2KRHA 5JI6A 2CGPA 3NQOA 3FZVA 5FLXZ 4RGSA 2R5ZA 1JVAA 4ENMA 1MSFC 4XL9A 2RQQA 3GTJJ 2P81A 1PYVA 5E3OA 2KEQA 4EEQA 2WAQN 2VT2A 4LD5A 2YX7A 3GTGJ 3R5XA 4LFBH 5FB2A 4TQSA 5GP9A 2C6YA 4IX7A 1ZKGA 3IH3A 2AU0A 4A3CJ 3E5XA 3OYJA 1BNCA 3HKZA 2FB9A 5KFQA 4C3HJ 3VMMA 3S2HJ 3V6HA 4I01A 3MR2A 2V9KA 1T0FA 1VTNC 2R82A 1E3OC 2AS5F 2L5QA 1X1BA 3ELKA 3T1HH 1TP4A 3BCBA 3LSRA 4MNUA 1YS7A 3Q5FA 1J9IA 2NVYJ 1T9JA 4GC6A 3QZ8A 2KDOA 3JRWA 5M5YJ 4UUSB 5LEKA 1LVAA 3FK6A 2ASDA 2X48A 1U9OA 3CZ6A 3CMAI 3T0YA 4OU0A 4UN8A 2O9LA 1Z6TA 2F5VA 1QNTA 4AYBA 3EH8A 2PX9A 1JJ6C 1J75A 3RF2A 1S6LA 4HX7A 1WI9A 1TWHA 2E5NA 2V58A 4DV0H 2UVUA 4MEXF 3DKWA 2VS7A 1EV7A 4MTDA 3KHHA 4BDZA 4NHJA 4A3KG 1TWGJ 2CQKA 3VYRB 2R93G 1H89C 3KE2A 2XHKA 1N25A 5E17F 3GW2A 2HEOA 2R7NA 3E5NA 2OD5A 4KDPA 2PMZA 4CCMA 2Q2UA 4ZDPA 4HLYA 1W36C 1ZREA 3IAS2 3U1KA 3RBDA 2EIMH 2BHYA 3SEZA 3HOWJ 3GTQA 5DG8A 4L0ZB 2BXZA 5D5WB 1KJJA 3PNVA 1ZR4A 3CJTB 4ZC3A 3C0FB 3G6VA 2CUZA 4D6NA 4LH6A 2M5WA 3QAHA 2R7RA 4LB5A 2WADA 3LAJA 4D6OA 1VQPI 2I3QA 1I50J 2WY8Q 1V5GA 2CMPA 2BVLA 1N34H 1VBGA 2V6CA 4RLQA 1X19A 2JTVA 3JRHA 3A2KA 3BROA 4MQVA 3EPZA 4RUCA 2D1HA 3KP7A 5HS7A 4A5NA 4DL2A 2BGCA 4O4HF 1DU6A 3SXYA 4ZJZA 2E1OA 2Y9ZA 5TJJA 4PSXA 1IAWA 4Q48A 1DFAA 2W7PA 2LY1A 2X6OA 2HGCA 1L3LA 3FXQA 5F1RA 2HQNA 2YZMA 2XB5A 1K83A 4II3A 4KIGA 4LOXA 5GAHJ 4U0WA 4M73A 2HNHA 5IP6A 2QEXI 1O3TA 3FDSA 2QCOA 3MJFA 2PQ8A 1EUCB 3TGNA 3IL2A 3HEFA 2OCCH 3RAXA 1XG1A 3GTLJ 3QP6A 4DIQA 3FHNA 3OYEA 4UVBA 3I55I 1XGSA 3BR3A 4O3NA 4BXXG 2Y48A 2PEXA 2VBOB 4I98B 2RQPA 1P8KZ 3OY9A 4Y8VB 1SANA 2KJCA 4LK1F 2DTRA 3GIQA 5KFOA 2I5UA 3I4NG 2CQYA 4RNNA 2FD5A 4UCUA 4EM0B 4UNCA 3F6VA 4X66H 2NVUB 5F27A 1YOVB 3S14J 3I4NJ 1OR7A 4O3OA 4CZZA 4O1SA 3H0GA 2MABA 4DNCA 2O0YA 2XKPA 1B59A 1TC3C 1UM2A 4A2BA 4EATA 3KP2A 2LKXA 1AA7A 3G1MA 2LD5A 2BR0A 3RJPA 2IS4A 1Z9CA 4O3PA 3KTMA 1H9TA 4B3AA 4OINF 1XSDA 1YHQI 3ZMDA 3NEUA 1WH2A 3W6JB 5E8GA 3QWLA 5E20A 3I59A 2AXTC 1LQ1A 3U21A 1NH3A 3S3NA 5FKLA 1R5GA 2L02A 1X1CA 1X1AA 2JSCA 1P7JA 3QOPA 4RAGA 4Z6YA 5FD6A 1D5YA 2B63G 1NG6A 1MIJA 2W00A 3GLXA 2X4HA 4I55F 1RETA 1D1BA 3KP3A 2FX0A 2XF7A 4BJTA 4O3RA 4I76A 5LRRA 5EF6A 5EG0B 5FJ8J 2B63J 1LEBA 4L9VA 5IPAA 2IS1A 1I5ZA 5DLFA 1UG2A 3HRSA 3I59B 4LH7A 3TQ1A 4F91B 3CMEI 2FMLA 4EGQA 3V7RA 1BBYA 1E3PA 5KT4A 2HYJA 2P7VB 5CVRA 4RLFA 4A3DG 2HWVA 3R0AA 4KN4X 2IS2A 4BE1A 2V4QA 2KLOA 4HQEA 4BQQA 5BR8H 4DOZA 1X3ZB 1D3YA 2C2DA 1BOAA 1ZRDA 2DQRA 2HR3A 2YR2A 1U9NA 2IA0A 4DV4H 4TV9F 3VFZA 4NLGA 4FX0A 5GAEJ 2HU9A 5M5WJ 1HBXG 3RZDJ 1VNDA 4A5MA 4A69C 4XN3A 4KL6A 1SCUB 3CJNA 4PK4A 2Q8KA 3RIZA 4UVCA 3SHFA 3ZQLA 1FIAA 4CYCB 4JP0A 1HW2A 2DWCA 3AFHA 3RSNA 5BNGA 3BQ2A 2KKOA 5FRNA 2FU4A 3QYEA 4JV1A 3GZNB 5HS9A 3R60A 4TQRA 3K4MA 2LR8A 4EEFG 1FT9A 1S97A 4GCVA 1Z2OX 2Y0SE 4AIKA 5ILSA 1J2XA 2XF5A 1YJWI 1BC8C 3SZGA 1Y56A 1TT0A 2GZWA 3D0SA 2JRMA 1BJAA 4AQXA 2XIGA 2L8LA 2XPUA 4ZOLF 3IH4A 2LF8A 3KZIC 5ICCA 1RJQA 2L7MP 2HXIA 3ZRGA 5CA0F 2VJ5A 2X0SA 3PW5A 2XCLA 2NYXA 3RPUA 2FUG2 1UAAA 1XTAA 1WI3A 1GGOA 1IUYA 1BP7A 2VBZA 4ZTFA 1LB2A 1BA5A 4Q45A 1J59A 1ZN2A 2LKPA 5FLVA 1B6AA 5DM7F 1XX5A 2EFWA 4KL5A 3RQIA 4CHUA 2JQ7A 4N0BA 1U2WA 5CVUA 5TRDA 4XONA 4XMYA 2YU3A 4OZ6A 1VF9A 3F9KA 4Q0YA 2LBFA 3FXRA 4QW9A 3M4IA 5B66C 2E1MC 4P5OA 1K6OA 3GV5B 2WA0A 2WBMA 4HSTA 1YO5C 4IHJF 3C3WA 5JQWA 4J9LA 2B63A 3M9AA 5K2MA 4BNCA 2W6PA 2CQ7A 1TLHB 4QIWE 3OYHA 2WAQE 4ED6A 2DA6A 2PMUA 3ZN0A 1O3RA 4EJUA 2RNJA 3MZHA 4OIPF 2DYSH 4BQOA 5IP7J 3BR0A 4DV5H 4ED8A 1RYRA 2VKVA 3HOYJ 2V79A 3H3ZA 1ZLKA 4LK0F 2VB6A 4RAFA 5F64A 2XE0A 1WHUA 3MXAA 4F4WA 4ED3A 2E5LH 1RR7A 3P5JA 4UXNA 4R7RA 2R92J 2DMTA 1DUXC 2ELHA 4M74A 2CSOA 3RKQA 4L18B 1EA3A 3HTUA 5J1YA 5C3EJ 3J80Z 3S2WA 2K85A 4IRGA 2BBYA 1T98A 2XF6A 4HNVA 2M8GX 2UVRA 4M3EA 1W5TA 5JLXA 4E2TA 4C30A 3D5RC 3WG7H 3VPBA 4BH9A 1JKQC 4CYCA 2IN0A 2XE0B 5KFAA 1ZQ3P 1HXDA 1U0JA 2X1DA 3CCMI 3BJAA 2V1NA 5KFUA 2AQEA 2W57A 4BHPA 1UB9A 1LDDA 1UFMA 3V6JA 4XSZF 4UNAA 5EZGA 1ETWA 3KPHA 4X6AJ 1TWCJ 3J81K 5L3CA 1USSA 4EEYA 3FKJA 4AABA 1Y1VG 3C0XA 5LBQA 5IT9W 2EFOA 2KZVA 2EX5A 1OYYA 1LDKB 2A61A 2FBIA 3Q9SA 2VBJB 4E4TA 4QIWA 5D5UB 1NHAA 2IA2A 4BBRG 4B3TH 4Y3OA 1ZHSA 1WGXA 1E4GT 3DTKA 4EYHB 2PMHA 1ZRFA 5BMVF 4ENNA 2ZBKA 3PW2A 2VXZA 1JUPA 3OSGA 5CLSA 3MWDA 2DK8A 1WRJA 2EA4A 2K9MA 3C2BA 4QIWN 1P4WA 4QWDA 1AKHA 2HOTA 2I87A 3D1NI 4IRKA 3RQ4A 5KFZA 3FBIB 1SD7A 1UJ8A 2H6BA 2JUGA 2MC3A 3FWEA 4B3XA 1BI2A 2KIMA 2HDWA 3WGIA 2RC4A 2NUAB 2K9LA 2WV1A 2CFXA 2ZFUA 4BACA 3V4GA 1SFOJ 3KEYA 4JI2H 4W97A 1FYMA 2GIVA 4XLAA 1ETYA 1ZD7A 3QZ7A 3HZJA 1E3HA 2V9VA 4Y33A 3HYIA 2JZYA 2CV2A 4A3MJ 3GTQJ 4U88A 1YRNB 1CQJB 3OYIA 3LWBA 3L2CA 2PLYA 4KT6A 3HDDA 3F8BA 2QUFA 1HDPA 2VQHA 2FK3A 1I3AA 3FISA 3BG7A 3K3PA 3BC8A 4J0MA 3TW6A 1RI7A 1KA8A 4MTEA 3GTPJ 3F21A 1YIJI 2UV1A 4RGUA 1B6SA 2UXBH 3EDPA 2PJPA 3MEXA 5BS6A 4HDVA 4GDFA 4QWQA 5F0FA 1MD0A 4O4LF 1BN5A 2F4LA 4E7SA 4I09A 3K1PA 1R71A 3HB9A 3AKZA 3LSHA 5JR3A 1XGMA 5KFEA 1ZQ7A 1SMYF 1RESA 3H5NA 3WU1B 1BC7C 3QPHA 3JREA 1A6IA 4QPQA 4DUZH 5DG9A 1SMTA 3R61A 3HYJA 3G6EI 1ZTRA 1BW5A 3V4SA 3K5IA 1RPWA 3MN2A 3MQ0A 3LSKA 3TL4X 4BS9A 2JEFA 2NVYA 1I6XA 4ZHQF 2QWWA 4V2GA 5DCFA 1GDTA 4WCGA 5K7ZA 1ODDA 2F4OB 2VPQA 1XMQH 3J81W 1S9HA 4N4NB 3EUHC 2COBA 3WHBA 3OMYA 3S1MJ 2VOOA 4E7ZA 4CCKA 3GTOA 3I3LA 1Z77A 1LPQA 5B5EC 3HOXJ 3BR2A 2H94A 2MC4A 2R93A 4CXFA 3TBIA 3WTYC 2F6CA 2R5ZB 1M1EB 1U3EM 4X0GA 2W82A 4WWCA 2K9SA 4JOMA 1T2KA 3S17J 1K61A 3H5AA 2DAOA 2MD0A 3VEPA 3OSNA 1BR4A 2YL2A 1KU2A 1QVUA 4JX6A 2NVXJ 2XAJA 1Y1WA 5KAFC 2DYRH 2A5WA 5LFAA 4JV0A 2M3AA 2EIJH 4LF7H 2IMWP 2BQUA 5LL6b 2XCAA 2RF4A 1KEEA 3Q8SB 2TRTA 2NOJB 3Q2OA 3ZOBA 4ASNA 1LVKA 2LK2A 4R8UB 4CCJA 1RKWA 3TIIA 1HQCA 5DUIA 4MGRA 4ED1A 2QA4I 4CCNA 3QRFF 1MBKA 2CRGA 4G3IA 2FPPB 4LSAA 2EV5A 4A2AA 2R7VA 3Q9VA 1H88C 2M34A 4MIMA 4J00A 4CGZA 3GIKA 3GO5A 1J5EH 4JX5A 2HYFA 3IRRA 4A3JG 3LA3A 5DDGA 5LHHA 3CO6C 2AXLA 2Y69H 2STTA 2JA5J 1X1DA 3UFXB 1T0FC 5I47A 4HEA2 4RM3A 4KITB 2KIFA 5ICEA 1DPUA 1J7KA 2FJ1A 3FXJA 3FF5A 3PFIA 1KZHA 1Y1WG 2R7WA 1YI2I 3LSGA 3CDHA 4LG3A 1FY7A 3QYBA 2OA4A 2W48A 1RNLA 2DA1A 2DT5A 3B02A 3BG5A 2B0LA 4XLPF 1YQAA 2CQNA 3RKXA 2J6TA 1JGSA 1SC7A 3H92A 4PSWA 3BCAA 4GKKH 2FBHA 3MIPA 2V1XA 1OJLA 1IN8A 2K9QA 2EZLA 2QENA 4APMA 3GEZA 3LSIA 1Z7UA 2IBDA 1JDEA 2SCUB 4IZZA 1K4TA 3LMLA 4HYKA 4C2MJ 3QODA 4A0XA 2K7LA 4LJZF 2QYZA 3UR3C 4DYCA 2JA7G 3HG9A 2XGPA 1OPCA 3BABA 5FPOA 1XSXA 1MJAA 3ASNH 1TQMA 2R7FA 2XAQA 3WE3A 5IYDG 3CCYA 3GF2A 4AYBN 2HJWA 5H6RA 3O8GA 2Q0OA 4CCLA 1NK2P 1K7AA 3LSJA 5HDKA 5ILUA 4DYRA 3L2PA 4X62H 5C1PA 4HW0A 3IN5A 2HKXA 3JR9A 3EUKL 5DCMA 2IT0A 1M5XA 4PJ0C 3OYBA 2VBWA 1R5HA 3CP8A 2JPCA 3GUDA 4LFAH 4A3BJ 4WF2A 1MOWA 5DGBA 3ZQQA 2G7HA 2HPMA 4B09A 1DGSA 4YJ2F 2IRFG 4N4OB 4ENJA 1IRGA 3BZCA 3FMQA 1B6RA 2L4AA 4RZRA 2CQXA 1J09A 4GFBA 2HQ5A 1B24A 1SYXB 2DJNA 2ZMEA 1SEIA 1QGPA 4MV1A 4C3IJ 3G3ZA 4RU9A 1Z1DA 4H0EA 3KAJA 3CCRI 1EJ9A 3W6VA 2DLLA 1PX2A 3HHHA 5KFGA 3PUFA 5JFRA 1LJ9A 3GXOA 4GGGA 2W7NA 4DR6H 4L5EA 5KFMA 1AU7A 4U7DA 3WE2A 4MQ9F 3BTCA 3CJRB 2E7XA 2ISYA 1QRYA 5FKMA 4QFQA 5IWAH 3M8EA 2VBLB 1EH6A 1HOMA 2X6YA 2Z99A 4FCYA 5IYZF 2LSOA 3H0GJ 4DL7A 5A2QW 4F93B 4UCOA 3HL2A 1IDYA 1MMGA 3OUUA 1IUFA 1Y1VJ 4HV5A 2LLKA 3P9KA 1YJ9I 1B8IA 1HW1A 4DL4A 3RBEA 5EWEA 3HPHA 4MV6A 2DA7A 4HSRA 4OWRB 1GSAA 5KT2A 1GV2A 4BY7G 4AYBE 3W2AA 2E1CA 1O7FA 4PGGA 1A9XA 4B48A 5DCMB 1K79A 3MAJA 1PK8A 4MLOA 5D5XB 2UUCH 4OMZA 3ZCOA 3GBGA 3CMYA 5K7FA 3HGYA 3DPLC 1B72B 1IRFA 4KMUX 5C5JA 4ZYEA 1G9ZA 1LFUP 3OSPA 2M7AA 2P0AA 5J6XA 3IGDA 3FKIG 3K69A 4MA5A 5DS9A 2EV6A 1YW9A 4QWEA 3K70D 3WTTC 4FETA 2QQAA 3O6BB 5LHIA 3HGGA 3IP4B 1WCMA 1OCRH 3CC2I 2I3PA 1ZHFA 1R58A 3OR1C 4PJJA 1I1SA 4M72A 5HLTA 2VL8A 3BJOA 3KEQA 4XZ3B 3WO0A 4A3MG 2QVOA 3CO7C 3KIOA 4EGZA 5KVRA 4JYAH 3B73A 3QPSA 5FKNA 2GOMA 3EUHA 3BPVA 2CYYA 4CA0A 4UNOA 1AUXA 3KHLA 1TL8A 1JE8A 4RAZA 4IHTA 2VUMA 5TISC 3HKZN 2IGKA 3IH2A 1R9TJ 4UHTA 2XGEA 1GVJA 4HNTA 1Z21A 3SFIA 1F4KA 2EV0A 1SFUA 3FXUA 4BY1J 1S7EA 3C2GA 5L3FA 2NS0A 5B3SH 4D1QA 3MR6A 2VA3A 3MKYB 3KETA 3BQYA 3ERMA 3CP2A 3J7AO 2FK2A 5T14A 3QQAA 4IWXA 3T1YH 1OR7C 3OHAA 2DLNA 1MSEC 1XMXA 2W9BA 2OBPA 3OYNA 1WJFA 2KPMA 2ZMEC 2EZIA 3MVPA 3S93A 3ZMVA 4HF2A 2LVSA 3JRAA 2FQ4A 4XSXF 4EV0A 1NG7A 2JT1A 3L2QA 4L0YB 4EFJA 3V7CA 4HQ6A 5F1JA 1LWSA 2KDZA 2K9NA 2VODA 4C5AA 2RKHA 2RN7A 5GAGJ 1QPIA 2COMA 2DPUA 3PO2J 2X6XA 1WH7A 1ENHA 3MKLA 3F8MA 4AVZA 4ZDOA 1R7JA 2PVPA 1X3UA 1R9TA 3TP0A 1R49A 3JAMK 4YISA 2L4MA 2H09A 1N36H 2JEGA 3WGHA 2LOOA 1R5ID 3JAMZ 5BMZA 4R79A 3KYLA 3F6OA 5KFRA 2BQRA 3GV8B 2HTSA 2R7QA 4YJ3F 5FROA 2W8KA 4DR1H 3J7YJ 4FX4A 1MJ9A 2FPGB 2LH9A 3KAKA 2AHQA 4IPAA 4DR7H 4HA8A 4PJNA 1MH3A 3R0JA 1XCVA 5E5SA 3W2VA 2MGQA 3K4KA 2RDJA 1YX3A 3L2RA 1TNSA 3MFHA 3T5XA 1R4MB 4RAYA 4IOCF 2HKOA 2R86A 3H9JA 3H1CA 1IZ1A 3A01B 3PVXA 1FP1D 3H3UA 3I64A 2ELJA 3DTIA 5H6QA 2R7SA 1S72I 1P6RA 4EJWA 5FO5A 2ME6A 4OIOF 3PW0A 3LSPA 5E79C 3K5HA 2IN8A 1RJPA 1S7AA 4KIBA 3NAUA 2DN0A 4DR3H 5KG5A 4NXNH 3LMMA 1XSVA 3G4SI 3QU3A 1CQIB 2GXBA 1D8KA 1YX5A 1JGGA 2HFHA 1PUEE 4XKBA 1N3FA 3DTEA 5HODA 3K3VA 1JKJB 4M9UA 2WB1N 3E6CC 1SFOA 3IWZA 1ZGAA 1XGNA 2ZJPF 2ACJA 1VQ7I 5IP7G 3HXLA 1B9NA 2JRTA 3OOUA 5FLMJ 3BJ6A 5GPAA 4IZOA 2EFQA 2FQ3A 3E5UA 3P7NA 3IRQA 4EGYA 4UN9G 2G0EA 1XC5A 2ZFWA 4I7HA 4O6JA 1Z05A 2E35A 2IXSA 3VYSB 2KZGA 3RCOA 4O2BF 3JCUC 3BG9A 2CWEA 3N05A 2FEZA 5D4RA 5KG6A 3HOZJ 5J4YA 4MV7A 4QSHA 2EBIA 3PUBA 1A31A 2M4GA 3GVAA 5KFBA 3MX9A 2MLKA 3KEOA 3NGDA 3GQCA 1XMAA 3REOA 3R23A 3SZPA 3RB6A 3ORRA 1XNQH 3HSEA 2KQRA 2ZB9A 2AQFA 4F92B 2K5CA 5CYVA 2Y0SN 3S8PA 2BY2A 2R7ZG 4HLXA 2YZNA 2QQ8A 2ZJRF 1GPPA 4RNOA 2ALZA 3S15J 3G1OA 2GBYA 2C2EA 4KA4A 4EJTA 4EYIB 3DBRB 5JUMA 2M45A 2FP4B 1ZH5A 3WHCA 3SI8A 1L0OC 1YW8A 3KLOA 3GTKA 1TTYA 4FQGA 3K4NA 4F4XA 1PUFA 4AADA 4I50F 2OAZA 3KX2A 4HRIA 3HOSA 1VI0A 5E3LA 2E1MB 2NU9B 3RFCA 1KQ9A 3IUOA 2L54A 2X85A 3ECOA 1WSCA 3N41B 3RTRA 5CVIA 4M3DA 2EWNA 1FKAH 1YYVA 3CF2A 3TKYA 3DQVC 2VT3A 2JA8J 4DV2H 2LF7A 3TEDA 3OIQA 4ZYGA 2LY9A 2LQMA 2R7MA 1U78A 1X3WB 2VE9A 1I94H 4Q47A 3LQRA 5KG7A 3TOAA 4B3MH 2KRCA 5FFZA 2ESHA 2VC0A 1P4XA 4DQ2A 1HKTA 3BP8A 1IDZA 4KJZA 2VBNA 3UQ8A 1G6NA 4LG0A 3EPGA 1TA8A 5F6FA 1HNWH 1FOXA 2A6HF 3IHUA 3P9CA 4DR4H 3GFIA 3N97A 1USTA 2JUCA 2JVGA 2XGXA 2KSWA 3AAFA 4Y4RA 3DLAA 4PZJA 1G4DA 4UVAA 2WC2A 3BTJA 4PJMA 3F72A 3A1YA 5D8DA 3DP7A 1Y8QB 1P92A 3K6GA 3L4JA 3H3VH 4GYGA 4G7HF 3E6DA 3HOVJ 1U0CA 2P6TA 3OWTA 2X9DA 4G6DA 2NVQJ 1ZG5A 2HVSA 2M87A 1Y39A 1CS0A 3EUAA 2LDUA 2FJZA 5CQGA 3WTVC 3HOVG 2VQDA 3B6CA 2EZHA 5FD5A 1JIHA 5HLGA 2VQFH 1T95A 4I99C 1NK3P 2FXAA 4HOBA 3JRGA 1BJTA 2GWRA 1B1BA 5BPIA 5KFKA 1B04A 4KFCA 2XPVA 4M7EA 2N8GA 1FBQA 5BQTA 3S1NJ 2GLTA 3MKWB 1S9FA 4GYIA 5HNHA 3RB3A 4UNBA 3WTWC 2JJ7A 2QKLB 4LGWA 5CA1F 4RGXA 2Y31A 5FKOA 4IRIA 3T5JA 3BZ6A 3MMYB 2O3FA 3U9GA 4CSWA 3E97A 2HDCA 4D5FA 2X1EA 1DPRA 5L3BA 4B4CA 4J9SA 4UN8G 2FPIB 1DQ3A 2UU9H 2XUBA 4E4HA 2OPTA 2OV7A 3L7WA 4JX4A 2CH0A 2WAEA 1JJ8C 1AHDP 2CV0A 1JUSA 4HF0A 4A3FG 3DEWA 1ONVA 1TT5B 4KYWA 3FM5A 4A3JJ 3M9MB 1KU9A 2CO5A 4AC0A 5K5OA 1FJGH 3LOCA 3N6XA 5KG3A 1IGNA 3HKZE 4DL6A 4ZTJA 2JVHA 2RV8A 4G6QA 2XC9A 4JI8H 4XLEA 5EGOB 1I7LA 3QFFA 4BE0A 1T9IA 2JPBA 4GKJH 1NTCA 4IRCA 4EJOA 5L1LA 1W5CC 2CS3A 1YRNA 1T38A 2CG4A 2BHZA 1S3JA 2MD5A 1C0WA 3BG3A 1XB4A 4DBRA 3RB4A 1E4EA 5H2FC 2CKZB 2J5PA 3AYHB 2LKSA 4EM1A 1RRJA 4ZQIA 2VQGA 1G9YA 5CQEA 1AKHB 3OUZA 3GTOJ 2M2EA 1OYWA 2JEJA 3FIWA 2AQ4A 5GONF 4WXDA 2W6OA 1EF0A 3CLQA 4A0ZA 4AIJA 2IW5A 4C2UA 3BR6A 4BJ5C 4KMFA 1BI3A 1YLFA 2ID6A 2IGMA 2FSWA 2VQLA 4UY8I 4UN7A 1S29A 1W5SA 1ZG3A 4XRFA 1WQ2A 4CC5A 4JUZA 4FE7A 4YHHH 2L9RA 5L9XA 4YAKB 2NS8A 3GILA 4F7ZA 1CE8A 2FKLA 1YFHA 3OIPA 2R7UA 1LEAA 2VC1A 3ZN1A 3K10A 1ZYRF 4BUPA 3G8CA 3J80W 4AWXB 4ESFA 4ETSA 2DK5A 1D8JA 2Y9YA 3M7GA 1UHMA 3QU6A 1Y0NA 4F55A 2L3DA 4TUYF 1QU3A 2M4KA 1E2XA 4C5CA 1T33A 2J5OA 2RGVA 4QPOA 4IHVA 2GA2A 5C1OA 3LSTA 3OSFA 3HOUG 1F5TA 3CF5F 2OTJI 4Z2YA 3I12A 5C4JJ 1D0XA 1VKZA 3K4CA 3AG2H 4OOIA 5J8FA 2VJIA 3TMOA 5CJ9A 4YHXA 9ANTA 4MV4A 1GSHA 4UUVA 5ICGA 1KONA 2MFZA 5HDGA 4TV7A 1XPXA 1IV6A 4JI0H 2VBLA 3PO2G 4UCRA 3KHRA 1JHFA 3PSIA 2HQAA 3VYTB 3OYFA 4BXXJ 5B1AH 4G9YA 2WB1E 3ZMZA 3RKYA 1U8BA 2JWTA 2G9WA 2R92A 5IY5H 5L3EA 5AIQA 1T36A 5HBRB 3KYCB 3FMSA 1K78B 5F0CA 3CQZA 4M6VA 3LA2A 1ETOA 5AIPA 3RPQA 4CH7A 1WR2A 3N42B 4FT8A 3DXJF 4FS1A 5EOYA 4IQJA 2XGQA 3H20A 1RUNA 3LFUA 4RUAA 3MFIA 1LDJA 1VQ5I 3GIIA 2ZNYA 4XYLB 3OTOH 1OLTA 2A69F 4UFZA 1G59A 2KHMA 4Q43A 5KFHA 2D1VA 1WJ5A 1W36D 1IOWA 3HOWG 3F8CA 1POGA 3WG9A 3H5RA 4HG2A 1ULYA 1T08B 3Q0WA 4BJ6C 4PFOA 4E2UA 4JI4H 2H8WA 4DJAA 5EJCA 1TWCA 1U5TC 4AAGA 1O7LA 2ISZA 3S2DJ 3G1LA 3PIPF 3FHZA 3CMMA 4UB8C 2XC7A 3QYFA 2F5DA 2CFOA 5LP6F 5KFCA 3OYGA 3ZMUA 3MKZA 3OYCA 4ED7A 1TNTA 2UUZA 4EMSA 3I9V2 4XRSA 3IWFA 2W84A 1YITI 4ESBA 2XGCA 1IBMH 3T1BA 3OR2C 1SD4A 1TWGA 1H0MA 4O3QA 1J0RA 2DIKA 3CCSI 3BPXA 4DZPA 4EFEA 4EFBA 2DPIA 3HPGA 3CLOA 2LMDA 4TV8F 1I39A 4BAYA 1JLLB 1DGWY 1MMNA 2XAHA 4YELA 2VKDA 2H6CA 2X6WA 3DEEA 1HR0H 3F3XA 5L3DA 3GWZA 2Z1DA 2YZGA 2YRWA 3SYTA 3DPTA 2FOKA 3OS0A 2D45A 2DT7B 5BPDA 1K4SA 4A12A 1D0ZA 4RB2C 2FOWA 2A07F 2FA5A 4CZCA 3K4BA 3HHGA 3KXYT 2ZSHB 4BBSJ 2JMZA 5JVGF 2ASJA 1SFEA 4BXFA 3BTIA 1S5LC 4RNMA 1XDNA 1SVMA 4JK1X 5JHUA 4EG0A 3DWLE 5C44G 4BXUA 1LFBA 5B1BH 4G8XA 3RI4A 2BZTA 3JRDA 2DA3A 2E7WA 1MKMA 2GQQA 5D4SA 3JSOA 3TIGA 1HNXH 4KZSA 5EDWA 1TQIA 2M8EA 4I6ZA 5IOZA 3BR5A 1W1WE 2M7BA 3CD6I 2D2WA 2R8JA 2CUFA 2XAUA 5E8IA 1KU3A 1V55H 5DV5A 4EM2A 2K4BA 2K86A 2W85A 2XRLA 3A03A 1K1SA 2J6UA 1FNNA 1VQMI 2M9HA 1CQTA 3C1DA 3CTAA 2HYGD 3RIRA 4J9RA 1GXQA 5J4VA 2DQLA 4XOTA 4JV2A 1R22A 4M9XA 2FMYA 1DV2A 4YFKF 4OAZA 2VOBA 1HA8A 3CUQC 1LWTA 1Z0XA 2DU9A 3WU0A 4II2A 3DBHB 4J9OA 4FASD 4HNUA 2BEOA 5EYRA 2BW3A 3DKXA 5A74A 4L1KA 5DG7A 2VA2A 1FLIA 2F48A 2GAUA 2L7KA 5HNFA 1ITYA 3OV8A 4BWSC 3SZTA 1DU0A 3TINA 1YTYA 3N40P 1BIBA 1KQ0A 5KG2A 4XLFA 1Z7LA 4LFUA 4DYQA 1OWTA 3MZYA 1MMAA 4YG2F 1MZBA 2IBKA 1UNNC 2DDBA 2KJBA 1K6YA 3VWBA 2DMPA 4O1RA 4J9NA 3BQ1A 4HR7A 3I4MG 2Y75A 3K70C 1U0DA 3M3YJ 3JAMW 3WNZA 4LB6B 1O75A 3E5QA 5C44J 2GLOA 2RVCA 4AIHA 1D0YA 3AG1H 1STZA 1RUOA 2PFBA 4M3GA 4J01A 1W0UA 1T56A 1FBUA 1AWCA 3TO9A 4ED2A 4C9YA 1UMQA 2R7OA 3W2WA 2M0MA 3Q1KA 2ZO4A 5M5XJ 3DPUA 3OOLA 1D5VA 2HOEA 2Z2SB 2R0QC 1EYZA 5GADJ 4A3CG 1SAUA 4LITA 4XRMA 4NDLA 2JMWA 2E1NA 4KN7X 1MMSA 3Q8PB 3LL7A 3A02A 1MI8A 4D7MA 2R92G 3RYPA 4CO8A 3FK7A 1IRZA 4ZI7F 5J2UF 3E3VA 2O8KA 2QBYB 3WTUC 4OIQF 3AG4H 1F9NA 4IJAA 2E2IA 1ETVA 3MFKA 2RDPA 3C2HA 1QA6A 1X4OA 2QF7A 4EGJA 2LRDA 3ORQA 4QWAA 4A3EJ 1A04A 4DZJA 4NC7A 3MXBA 1XNRH 2LYCA 2W6QA 2IGOA 3I54A 4YAJB 5A0MB 4R8UA 4PWQA 3I53A 4LOCA 2B7EA 4O3MA 3QOEA 4I4TF 2R4GA 2HVRA 3DF8A 4KNYA 1KYWA 2DPDA 2OJED 5ERIA 3M8FA 2W1OA 4JI6H 4XOPA 3PQJA 4FISA 3C0WA 2R5YA 1ZG1A 1APLC 2TDXA 5M3MJ 2QQ9A 3BQZA 4LIVA 3NRVA 1MDMB 2KT0A 5FGMA 4LF5H 1FSEA 3JSNA 5A77A 5IP9G 3SDGA 1Z6RA 2LBFB 4L9TA 2AGOA 4WXCA 5DQGA 2W24A 1LUJB 2DO7A 2ECBA 2K3PA 4GO1A 5KCMA 1MW7A 3T5LA 2LNBA 5DTDA 1HLVA 1TWAA 1WH5A 1V9PA 1GT0C 1MGTA 1F36A 2OF7A 2VBYA 3KLNA 1RIOH 1W93A 4DLKA 1O4XA 4Z1XA 3C18A 4L5JA 2W8LA 5IYCG 4G6TB 1Y1VA 3PR5B 1JXLA 5D6FA 5GTIC 3JSLA 5A78A 1JTYA 1ETQA 5D8LB 3BZKA 5CAEB 2HOAA 2LG4A 3LAPA 1U5TA 1N48A 2ZXWH 2PBIA 3L1PA 1YS6A 4RB1A 4I2OA 2OQRA 1ORKA 1GLVA 1X4PA 5F08A 4JV5H 5IOYA 4S04A 3H36A 4FBUA 3HJEA 2K3FA 3A0BC 2F4MB 5IP9J 3E1SA 4UCSA 4HDUA 3V6KA 3TP3A 5KFJA 3HUGB 1JT6A 2BQ3A 2UUBH 2JA6G 4GIGA 1FOWA 1Y0UA 3BAAA 2NXNB 4Y17A 3WTZA 3E6BA 4FU0A 3UKGA 2M1BA 3FMRA 5LGUA 2Z5UA 3FX3A 2FLLA 2BY1A 3LSMA 2A68F 2RREA 4HV6A 2BYVE 4FS2A 2K4JA 4KIFA 4XLNF 2WTEA 1JKPC 3GIMA 4JI1H 2DCEA 3K4LA 1OFCX 1ON2A 3U2RA 3EPIA 1I1GA 1Y8RB 1W96A 3L9FA 4S0HB 4QWBA 5KT6A 4K0KH 3RGZA 1S8NA 3G6XA 2RDIA 1ZELA 4DV1H 2IA1A 1KGSA 2L7FP 1XD7A 5IYBJ 4DR2H 1SAXA 1Z91A 1MBHA 3A4CA 3G2BA 2JA6J 4ENKA 3L2WA 5TGTA 2JA5G 2C22A 2ZM6H 2FNPA 2FE3A 1KJQA 2LWYA 1VQOI 2R7KA 3OS1A 5EGOA 2ZCWA 3ABKH 2UXCH 1GVDA 3CDLA 5E3MA 3CCQI 2HTJA 5IT9K 5HV6A 5E1ZB 2RGRA 4O2AF 4RS8A 3J7ZI 2Z16A 1D1CA 4OX9H 3ESWB 1MDMA 2GXGA 1GXPA 1R7MA 2DA2A 1QBJA 3HSRA 3R5FA 1G3WA 2A6EF 5KFWA 4LF9H 2LFBA 2ADUA 2NAZA 2O03A 1N33H 4MV3A 1WWXA 1PP8F 2P0WA 2GOXB 2V59A 3CC4I 2HGSA 2DFFA 2WY7Q 3TW7A 2E2HA 2DJIA 3TOBA 4Q5SF 3TDZC 4NNJA 2NNNA 1SD5A 3ROUA 3N8DA 3M8JA 2VE8A 2R3SA 1S0NA 2KIQA 4GXOA 3FDYA 1WCMJ 2V7FA 2CW8A 3O8HA 1A35A 1B33N 2Q2TA 1W7PB 4KHPH 4UCTA 4G7ZF 2EQRA 5AONA 4ECUA 4R1HA 5KFPA 4ECWA 2PBZA 4KICA 1FBSA 4ECQA 2O61A 3GIPA 4D7NA 3HOUJ 1HCRA 4X65H 2R93J 4DR5H 1ON1A 1XMOH 1O3SA 1S0OA 1ZRCA 1A36A 4IVNA 3GTMA 3KP6A 3OYMA 1E17A 2AO9A 3H3VK 1M0WA 2YYAA 2DXIA 2ZDHA 4NQWB 4DV7H 3CCLI 5AKFA 4OIRF 2VXDA 3H9GA 1E4EB 2W4SA 2ZXIA 4Q44A 5LXTF 1IBLH 3OHBA 2RNGA 3SQNA 2L7ZA 5K7HA 3KP5A 4M9ZA 2RAEA 1GSOA 2XASA 4YITA 1ULZA 3EYIA 1UCRA 2ZSIB 1EF4A 3E6MA 4RZQA 4QWCA 2XDVA 3SFZA 4C3JJ 1BI0A 3FMAA 2EK5A 4X1EA 4BQNA 3AL0B 2DMNA 1RZ4A 3F22A 3KO2A 2YW2A 3GYHX 2JN6A 5F9NA 4HX4A 3PNTA 4Z1ZA 1Y6IA 2BOLA 3HIFA 4M71A 2NU8B 4EBCA 1SFKA 2E5ZA 1JI8A 5LD2C 1KJ8A 2MG4A 3K1MA 1U6GA 4L9NA 4JI3H 3CUQB 3H35A 3PNYA 4YFXF 1AN7A 3KALA 1A5JA 1I3QJ 3P9IA 3LFKA 5KFIA 1IW7F 1T6SA 4IRHA 2QOJZ 1P9QC 3FKIJ 3K9TA 5J8CA 1RJRA 1R23A 3PL8A 2IMZA 5D1OB 2YS9A 2NVXA 2OLSA 2QGUA 3PFYA 1R00A 1UELB 1REPC 1JTXA 3QQYA 4IWYA 4YR3A 2DTZA 1MH4A 2HI3A 3HUGA 1ETKA 2R5YB 1GO3E 5FJ8G 4EBDA 4E6KG 4A3BG 3K1NA 2VKHA 5DGAA 3H0GG 4ECRA 3A0HC 2R84A 3Q8QB 3I4MJ 4F52A 1OMIA 2VPRA 3QP5A 1R1UA 2JK3A 4LLLA 5KNLA 1IG7A 3G6YA 1IRXA 4B1RA 2F2EA 2BVMA 1GLNA 5D5VB 1IJWC 4A3LJ 1WZ2A 2W6MA 3I71A 4A3DJ 3ZQGA 4BGDA 3T5KA 3ABTA 5KFXA 4AAFA 1JKOC 3UNGC 4RDUA 1TWFA 5KFLA 5DD8A 2X0LA 2FK1A 1RK6A 3E0JB 2E2IJ 2UXDH 4WBNF 2ZDGA 2E36A 3J7AK 1W7PA 2NNYA 4UN9A 3KFWX 1QHGA 2FRHA 4JQFA 3VSKA 2IVMA 4A6DA 1Z2PX 4YB8B 4EBEA 2BV6A 2ZJ2A 3WODF 4A3FJ 4A0YA 3TDUC 5GPCA 2W6NA 2BE5F 3U9TA 2R8GA 2VPLA 5KG0A 4E7LA 1FYKA 2V1UA 2OH2A 2V4JC 4B47A 1O57A 1U5TB 3VB2A 2KMUA 2ATLA 4XORA 3HRTA 3HRUA 3G71I 5KG4A 1C3OA 1M6VA 4WD3A 5LGNA 5DLGA 4FBTA 4KT5C 1EKEA 4PDBA 1VAJA 2R7ZA 1YJNI 3ABMH 3QPLA 3FM3A 2P5LC 2DW4A 4M3BA 4IHSA 1OISA 2P8TA 4F50A 2QKMB 3IKTA 3IFJA 1I6UA 2D5VA 5LYJF 1FX7A 3JW4A 3F8FA 2ZXHA 2XSDC 1OCZH 2WDTA 4F4YA 4XKVA 5LMNH 2X1CA 3FD2A 4IOAF 1FMWA 3MD2A 3IKVA 1OCOH 4LF6H 4YIRX 1C30A 3VOEA 5J1RA 2F4IA 2WV0A 4FE4A 4YRVA 3S3OA 4CICA 2Z9OA 2XPWA 1TW3A 3SJMA 2TCTA 3B6AA 2PN6A 3C7JA 4A93G 1D1AA 2M30A 2OZUA 3BLYA 3JRBA 1HKSA 2QQBA 2Y0MA 4XICA 1UZCA 4N9HA 4HYEA 2R7LA 1ZARA 2MSYA 4ZYAA 3W3CA 4E7IA 4O4IF 2WTFA 2YCHA 2DFHA 2AGQA 1T39A 5JVLA 2K40A 4BU2A 2MH9A 2Q2EB 1KBLA 2XAFA 2VI6A 4XNFA 5CPRB 4UT0A 4E7JA 3MXBB 4QLCU 1BXRA 1UHWA 2I80A 3I0TA 1V4RA 3V8JA 2ZMEB 2EIKH 5FLMG 2IPQX 2HS5A 1TBXA 4ON0A 4IHYA 2UWMA 4AQUA 3J7AY 1N32H 1SVOA 1OKRA 1M7JA 2B9SA 3MWMA 1SEUA 2F5EA 2KP6A 3F23A 1ACIA 5HLHA 4XR6A 2HVQA 1CF7A 1E4FT 1IO2A 4ZDLA 2CW7A 4A2UA 3BDDA 1VQ8I 5E18F 1Q1VA 1P4AA 3I58A 5L3GA 4L9JA 3CUOA 4C2TA 4DL3A 1Y14B 3ZMTA 3OL4A 4LLGF 3V8KA 4J9PA 5H80A 1YIOA 1UC9A 2VR1A 3LNQA 1H8AC 3M9OB 4YR2A 5HS8A 1LE8B 1I50A 3X2QH 1IXRC 5K1YA 3ML6A 2AB5A 1WPKA 4LG0B 3HC7A 3RUPA 5F9LA 3BOQA 1RR8C 3MCZA 3V8LA 5A2QK 4IQ4A 3R7PA 2WAQA 2YS6A 4P9FA 2VPSA 4CYDA 3NWTA 3O3KA 2YU9A 2LCJA 4BHCA 5GTHC 4KUMA 3M4OJ 3KP4A 2M0CA 3SE7A 4RGRA 4BEHA 4HQMA 4NB5A 4D9JA 4QTRA 3ZPLA 4IHWA 1G3SA 2XVCA 2DA4A 3AG3H 4BBRJ 5EEAA 1N77A 2V1DA 4OMYA 4S05A 2R87A 4C5BA 2FMAA 4DGWB 2QSFX 3KZYA 5KKNB 4WK8F 4IRDA 3PIOF 3NZMA 3FKIA 4NQWA 4DW6A 2R8KA 1I7NA 2OQGA 3VPDA 2JEIA 4XRSG 4EQQA 1V5EA 2C2RA 5IT9Z 3GZ6A 1M0TA 2A5YB 1UG0A 1P8LA 2YS7A 2LREA 1IXSB 4FM9A 4XN0A 1ZGWA 2BY3A 4ZZDA 1TWHJ 1P2FA 4LLNA 2PN1A 2QK4A 1R4NB 1QQIA 4AAEA 3GFMA 1EZ1A 5C3EG 1BJZA 4X64H 1X58A 3GLLA 4CC6A 2EFNA 1JX4A 5CVVA 2XAGA 5E63A 1GHCA 1LNWA 1FTTA 1BW6A 3GFLA
chains in the Genus database with same CATH topology
2X6WA 3DEEA 5I0AA 3ZQQA 2HPMA 1DGSA 1HR0H 2Z1DA 4N4OB 4LFBH 3SYTA 3DPTA 4IX7A 3OS0A 4NXMH 1J09A 2DT7B 1D0ZA 1B24A 1SYXB 4RB2C 4CZCA 3K4BA 1SEIA 3OYJA 3CJQB 2E60A 3HKZA 2ZSHB 2JMZA 3KXYT 1YE9A 2LY2A 4BXFA 2V9KA 1N78A 1XDNA 3KAJA 3N44B 2L5QA 1X1BA 2X51A 3T1HH 3BCBA 1T9JA 3DWLE 4LIUA 2CV1A 2KDOA 2W7NA 4DR6H 3L2UA 3CZ6A 3CJRB 2WAFA 1HNXH 4B44A 3SEQA 1Z3YA 3OL3A 4UN8A 2VBLB 2F5VA 5IWAH 2X6YA 4AYBA 3EH8A 2M7BA 4DBQA 3RF2A 4B43A 2MCTA 2E5NA 3RPUD 4F93B 4UCOA 3HL2A 5A2QW 1MMGA 2XAUA 2VS7A 2R7TA 4DV0H 2DOAA 4B3RH 4MTDA 5AKMA 4BDZA 2WB1A 3N43B 3HPHA 3VYRB 4HSRA 4OWRB 1VZ0A 4XOTA 5FLXW 3W2AA 4ITVA 2PMZA 4B48A 4CCMA 2Q2UA 2VQCA 4OAZA 4PJLA 4ZDPA 3IAS2 1W36C 1HA8A 1LWTA 2VOBA 3SEZA 4II2A 4UCVA 4MLOA 4FASD 4HNUA 3ZCOA 2UUCH 5A74A 4JI5H 2BW3A 3DKXA 3GBGA 3PNVA 4ZC3A 3DPLC 3C0FB 2CUZA 1G9ZA 4D6NA 2L7KA 2DCHX 5HNFA 2M7AA 2R7RA 3IGDA 1WJEA 3MISA 2WADA 4D6OA 4BWSC 2I3QA 1V5GA 2CMPA 1DGRM 2VIXA 2BVLA 2WY8Q 2O5RA 1Z7LA 4FETA 4XLFA 3IP4B 2WE6A 4RLQA 1X19A 3A2KA 3RIZA 4XLCA 3EPZA 1MMAA 2IN9A 2I3PA 3K4JA 1MZBA 4P1WA 3VWBA 1K6YA 3OR1C 4PJJA 3ZXSA 5E67A 5HLTA 4ZJZA 4O1RA 2VL8A 2OWOA 2UUAH 4PSXA 3K70C 1U0DA 1DFAA 2LY1A 1VDEA 3JAMW 4XKWA 1O75A 4JYAH 2GOMA 5HVQC 4LSXA 2XSJC 1D0YA 4CA0A 4J01A 1S03G 4NUBA 3OS2A 4II3A 4RAZA 4C9YA 4LOXA 4IAJA 2R7OA 2IGKA 3W2WA 2HNHA 2M0MA 4HNTA 4KISA 3OOLA 3DPUA 1Z21A 5A72A 4MV9A 2Z2SB 3RGXA 2F4VH 3C2GA 4DIQA 1SAUA 3FHNA 4LITA 4D1QA 3BG6A 3OYEA 2IS6A 3MKYB 1X9NA 3LL7A 4JI7H 3CP2A 1MI8A 2VBOB 1P8KZ 3T1YH 3OY9A 1OR7C 3OYNA 1WJFA 2KPMA 3S93A 2V26A 1IBKH 4UCUA 1NG7A 4UNCA 3L2QA 4X66H 4EFJA 3C2HA 1X4OA 2LRDA 2HZDA 3MXBA 1XNRH 4NC7A 4O1SA 2MABA 1LWSA 2LYCA 2L9SA 2IGOA 1LKXA 3H0DA 4BL0B 1UM2A 5A0MB 4A2BA 4EATA 2X6XA 4YY3H 1AA7A 2IS4A 3QOEA 4AVZA 4ZDOA 4KL6A 2R4GA 2HVRA 2WYOA 5KHDA 4YISA 2W1OA 4JI6H 4XOPA 1N36H 3C0WA 1WH2A 2LOOA 3U21A 4LIVA 4R79A 3KYLA 3S3NA 4LF5H 1X1CA 1X1AA 1N32H 5FD6A 2R7QA 3IAM2 3JSNA 1NG6A 5A77A 5FROA 2W00A 2LBFB 4DR1H 1D1BA 4BJTA 2XF7A 4PFPA 5KCMA 2LH9A 4BDYA 2K3PA 3KAKA 4DR7H 4EEQA 4PJNA 1MW7A 4BE2A 1TAEA 2IS1A 5E5SA 3W2VA 1V9PA 3K4KA 4LH7A 3DKYA 1YX3A 3L2RA 4Z1XA 4F91B 4UCSA 2JNQA 4G6TB 4RAYA 3H9JA 4RLFA 3AL0C 3JSLA 5A78A 2R7SA 2ELJA 3DTIA 2IS2A 4BE1A 2FLDA 2KLOA 4BQQA 5BR8H 4DOZA 2LG4A 2IN8A 4DV4H 4RB1A 4GRIA 1X4PA 4DR3H 4NXNH 4JV5H 3LMMA 1PJRA 2HU9A 3S3MA 5FRMA 4OAYA 3E1SA 1YX5A 1LFPA 1DQUA 3CESA 4PK4A 4XN3A 4XKBA 1FMVA 3FBNB 3DTEA 3DU5A 3HUGB 3VSLA 1N3FA 4GIGA 3K3VA 2UUBH 3BAAA 4LFCH 2IGNA 3AFHA 3HXLA 3RSNA 1ZHQA 3LSMA 3OOUA 5FRNA 2RREA 3QYEA 4UN9G 3N40P 4JI1H 3K4MA 4I7HA 4F3QA 2DCEA 3K4LA 2IXSA 2MYSA 3VYSB 4Z20A 3RCOA 1AT0A 3SDBA 3PJRA 1Z2OX 3N05A 2XF5A 3SZGA 3ONQA 1Y56A 5D1OA 1TT0A 4K0KH 4MV7A 3RGZA 4DV1H 1ZELA 4XLHA 4E7KA 3PUBA 4AQXA 4DR2H 2M4GA 2XIGA 2L8LA 2Q1ZB 3MX9A 3A4CA 3G2BA 1XNQH 3ZRGA 2KQRA 2VJ5A 5TGTA 4XM3A 3L2WA 3UVFA 2ZM6H 2AQFA 4AU7A 2FE3A 2LWYA 2FUG2 4F92B 3OS1A 2K5CA 1UAAA 2UXCH 3S8PA 1N75A 3L4KA 2RGRA 1BP7A 1AF5A 4ZTFA 2Z16A 1GPPA 1D1CA 4OX9H 1WJAA 1R7MA 4LF9H 2HPIA 2VUGA 4KL5A 1N3EA 2O03A 4U7BA 1N33H 2P0WA 2GOXB 2VBOA 2HGSA 4XONA 4GLXA 2WY7Q 4XMYA 4OZ6A 4IKFA 2DJIA 3K4NA 3F9KA 4NNJA 4Q0YA 4DV3H 4B3SH 2LBFA 4AADA 3M8JA 3M4IA 2E1MC 3KX2A 4P5OA 4HRIA 2WA0A 3HOSA 2WBMA 3FDYA 4HSTA 2V7FA 2CW8A 2E1MB 5K08A 2Q2TA 4KHPH 3IUOA 3OYHA 1ZDEA 2X85A 4UCTA 3N41B 3RTRA 1FKAH 1BR2A 5AKNA 4BQOA 4DV5H 3CF2A 1BOBA 3DQVC 3L2VA 2VB6A 4DV2H 2LQMA 3OIQA 2XE0A 4X65H 3MXAA 4DR5H 1XMOH 2BW3B 2E5LH 1I94H 4B3MH 4R7RA 2KRCA 3UQ8A 3OYMA 4DUYH 1M0WA 2VBNA 4KJZA 4LF4H 2DXIA 4NQWB 1EA3A 4DV7H 5AKFA 1HNWH 2L9NA 2XF6A 2VXDA 3H9GA 4DR4H 2W4SA 2ZXIA 4E2TA 4C30A 3D5RC 1IBLH 2RNGA 2KL4A 2JVGA 2IN0A 2XE0B 2KSWA 4Y4RA 3CVZA 3DLAA 2O7MA 1U0JA 4YITA 2ZSIB 4PJMA 5HOOA 3A1YA 4RZQA 1MMDA 2XDVA 2X1DA 3OYDA 3FMAA 2V1NA 3K6GA 3L4JA 2AQEA 4BQNA 2PJRA 3AL0B 3KO2A 1BGWA 2W57A 1U0CA 3PNTA 4Z1ZA 3OWTA 1Y6IA 4UNAA 1L2ZA 2BOLA 5AK9A 2HVSA 1SFKA 2E5ZA 1JI8A 5A0MA 3EUAA 5LD2C 3FKJA 5CQGA 4AABA 1G8XA 1WJBA 2VJ4A 3H35A 3PNYA 2VASA 3C0XA 1AN7A 3KALA 5FD5A 2KZVA 2VQFH 1T95A 2EX5A 5IT9W 1LDKB 2VBJB 2QOJZ 2PJRB 1P9QC 1ERDA 4UN7G 3PN1A 1BJTA 3PL8A 2IMZA 5FPRA 3K70D 4Y3OA 1B04A 5D1OB 4B3TH 1ZHSA 1E4GT 3IG0A 3DTKA 4M7EA 3PFYA 3QQYA 1UELB 3MKWB 1MNDA 2VXZA 1A0IA 5HNHA 4UNBA 4E6KG 2QKLB 2VKHA 2K9MA 1Z3XA 3H9QA 2CUJA 2LC2A 3MMYB 4F52A 3RQ4A 3FBIB 5KNLA 2JUGA 4PUSA 2DT6A 3DF7A 1IRXA 3OYAA 4CSWA 2BVMA 1GLNA 4B3XA 2X1EA 2HDWA 3F8NA 4BGDA 2K9LA 4NC8A 3HOTA 4BEHB 4AAFA 2ZFUA 4BACA 3UNGC 4UN8G 3KEYA 4JI2H 1DQ3A 2UU9H 5D1PA 4XLAA 4E4HA 1ZD7A 2OUMA 2R7XA 2VS8A 3EYYA 2OV7A 4Y33A 2CH0A 2WAEA 3E0JB 3OYKA 2CV2A 2CV0A 3HYIA 1HNZH 2UXDH 3OYIA 3J7AK 4UN9A 1TA8A 4JQFA 1QHGA 3VSKA 4KT6A 1AM2A 1Z2PX 4LF8H 1E0EA 1FJGH 2VQHA 3N6XA 2OC6A 3BG7A 2V6EA 3E54A 4ZTJA 3NWSA 2JVHA 2VPLA 3BC8A 1WJCA 4E7LA 4JI8H 2V4JC 4E7HA 4XLEA 4B47A 4MTEA 4J0MA 3ZGKA 4BE0A 1T9IA 4GKJH 2KMUA 2UV1A 2UXBH 1TZLA 4XORA 4CUGA 2CS3A 4E7SA 2VLAA 4PDBA 3BA8A 3AKZA 3LSHA 3H5NA 3PSFA 4DBRA 1S68A 4JI3H 5LMNH 2QKMB 2L2OA 3IFJA 4QPQA 4DUZH 1I6UA 1GYFA 3HYJA 3DU6A 2ZXHA 2VQGA 2WDTA 4XKVA 1VS0A 2X1CA 3LSKA 3TL4X 1FMWA 3V42A 3VDXA 4BS9A 3FD2A 3MD2A 1G9YA 2ZJTA 4LF6H 5CQEA 2F4IA 2Y0SA 4YRVA 3S3OA 1XMQH 1V5FA 3J81W 1S9HA 4N4NB 1EF0A 3EUHC 4RB3C 5CKTA 3OMYA 4CCOA 1BR1A 4C2UA 4E7ZA 4BJ5C 4CCKA 3I3LA 1D1AA 3BLYA 5A0WA 2IGMA 2MC4A 4LQ0A 2VQLA 4UN7A 3TBIA 2F6CA 2VBJA 4DV6H 4RMNA 4X0GA 4CC5A 2W82A 4ZYAA 3W3CA 4E7IA 4LH6A 4YHHH 4JOMA 2YCHA 3H5AA 2MD0A 2VBNB 1BR4A 4ANJA 3OIPA 4BU2A 2Q2EB 2R7UA 4XNFA 5CPRB 4UT0A 5LFAA 2A5WA 4E7JA 3MXBB 3K10A 5E5OA 2M3AA 4LF7H 4BUPA 3J80W 5LL6b 1FVIA 4ETSA 3M1CA 4AQUA 2A6TA 2NOJB 2UWMA 3J7AY 1LVKA 1WFXA 4F55A 4CCJA 1QU3A 2M4KA 1Z2NX 2VQEH 4QPOA 2RGVA 3MWMA 4CCNA 4AQYH 2KP6A 4XR6A 2HVQA 3OYLA 4LSAA 1E4FT 4A2AA 2R7VA 4ZDLA 2CW7A 1D0XA 3VYUB 1R6RA 3K4CA 2VJIA 4J00A 3TMOA 1J5EH 4YHXA 3RTXA 4C2TA 4RM2A 1KONA 2MFZA 3OL4A 3S32A 1X1DA 2HHHH 2VBLA 4JI0H 4UCRA 1T0FC 3PSIA 2HQAA 3VYTB 4XQFA 4H4KC 4HEA2 4YEJA 1MNEA 4RM3A 4KITB 3OYFA 3RJ0A 3ZR8X 2AB5A 3HC7A 2R7WA 4LMYA 5LMUH 3LSGA 4IQ4A 4LG3A 4RB0A 3QYBA 2JA2A 2I8DA 3R7PA 2WAQA 4CH7A 3N42B 4HPQA 4PSWA 4IQJA 2VPSA 3NWTA 3H20A 3BCAA 5EOYA 3LFUA 3MIPA 4GKKH 2LCJA 3OTOH 1OLTA 4UFZA 4APMA 1G59A 2KHMA 2JSPA 3LSIA 4BEHA 4D9JA 1WJ5A 1W36D 4XKCA 4IZZA 2VJJA 1N77A 3LMLA 3H5RA 4HG2A 4JI4H 4E2UA 4BJ6C 3QODA 4PFOA 4DGWB 4DJAA 3BA9A 4AAGA 3NZMA 3OORA 3UR3C 3HG9A 3CMMA 3BABA 5FPOA 2XC7A 3D5SC 3QYFA 1DP3A 2CFOA 1V5EA 3OYGA 3MKZA 5JHFA 3OYCA 1N34H 2UUZA 1M0TA 3I9V2 1UG0A 4U87A 1P8LA 2LREA 4FM9A 1IBMH 1WJDA 4XN0A 3OR2C 4CCLA 1QHHD 3D5LA 2KRHA 3L2PA 4AAEA 4X62H 4EFBA 4EFEA 4X64H 3HPGA 3EUKL 1M5XA 4CC6A 3OYBA 1JVAA 3CP8A 2RQQA 4XL9A 5E63A 1DGWY 1PYVA 2KEQA 1MMNA 4LFAH 4YELA 2VKDA 1MOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I0A A;  1G9Y A;  1ZDE A;  5AKN A;  4YIS A;  1B24 A;  1EF0 A;  3C0W A;  2LQM A;  2JMZ A;  2XE0 A;  3MXA A;  1UM2 A;  5A0W A;  2VBN A;  4LQ0 A;  5A77 A;  1T9J A;  4UN7 A;  2VBJ A;  5AKF A;  4E2T A;  2VBN B;  5E5S A;  4UN8 A;  2VBL B;  2IN0 A;  2XE0 B;  1MOW A;  4UT0 A;  3EH8 A;  2O7M A;  4YIT A;  3MXB B;  5E5O A;  4Z1X A;  2JNQ A;  3KO2 A;  2VS7 A;  4AQU A;  1U0C A;  5AKM A;  4Z1Z A;  5A78 A;  4UNA A;  2FLD A;  5AK9 A;  5A0M A;  4AAB A;  2IN8 A;  3C0X A;  2EX5 A;  2CW7 A;  1LWT A;  2VBJ B;  2QOJ Z;  4UN7 G;  2IMZ A;  4YHX A;  4KL6 A;  5A74 A;  1N3F A;  3QQY A;  4GIG A;  2VBL A;  4D6N A;  2DCH X;  1G9Z A;  3IGD A;  4UNB A;  3MIS A;  4D6O A;  2I3Q A;  2IN9 A;  2AB5 A;  4UN9 G;  2I3P A;  4Z20 A;  1AT0 A;  5E67 A;  3R7P A;  4O1R A;  1U0D A;  1DFA A;  4AAF A;  4UN8 G;  1VDE A;  1DQ3 A;  3MIP A;  2LCJ A;  1ZD7 A;  2VS8 A;  4AQX A;  2L8L A;  3MX9 A;  3HYI A;  4UN9 A;  4LOX A;  1AM2 A;  3UVF A;  4E2U A;  3OOL A;  5A72 A;  2LWY A;  3E54 A;  4AAG A;  3NZM A;  3OOR A;  1BP7 A;  1T9I A;  1AF5 A;  1GPP A;  1MI8 A;  2VBO B;  1P8K Z;  1R7M A;  4KL5 A;  1N3E A;  5A0M B;  2VBO A;  4AAE A;  4UNC A;  4OZ6 A;  3IFJ A;  4EFJ A;  1M5X A;  3HYJ A;  4AAD A;  3MXB A;  3FD2 A;  1JVA A;  4O1S A;  1LWS A;  5E63 A;  2KEQ A;  2CW8 A;  5K08 A; 
#chains in the Genus database with same CATH topology
 2VBX A;  5I0A A;  2LP0 A;  4ZYH A;  4M6X A;  4UUS A;  1OCP A;  3GID A;  4PDK A;  4MO7 A;  1VQ9 I;  4NXM H;  4JBA A;  2UXX A;  5FKK A;  2UVV A;  4BY1 G;  3CCJ I;  2ZC2 A;  1X2N A;  5EDN A;  3GTG A;  3CJQ B;  2E60 A;  2QBY A;  1YE9 A;  2LY2 A;  5EWF A;  3ZQC A;  1N78 A;  5DQI A;  3N44 B;  2FNA A;  1IN7 A;  2X51 A;  3FXO A;  5EZY F;  4I0A A;  4XID A;  4LIU A;  3WU2 C;  2CV1 A;  3S16 J;  3HOZ G;  5DQH A;  1EHI A;  2EH3 A;  4YP3 A;  3I56 I;  1V3F A;  3L2U A;  1I3Q A;  5KFV A;  3PO3 G;  2WAF A;  2GA1 A;  4B44 A;  3SEQ A;  1Z3Y A;  2CJJ A;  2XRN A;  3OL3 A;  3OOP A;  3S1Q J;  5KFD A;  1RK5 A;  3LQQ A;  2QM3 A;  3H4B A;  5L1J A;  4ECV A;  3BR1 A;  4R8H A;  2ELK A;  3HBL A;  4DBQ A;  5LRS A;  4B43 A;  4MEY F;  1VQL I;  3CCE I;  1Y1W J;  2MCT A;  2DMQ A;  4U0V A;  3DBL B;  3RPU D;  3V7S A;  2DMU A;  4U0Y A;  1I27 A;  4Q4Z F;  2R7T A;  2DOA A;  4B3R H;  5D6E A;  5AKM A;  1ZLJ A;  1CGP A;  2WB1 A;  2XGD A;  3N43 B;  5IT3 A;  2IA6 A;  4AM3 A;  5J3L A;  1VZ0 A;  1S0M A;  2QYO A;  5FLX W;  3GTL A;  5IYB G;  4JYK A;  4YII A;  2DOE A;  4ITV A;  2WWY A;  2VQC A;  2DZD A;  4M3F A;  4PJL A;  3EET A;  1T8I A;  1RC9 A;  3FXL A;  4IEJ A;  4UCV A;  3JSP A;  1IXC A;  4M9S A;  2V5A A;  4JI5 H;  3H4D A;  1F43 A;  5BPF A;  5KFN A;  1SFX A;  2DCH X;  2JA7 A;  1WJE A;  3ERE D;  1W4M A;  3MIS A;  1UHS A;  2VIX A;  1DGR M;  5ICF A;  2ECC A;  2O5R A;  3O2P E;  2OZ6 A;  2WE6 A;  4XYM B;  1TWA J;  4MFD A;  1H9G A;  4G7O F;  4XLC A;  4O5V A;  2IN9 A;  1MBE A;  2EB7 A;  3K4J A;  2H1L A;  4P1W A;  1R1V A;  4UUT A;  5HLI A;  3TO6 A;  4BHB A;  3ZXS A;  3J80 K;  1XN7 A;  2IP2 A;  3WTS C;  1VFC A;  4Y52 J;  5E67 A;  3MR3 A;  4IR1 A;  2OWO A;  1R1T A;  2UUA H;  3RB0 A;  1VDE A;  5KG1 A;  4XBF A;  2HQR A;  4XKW A;  3RZO J;  5HVQ C;  1GUU A;  4LSX A;  3K7A J;  2XSJ C;  4ME6 A;  2VN2 A;  4Q8F A;  5L1K A;  1Z67 A;  2R7D A;  4NUB A;  3OS2 A;  2W9C B;  1S03 G;  2W9B B;  2QSG X;  2C28 A;  2Z3Y A;  2V9W A;  1ZR2 A;  2NU7 B;  4KIS A;  1T94 A;  5A72 A;  4G94 A;  5BPH A;  4MV9 A;  3RYR A;  3ECH A;  3RGX A;  2F4V H;  2JA8 G;  4V2F A;  2IS6 A;  4U7C A;  2CUE A;  3BG6 A;  5HDN A;  3J81 Z;  4YBZ B;  5LA6 F;  3ZQF A;  1X9N A;  1BM9 A;  4JI7 H;  4IXA A;  2CW0 F;  4P96 A;  1RKT A;  2DPJ A;  4L5I A;  3EQL F;  2W9C A;  3L00 A;  2XRO A;  3GTK J;  2Q2E A;  1JT0 A;  2IJL A;  4I0B A;  2V26 A;  2DFE A;  1IBK H;  2BXY A;  3VOD A;  4XK4 A;  4BYY A;  3ETJ A;  3MWE A;  2FLP A;  2PMZ N;  4J9Q A;  5LEJ A;  2GPS A;  3JRI A;  3R6S A;  2HZD A;  2NS7 A;  1FPQ A;  2EJR A;  3M07 A;  2W71 A;  1MBJ A;  2L9S A;  1WSU A;  2IAI A;  1MBF A;  1LKX A;  4BL0 B;  3H0D A;  2C35 B;  5KFT A;  2GIZ A;  3DCF A;  3U1D A;  4IO9 F;  1FSH A;  3I5U A;  4BKX A;  1PDN C;  4YY3 H;  4A3E G;  2L9V A;  2UXN A;  2YU9 J;  4A3G G;  2ID3 A;  1DP7 P;  2OU2 A;  5LLQ A;  2WYO A;  5DEQ A;  5KHD A;  3MR5 A;  2VON A;  1I6H J;  1FTZ A;  5KFY A;  2JA6 A;  5CVJ A;  4BY7 J;  1JKR C;  2F5C A;  3GV7 B;  3GTJ A;  2ZNZ A;  1OYI A;  3K0L A;  4V19 K;  1W7P D;  4MHG A;  3IAM 2;  2W6Z A;  4NC6 A;  3JRC A;  5EWG A;  4M6Y A;  1AUV A;  4PFP A;  2ZJQ F;  1KJI A;  4BDY A;  4QJF A;  2VUM G;  2P5V A;  4BE2 A;  2DA5 A;  1JDB B;  1TW2 A;  1TAE A;  4A3I J;  2PG4 A;  1IC8 A;  3Q3S A;  2GPW A;  2E2H J;  4MAM A;  2C00 A;  3DKY A;  2MA3 A;  1QZY A;  1WCM G;  4YR0 A;  4N9I A;  5KT5 A;  2JA7 J;  2ASL A;  1B4A A;  1QZE A;  2JNQ A;  2L01 A;  3T5H A;  4YQW A;  1XDS A;  3I4P A;  4W1U A;  5D8K B;  3AL0 C;  2HXO A;  1KQ8 A;  2FLD A;  1BIA A;  1A6Q A;  3DEU A;  3F0C A;  3GCM A;  4B8X A;  2STW A;  4ECT A;  4HBL A;  3ZQH A;  1JXS A;  1FP2 A;  2BY0 A;  1WKM A;  1B8I B;  2O7O A;  4UV9 A;  1V4Y A;  2J6S A;  4GRI A;  1G2H A;  4WXH A;  2W70 A;  3S3M A;  1PJR A;  5FRM A;  4OAY A;  2PMZ E;  1LFP A;  1DQU A;  3CES A;  3DV8 A;  1KC7 A;  3JTG A;  1FMV A;  3FBN B;  3DU5 A;  3WTX C;  1ZET A;  3VSL A;  3LA7 A;  2O6G E;  3CDI A;  4ECS A;  4LFC H;  2IGN A;  4Y7N J;  4PCQ A;  2A05 A;  3IV5 A;  1ZHQ A;  1FWZ A;  2MH2 A;  2V9P A;  4IF4 A;  5E3N A;  4A3G J;  1PVE A;  3N4M A;  1VQK I;  4F3Q A;  2E71 A;  2YRX A;  4YFN F;  2MYS A;  4Z20 A;  1FIP A;  1AT0 A;  3SDB A;  1K1Q A;  3PJR A;  3RV3 A;  4HAM A;  4D0P A;  4A3K J;  4IHX A;  1MNM C;  3Q0U A;  2GM4 A;  3ONQ A;  5D1O A;  5JH7 F;  1EH8 A;  2MW8 A;  2OTL I;  3GIJ A;  4XLH A;  4E7K A;  3M1E A;  2OCE A;  2Q1Z B;  3S1R J;  2MLG A;  5C8Y F;  4J9M A;  2XB0 X;  4F4Z A;  2XCP A;  4A3I G;  4XM3 A;  3UVF A;  2KIS A;  5LOV F;  5JVD F;  4AU7 A;  3HTS B;  1S7O A;  1N75 A;  2EPF A;  4HZF A;  5DD4 A;  2P6S A;  3L4K A;  3HOY G;  3DLL F;  1AF5 A;  1FJL A;  1FYL A;  5DUK A;  1WJA A;  2P7C B;  1TQP A;  2HPI A;  4ZZL A;  1HF0 A;  1HST A;  2VUG A;  1N3E A;  5IYD J;  2QLZ A;  4U7B A;  1VBH A;  3TQN A;  4GLX A;  1XDU A;  2VBO A;  4O3S A;  1FZP B;  2QZ8 A;  2ZDQ A;  1G3T A;  4IKF A;  4DV3 H;  3ABU A;  2YPR A;  5ILV A;  4B3S H;  4ZYD A;  3IC7 A;  2NU6 B;  2EFP A;  4UV8 A;  5K08 A;  1QO0 D;  1FOK A;  3OIO A;  5JVT A;  6PAX A;  2ETH A;  1ZDE A;  1HSJ A;  3U9S A;  1BR2 A;  3GTM J;  5AKN A;  2K02 A;  1BOB A;  5LGT A;  1IOV A;  3L2V A;  2KFD A;  1QZZ A;  3CQZ J;  1MJB A;  5K5R A;  3RDI A;  3WO1 A;  2R6F A;  5K5Q A;  2R8I A;  2BW3 B;  3KZZ A;  1VQ6 I;  2L0K A;  3H40 A;  4ECX A;  5EZH A;  1HDD C;  4DUY H;  3COA C;  1XS9 A;  4PGH A;  3T8R A;  2NVT J;  4LF4 H;  1S10 A;  3KHG A;  3GME A;  2A3S A;  2EA2 A;  1QPM A;  1T3N A;  2L9N A;  1WVR A;  1VQN I;  4ZH4 F;  4U6P A;  3NAR A;  4QW8 A;  3LWF A;  1G3Y A;  2KL4 A;  2MBF A;  2KIU A;  2W25 A;  5M3F J;  4WX9 A;  4CDG A;  3CVZ A;  2O7M A;  5HOO A;  3JTH A;  1MMD A;  3R5H A;  3OYD A;  2PJR A;  2FF4 A;  1BGW A;  4AD9 A;  2QSH X;  5J47 A;  4AID A;  4BQA A;  1FC3 A;  4P55 A;  4IL6 C;  5CB4 F;  2AGP A;  1BL0 A;  3BWG A;  1FEX A;  5AK9 A;  1DIK A;  1L2Z A;  4ECY A;  5A0M A;  2XV4 S;  1G8X A;  1WJB A;  2VJ4 A;  2VAS A;  3A01 A;  2UVW A;  1JUM A;  4RA2 A;  3CCV I;  2LTP A;  1DV1 A;  4NBQ A;  2PJR B;  1ERD A;  4UN7 G;  3PN1 A;  5FPR A;  1K83 J;  1B9M A;  5ED4 A;  5F04 A;  4I02 A;  2P4W A;  1HC8 A;  3IG0 A;  5KX5 F;  2IP4 A;  2HDD A;  4ABZ A;  3G73 A;  3CCU I;  1MND A;  1A0I A;  1XMK A;  2XD4 A;  2R8H A;  5KK1 A;  4P9U A;  4XX0 B;  2DOF A;  3JZI A;  1Z3X A;  1FOY A;  3E7L A;  3H9Q A;  5J40 A;  1OCC H;  2CUJ A;  2LC2 A;  4HX8 A;  3ULQ B;  3GX4 X;  4PUS A;  2DT6 A;  1KJ9 A;  5E1W A;  4Y13 A;  1YW7 A;  3OYA A;  3DF7 A;  4HF1 A;  4BBS G;  3F8N A;  1ZAO A;  3PQK A;  2M05 A;  3GLK A;  5KT7 A;  3R4K A;  4NC8 A;  3HOT A;  4BEH B;  1BI1 A;  2JA5 A;  1O3Q A;  2ZKZ A;  5D1P A;  1OQY A;  1P7I A;  2OUM A;  2DBB A;  3ABL H;  3EYY A;  1QVT A;  3T8T A;  2UZK A;  2R7X A;  5EEG A;  2VS8 A;  1HNZ H;  3MZ8 A;  3OYK A;  1DDN A;  2Y30 A;  1X1P A;  1JHH A;  2H27 A;  5DYM A;  1AM2 A;  4LF8 H;  1E0E A;  1U8R A;  2OC6 A;  4C2M A;  1RYS A;  2V6E A;  3E54 A;  3NWS A;  3ZQ7 A;  1WJC A;  4E7H A;  3VPC A;  5KAI C;  1LE8 A;  3PW7 A;  3ZGK A;  1AOY A;  4GC7 A;  1TZL A;  5J2T F;  5EEH A;  4CUG A;  1MBG A;  4A3L G;  2H1K A;  4YIF A;  2VLA A;  4A6E A;  2R85 A;  2YSR A;  3BA8 A;  2CQQ A;  4AVP A;  1EH7 A;  4IAJ A;  3GTP A;  3PSF A;  1S68 A;  4ECZ A;  2PI0 A;  2L2O A;  3BQ0 A;  1GYF A;  1Q1H A;  1V54 H;  2DFI A;  5H20 A;  3VPR A;  2ZXJ A;  3PW4 A;  3DU6 A;  3HM5 A;  2F5F A;  3RAQ A;  4G12 A;  2ESN A;  1VS0 A;  3VDX A;  3V42 A;  4EVI A;  2ZJT A;  3QPT A;  1XCB A;  1N56 A;  1PUF B;  2FLN A;  4Y15 A;  5IYC J;  3JRF A;  3FXM A;  2FBK A;  2Y0S A;  3RV4 A;  4J19 A;  3DFG A;  1V5F A;  4AUX A;  4RB3 C;  5CKT A;  3ZMS A;  2ICW G;  4J9K A;  2NRA C;  4CCO A;  1BR1 A;  3GZ5 A;  1B72 A;  5KFF A;  1J5Y A;  4MA0 A;  5A0W A;  5LHG A;  3PZP A;  1PP7 U;  3KCC A;  4LQ0 A;  1IN6 A;  2VBJ A;  3BY6 A;  2CU7 A;  4RMN A;  1IF1 A;  1KYZ A;  4DV6 H;  1IN5 A;  2W7O A;  3KYD B;  3K2A A;  2Z33 A;  2VBN B;  1OCT C;  4ANJ A;  1IN4 A;  5FLX K;  1GV5 A;  2EIN H;  1VQ4 I;  2HOS A;  2IEK A;  2E19 A;  2G7U A;  3Q0V A;  4RBO A;  3ISP A;  5E5O A;  2KRF A;  2I8C A;  3TQT A;  3K2Z A;  2R7Z J;  4ED0 A;  1HKQ A;  5KFS A;  1FVI A;  3M1C A;  2H8R A;  4E70 A;  1SD6 A;  2A6T A;  5JLW A;  1KU7 A;  2ME0 A;  1WFX A;  3HSF A;  4A93 J;  1Z2N X;  2VQE H;  1R36 A;  2EIL H;  2VKE A;  1V51 A;  4FHT A;  2O8X A;  1YG2 A;  4AQY H;  2XKO A;  3LP8 A;  3OYL A;  4D5C A;  2V4R A;  2CZG A;  2VOP A;  5J1U A;  1X2M A;  1R6R A;  3VYU B;  2GXA A;  1UC8 A;  3FXK A;  3Q8R B;  2YX4 A;  4DL5 A;  5DM6 F;  3L09 A;  2W9A A;  5A2Q Z;  3RTX A;  5BOX A;  4RM2 A;  1HW5 A;  2J9G A;  3S32 A;  1TWF J;  1ZK8 A;  5FFX A;  2HHH H;  2DI3 A;  2E34 A;  3PO3 J;  3ETH A;  2DDA A;  3WGG A;  4XQF A;  4H4K C;  4YEJ A;  2I10 A;  1MNE A;  1ETX A;  3RJ0 A;  4IR9 A;  4Q8E A;  3BT9 A;  3ZR8 X;  1F1Z A;  1CF7 B;  2EZK A;  4LMY A;  3PR4 A;  4LX3 A;  2P5K A;  2YUS A;  3RKW A;  5C4X J;  5E1X A;  5LMU H;  3HRM A;  4RB0 A;  4UB6 C;  2JA2 A;  2I8D A;  3CC7 I;  3ZQI A;  4FTH A;  4HPQ A;  1ZGJ A;  3W6K B;  3TO7 A;  5C4X G;  3BTL A;  3M9N B;  3V4Z A;  4MFE A;  4ESJ A;  2NOG A;  5KT3 A;  3GFJ A;  3JRX A;  2Y2Z A;  1EUD B;  2JSP A;  4XKC A;  2VJJ A;  3ZP5 A;  1SVL A;  1K78 A;  2HZT A;  3ASO H;  3BA9 A;  5EG0 A;  4K2E A;  3OOR A;  2E2J J;  4MV8 A;  3CUQ A;  3D5S C;  1DP3 A;  3BJY A;  5L1I A;  4EJV A;  3HOX G;  1IV8 A;  5JHF A;  3PM1 A;  4U87 A;  2DOD A;  2K27 A;  1WJD A;  5F0H A;  1QHH D;  1XGO A;  3D5L A;  1W0T A;  2VUM J;  2KRH A;  5JI6 A;  2CGP A;  3NQO A;  3FZV A;  5FLX Z;  4RGS A;  2R5Z A;  1JVA A;  4ENM A;  1MSF C;  4XL9 A;  2RQQ A;  3GTJ J;  2P81 A;  1PYV A;  5E3O A;  2KEQ A;  4EEQ A;  2WAQ N;  2VT2 A;  4LD5 A;  2YX7 A;  3GTG J;  3R5X A;  4LFB H;  5FB2 A;  4TQS A;  5GP9 A;  2C6Y A;  4IX7 A;  1ZKG A;  3IH3 A;  2AU0 A;  4A3C J;  3E5X A;  3OYJ A;  1BNC A;  3HKZ A;  2FB9 A;  5KFQ A;  4C3H J;  3VMM A;  3S2H J;  3V6H A;  4I01 A;  3MR2 A;  2V9K A;  1T0F A;  1VTN C;  2R82 A;  1E3O C;  2AS5 F;  2L5Q A;  1X1B A;  3ELK A;  3T1H H;  1TP4 A;  3BCB A;  3LSR A;  4MNU A;  1YS7 A;  3Q5F A;  1J9I A;  2NVY J;  1T9J A;  4GC6 A;  3QZ8 A;  2KDO A;  3JRW A;  5M5Y J;  4UUS B;  5LEK A;  1LVA A;  3FK6 A;  2ASD A;  2X48 A;  1U9O A;  3CZ6 A;  3CMA I;  3T0Y A;  4OU0 A;  4UN8 A;  2O9L A;  1Z6T A;  2F5V A;  1QNT A;  4AYB A;  3EH8 A;  2PX9 A;  1JJ6 C;  1J75 A;  3RF2 A;  1S6L A;  4HX7 A;  1WI9 A;  1TWH A;  2E5N A;  2V58 A;  4DV0 H;  2UVU A;  4MEX F;  3DKW A;  2VS7 A;  1EV7 A;  4MTD A;  3KHH A;  4BDZ A;  4NHJ A;  4A3K G;  1TWG J;  2CQK A;  3VYR B;  2R93 G;  1H89 C;  3KE2 A;  2XHK A;  1N25 A;  5E17 F;  3GW2 A;  2HEO A;  2R7N A;  3E5N A;  2OD5 A;  4KDP A;  2PMZ A;  4CCM A;  2Q2U A;  4ZDP A;  4HLY A;  1W36 C;  1ZRE A;  3IAS 2;  3U1K A;  3RBD A;  2EIM H;  2BHY A;  3SEZ A;  3HOW J;  3GTQ A;  5DG8 A;  4L0Z B;  2BXZ A;  5D5W B;  1KJJ A;  3PNV A;  1ZR4 A;  3CJT B;  4ZC3 A;  3C0F B;  3G6V A;  2CUZ A;  4D6N A;  4LH6 A;  2M5W A;  3QAH A;  2R7R A;  4LB5 A;  2WAD A;  3LAJ A;  4D6O A;  1VQP I;  2I3Q A;  1I50 J;  2WY8 Q;  1V5G A;  2CMP A;  2BVL A;  1N34 H;  1VBG A;  2V6C A;  4RLQ A;  1X19 A;  2JTV A;  3JRH A;  3A2K A;  3BRO A;  4MQV A;  3EPZ A;  4RUC A;  2D1H A;  3KP7 A;  5HS7 A;  4A5N A;  4DL2 A;  2BGC A;  4O4H F;  1DU6 A;  3SXY A;  4ZJZ A;  2E1O A;  2Y9Z A;  5TJJ A;  4PSX A;  1IAW A;  4Q48 A;  1DFA A;  2W7P A;  2LY1 A;  2X6O A;  2HGC A;  1L3L A;  3FXQ A;  5F1R A;  2HQN A;  2YZM A;  2XB5 A;  1K83 A;  4II3 A;  4KIG A;  4LOX A;  5GAH J;  4U0W A;  4M73 A;  2HNH A;  5IP6 A;  2QEX I;  1O3T A;  3FDS A;  2QCO A;  3MJF A;  2PQ8 A;  1EUC B;  3TGN A;  3IL2 A;  3HEF A;  2OCC H;  3RAX A;  1XG1 A;  3GTL J;  3QP6 A;  4DIQ A;  3FHN A;  3OYE A;  4UVB A;  3I55 I;  1XGS A;  3BR3 A;  4O3N A;  4BXX G;  2Y48 A;  2PEX A;  2VBO B;  4I98 B;  2RQP A;  1P8K Z;  3OY9 A;  4Y8V B;  1SAN A;  2KJC A;  4LK1 F;  2DTR A;  3GIQ A;  5KFO A;  2I5U A;  3I4N G;  2CQY A;  4RNN A;  2FD5 A;  4UCU A;  4EM0 B;  4UNC A;  3F6V A;  4X66 H;  2NVU B;  5F27 A;  1YOV B;  3S14 J;  3I4N J;  1OR7 A;  4O3O A;  4CZZ A;  4O1S A;  3H0G A;  2MAB A;  4DNC A;  2O0Y A;  2XKP A;  1B59 A;  1TC3 C;  1UM2 A;  4A2B A;  4EAT A;  3KP2 A;  2LKX A;  1AA7 A;  3G1M A;  2LD5 A;  2BR0 A;  3RJP A;  2IS4 A;  1Z9C A;  4O3P A;  3KTM A;  1H9T A;  4B3A A;  4OIN F;  1XSD A;  1YHQ I;  3ZMD A;  3NEU A;  1WH2 A;  3W6J B;  5E8G A;  3QWL A;  5E20 A;  3I59 A;  2AXT C;  1LQ1 A;  3U21 A;  1NH3 A;  3S3N A;  5FKL A;  1R5G A;  2L02 A;  1X1C A;  1X1A A;  2JSC A;  1P7J A;  3QOP A;  4RAG A;  4Z6Y A;  5FD6 A;  1D5Y A;  2B63 G;  1NG6 A;  1MIJ A;  2W00 A;  3GLX A;  2X4H A;  4I55 F;  1RET A;  1D1B A;  3KP3 A;  2FX0 A;  2XF7 A;  4BJT A;  4O3R A;  4I76 A;  5LRR A;  5EF6 A;  5EG0 B;  5FJ8 J;  2B63 J;  1LEB A;  4L9V A;  5IPA A;  2IS1 A;  1I5Z A;  5DLF A;  1UG2 A;  3HRS A;  3I59 B;  4LH7 A;  3TQ1 A;  4F91 B;  3CME I;  2FML A;  4EGQ A;  3V7R A;  1BBY A;  1E3P A;  5KT4 A;  2HYJ A;  2P7V B;  5CVR A;  4RLF A;  4A3D G;  2HWV A;  3R0A A;  4KN4 X;  2IS2 A;  4BE1 A;  2V4Q A;  2KLO A;  4HQE A;  4BQQ A;  5BR8 H;  4DOZ A;  1X3Z B;  1D3Y A;  2C2D A;  1BOA A;  1ZRD A;  2DQR A;  2HR3 A;  2YR2 A;  1U9N A;  2IA0 A;  4DV4 H;  4TV9 F;  3VFZ A;  4NLG A;  4FX0 A;  5GAE J;  2HU9 A;  5M5W J;  1HBX G;  3RZD J;  1VND A;  4A5M A;  4A69 C;  4XN3 A;  4KL6 A;  1SCU B;  3CJN A;  4PK4 A;  2Q8K A;  3RIZ A;  4UVC A;  3SHF A;  3ZQL A;  1FIA A;  4CYC B;  4JP0 A;  1HW2 A;  2DWC A;  3AFH A;  3RSN A;  5BNG A;  3BQ2 A;  2KKO A;  5FRN A;  2FU4 A;  3QYE A;  4JV1 A;  3GZN B;  5HS9 A;  3R60 A;  4TQR A;  3K4M A;  2LR8 A;  4EEF G;  1FT9 A;  1S97 A;  4GCV A;  1Z2O X;  2Y0S E;  4AIK A;  5ILS A;  1J2X A;  2XF5 A;  1YJW I;  1BC8 C;  3SZG A;  1Y56 A;  1TT0 A;  2GZW A;  3D0S A;  2JRM A;  1BJA A;  4AQX A;  2XIG A;  2L8L A;  2XPU A;  4ZOL F;  3IH4 A;  2LF8 A;  3KZI C;  5ICC A;  1RJQ A;  2L7M P;  2HXI A;  3ZRG A;  5CA0 F;  2VJ5 A;  2X0S A;  3PW5 A;  2XCL A;  2NYX A;  3RPU A;  2FUG 2;  1UAA A;  1XTA A;  1WI3 A;  1GGO A;  1IUY A;  1BP7 A;  2VBZ A;  4ZTF A;  1LB2 A;  1BA5 A;  4Q45 A;  1J59 A;  1ZN2 A;  2LKP A;  5FLV A;  1B6A A;  5DM7 F;  1XX5 A;  2EFW A;  4KL5 A;  3RQI A;  4CHU A;  2JQ7 A;  4N0B A;  1U2W A;  5CVU A;  5TRD A;  4XON A;  4XMY A;  2YU3 A;  4OZ6 A;  1VF9 A;  3F9K A;  4Q0Y A;  2LBF A;  3FXR A;  4QW9 A;  3M4I A;  5B66 C;  2E1M C;  4P5O A;  1K6O A;  3GV5 B;  2WA0 A;  2WBM A;  4HST A;  1YO5 C;  4IHJ F;  3C3W A;  5JQW A;  4J9L A;  2B63 A;  3M9A A;  5K2M A;  4BNC A;  2W6P A;  2CQ7 A;  1TLH B;  4QIW E;  3OYH A;  2WAQ E;  4ED6 A;  2DA6 A;  2PMU A;  3ZN0 A;  1O3R A;  4EJU A;  2RNJ A;  3MZH A;  4OIP F;  2DYS H;  4BQO A;  5IP7 J;  3BR0 A;  4DV5 H;  4ED8 A;  1RYR A;  2VKV A;  3HOY J;  2V79 A;  3H3Z A;  1ZLK A;  4LK0 F;  2VB6 A;  4RAF A;  5F64 A;  2XE0 A;  1WHU A;  3MXA A;  4F4W A;  4ED3 A;  2E5L H;  1RR7 A;  3P5J A;  4UXN A;  4R7R A;  2R92 J;  2DMT A;  1DUX C;  2ELH A;  4M74 A;  2CSO A;  3RKQ A;  4L18 B;  1EA3 A;  3HTU A;  5J1Y A;  5C3E J;  3J80 Z;  3S2W A;  2K85 A;  4IRG A;  2BBY A;  1T98 A;  2XF6 A;  4HNV A;  2M8G X;  2UVR A;  4M3E A;  1W5T A;  5JLX A;  4E2T A;  4C30 A;  3D5R C;  3WG7 H;  3VPB A;  4BH9 A;  1JKQ C;  4CYC A;  2IN0 A;  2XE0 B;  5KFA A;  1ZQ3 P;  1HXD A;  1U0J A;  2X1D A;  3CCM I;  3BJA A;  2V1N A;  5KFU A;  2AQE A;  2W57 A;  4BHP A;  1UB9 A;  1LDD A;  1UFM A;  3V6J A;  4XSZ F;  4UNA A;  5EZG A;  1ETW A;  3KPH A;  4X6A J;  1TWC J;  3J81 K;  5L3C A;  1USS A;  4EEY A;  3FKJ A;  4AAB A;  1Y1V G;  3C0X A;  5LBQ A;  5IT9 W;  2EFO A;  2KZV A;  2EX5 A;  1OYY A;  1LDK B;  2A61 A;  2FBI A;  3Q9S A;  2VBJ B;  4E4T A;  4QIW A;  5D5U B;  1NHA A;  2IA2 A;  4BBR G;  4B3T H;  4Y3O A;  1ZHS A;  1WGX A;  1E4G T;  3DTK A;  4EYH B;  2PMH A;  1ZRF A;  5BMV F;  4ENN A;  2ZBK A;  3PW2 A;  2VXZ A;  1JUP A;  3OSG A;  5CLS A;  3MWD A;  2DK8 A;  1WRJ A;  2EA4 A;  2K9M A;  3C2B A;  4QIW N;  1P4W A;  4QWD A;  1AKH A;  2HOT A;  2I87 A;  3D1N I;  4IRK A;  3RQ4 A;  5KFZ A;  3FBI B;  1SD7 A;  1UJ8 A;  2H6B A;  2JUG A;  2MC3 A;  3FWE A;  4B3X A;  1BI2 A;  2KIM A;  2HDW A;  3WGI A;  2RC4 A;  2NUA B;  2K9L A;  2WV1 A;  2CFX A;  2ZFU A;  4BAC A;  3V4G A;  1SFO J;  3KEY A;  4JI2 H;  4W97 A;  1FYM A;  2GIV A;  4XLA A;  1ETY A;  1ZD7 A;  3QZ7 A;  3HZJ A;  1E3H A;  2V9V A;  4Y33 A;  3HYI A;  2JZY A;  2CV2 A;  4A3M J;  3GTQ J;  4U88 A;  1YRN B;  1CQJ B;  3OYI A;  3LWB A;  3L2C A;  2PLY A;  4KT6 A;  3HDD A;  3F8B A;  2QUF A;  1HDP A;  2VQH A;  2FK3 A;  1I3A A;  3FIS A;  3BG7 A;  3K3P A;  3BC8 A;  4J0M A;  3TW6 A;  1RI7 A;  1KA8 A;  4MTE A;  3GTP J;  3F21 A;  1YIJ I;  2UV1 A;  4RGU A;  1B6S A;  2UXB H;  3EDP A;  2PJP A;  3MEX A;  5BS6 A;  4HDV A;  4GDF A;  4QWQ A;  5F0F A;  1MD0 A;  4O4L F;  1BN5 A;  2F4L A;  4E7S A;  4I09 A;  3K1P A;  1R71 A;  3HB9 A;  3AKZ A;  3LSH A;  5JR3 A;  1XGM A;  5KFE A;  1ZQ7 A;  1SMY F;  1RES A;  3H5N A;  3WU1 B;  1BC7 C;  3QPH A;  3JRE A;  1A6I A;  4QPQ A;  4DUZ H;  5DG9 A;  1SMT A;  3R61 A;  3HYJ A;  3G6E I;  1ZTR A;  1BW5 A;  3V4S A;  3K5I A;  1RPW A;  3MN2 A;  3MQ0 A;  3LSK A;  3TL4 X;  4BS9 A;  2JEF A;  2NVY A;  1I6X A;  4ZHQ F;  2QWW A;  4V2G A;  5DCF A;  1GDT A;  4WCG A;  5K7Z A;  1ODD A;  2F4O B;  2VPQ A;  1XMQ H;  3J81 W;  1S9H A;  4N4N B;  3EUH C;  2COB A;  3WHB A;  3OMY A;  3S1M J;  2VOO A;  4E7Z A;  4CCK A;  3GTO A;  3I3L A;  1Z77 A;  1LPQ A;  5B5E C;  3HOX J;  3BR2 A;  2H94 A;  2MC4 A;  2R93 A;  4CXF A;  3TBI A;  3WTY C;  2F6C A;  2R5Z B;  1M1E B;  1U3E M;  4X0G A;  2W82 A;  4WWC A;  2K9S A;  4JOM A;  1T2K A;  3S17 J;  1K61 A;  3H5A A;  2DAO A;  2MD0 A;  3VEP A;  3OSN A;  1BR4 A;  2YL2 A;  1KU2 A;  1QVU A;  4JX6 A;  2NVX J;  2XAJ A;  1Y1W A;  5KAF C;  2DYR H;  2A5W A;  5LFA A;  4JV0 A;  2M3A A;  2EIJ H;  4LF7 H;  2IMW P;  2BQU A;  5LL6 b;  2XCA A;  2RF4 A;  1KEE A;  3Q8S B;  2TRT A;  2NOJ B;  3Q2O A;  3ZOB A;  4ASN A;  1LVK A;  2LK2 A;  4R8U B;  4CCJ A;  1RKW A;  3TII A;  1HQC A;  5DUI A;  4MGR A;  4ED1 A;  2QA4 I;  4CCN A;  3QRF F;  1MBK A;  2CRG A;  4G3I A;  2FPP B;  4LSA A;  2EV5 A;  4A2A A;  2R7V A;  3Q9V A;  1H88 C;  2M34 A;  4MIM A;  4J00 A;  4CGZ A;  3GIK A;  3GO5 A;  1J5E H;  4JX5 A;  2HYF A;  3IRR A;  4A3J G;  3LA3 A;  5DDG A;  5LHH A;  3CO6 C;  2AXL A;  2Y69 H;  2STT A;  2JA5 J;  1X1D A;  3UFX B;  1T0F C;  5I47 A;  4HEA 2;  4RM3 A;  4KIT B;  2KIF A;  5ICE A;  1DPU A;  1J7K A;  2FJ1 A;  3FXJ A;  3FF5 A;  3PFI A;  1KZH A;  1Y1W G;  2R7W A;  1YI2 I;  3LSG A;  3CDH A;  4LG3 A;  1FY7 A;  3QYB A;  2OA4 A;  2W48 A;  1RNL A;  2DA1 A;  2DT5 A;  3B02 A;  3BG5 A;  2B0L A;  4XLP F;  1YQA A;  2CQN A;  3RKX A;  2J6T A;  1JGS A;  1SC7 A;  3H92 A;  4PSW A;  3BCA A;  4GKK H;  2FBH A;  3MIP A;  2V1X A;  1OJL A;  1IN8 A;  2K9Q A;  2EZL A;  2QEN A;  4APM A;  3GEZ A;  3LSI A;  1Z7U A;  2IBD A;  1JDE A;  2SCU B;  4IZZ A;  1K4T A;  3LML A;  4HYK A;  4C2M J;  3QOD A;  4A0X A;  2K7L A;  4LJZ F;  2QYZ A;  3UR3 C;  4DYC A;  2JA7 G;  3HG9 A;  2XGP A;  1OPC A;  3BAB A;  5FPO A;  1XSX A;  1MJA A;  3ASN H;  1TQM A;  2R7F A;  2XAQ A;  3WE3 A;  5IYD G;  3CCY A;  3GF2 A;  4AYB N;  2HJW A;  5H6R A;  3O8G A;  2Q0O A;  4CCL A;  1NK2 P;  1K7A A;  3LSJ A;  5HDK A;  5ILU A;  4DYR A;  3L2P A;  4X62 H;  5C1P A;  4HW0 A;  3IN5 A;  2HKX A;  3JR9 A;  3EUK L;  5DCM A;  2IT0 A;  1M5X A;  4PJ0 C;  3OYB A;  2VBW A;  1R5H A;  3CP8 A;  2JPC A;  3GUD A;  4LFA H;  4A3B J;  4WF2 A;  1MOW A;  5DGB A;  3ZQQ A;  2G7H A;  2HPM A;  4B09 A;  1DGS A;  4YJ2 F;  2IRF G;  4N4O B;  4ENJ A;  1IRG A;  3BZC A;  3FMQ A;  1B6R A;  2L4A A;  4RZR A;  2CQX A;  1J09 A;  4GFB A;  2HQ5 A;  1B24 A;  1SYX B;  2DJN A;  2ZME A;  1SEI A;  1QGP A;  4MV1 A;  4C3I J;  3G3Z A;  4RU9 A;  1Z1D A;  4H0E A;  3KAJ A;  3CCR I;  1EJ9 A;  3W6V A;  2DLL A;  1PX2 A;  3HHH A;  5KFG A;  3PUF A;  5JFR A;  1LJ9 A;  3GXO A;  4GGG A;  2W7N A;  4DR6 H;  4L5E A;  5KFM A;  1AU7 A;  4U7D A;  3WE2 A;  4MQ9 F;  3BTC A;  3CJR B;  2E7X A;  2ISY A;  1QRY A;  5FKM A;  4QFQ A;  5IWA H;  3M8E A;  2VBL B;  1EH6 A;  1HOM A;  2X6Y A;  2Z99 A;  4FCY A;  5IYZ F;  2LSO A;  3H0G J;  4DL7 A;  5A2Q W;  4F93 B;  4UCO A;  3HL2 A;  1IDY A;  1MMG A;  3OUU A;  1IUF A;  1Y1V J;  4HV5 A;  2LLK A;  3P9K A;  1YJ9 I;  1B8I A;  1HW1 A;  4DL4 A;  3RBE A;  5EWE A;  3HPH A;  4MV6 A;  2DA7 A;  4HSR A;  4OWR B;  1GSA A;  5KT2 A;  1GV2 A;  4BY7 G;  4AYB E;  3W2A A;  2E1C A;  1O7F A;  4PGG A;  1A9X A;  4B48 A;  5DCM B;  1K79 A;  3MAJ A;  1PK8 A;  4MLO A;  5D5X B;  2UUC H;  4OMZ A;  3ZCO A;  3GBG A;  3CMY A;  5K7F A;  3HGY A;  3DPL C;  1B72 B;  1IRF A;  4KMU X;  5C5J A;  4ZYE A;  1G9Z A;  1LFU P;  3OSP A;  2M7A A;  2P0A A;  5J6X A;  3IGD A;  3FKI G;  3K69 A;  4MA5 A;  5DS9 A;  2EV6 A;  1YW9 A;  4QWE A;  3K70 D;  3WTT C;  4FET A;  2QQA A;  3O6B B;  5LHI A;  3HGG A;  3IP4 B;  1WCM A;  1OCR H;  3CC2 I;  2I3P A;  1ZHF A;  1R58 A;  3OR1 C;  4PJJ A;  1I1S A;  4M72 A;  5HLT A;  2VL8 A;  3BJO A;  3KEQ A;  4XZ3 B;  3WO0 A;  4A3M G;  2QVO A;  3CO7 C;  3KIO A;  4EGZ A;  5KVR A;  4JYA H;  3B73 A;  3QPS A;  5FKN A;  2GOM A;  3EUH A;  3BPV A;  2CYY A;  4CA0 A;  4UNO A;  1AUX A;  3KHL A;  1TL8 A;  1JE8 A;  4RAZ A;  4IHT A;  2VUM A;  5TIS C;  3HKZ N;  2IGK A;  3IH2 A;  1R9T J;  4UHT A;  2XGE A;  1GVJ A;  4HNT A;  1Z21 A;  3SFI A;  1F4K A;  2EV0 A;  1SFU A;  3FXU A;  4BY1 J;  1S7E A;  3C2G A;  5L3F A;  2NS0 A;  5B3S H;  4D1Q A;  3MR6 A;  2VA3 A;  3MKY B;  3KET A;  3BQY A;  3ERM A;  3CP2 A;  3J7A O;  2FK2 A;  5T14 A;  3QQA A;  4IWX A;  3T1Y H;  1OR7 C;  3OHA A;  2DLN A;  1MSE C;  1XMX A;  2W9B A;  2OBP A;  3OYN A;  1WJF A;  2KPM A;  2ZME C;  2EZI A;  3MVP A;  3S93 A;  3ZMV A;  4HF2 A;  2LVS A;  3JRA A;  2FQ4 A;  4XSX F;  4EV0 A;  1NG7 A;  2JT1 A;  3L2Q A;  4L0Y B;  4EFJ A;  3V7C A;  4HQ6 A;  5F1J A;  1LWS A;  2KDZ A;  2K9N A;  2VOD A;  4C5A A;  2RKH A;  2RN7 A;  5GAG J;  1QPI A;  2COM A;  2DPU A;  3PO2 J;  2X6X A;  1WH7 A;  1ENH A;  3MKL A;  3F8M A;  4AVZ A;  4ZDO A;  1R7J A;  2PVP A;  1X3U A;  1R9T A;  3TP0 A;  1R49 A;  3JAM K;  4YIS A;  2L4M A;  2H09 A;  1N36 H;  2JEG A;  3WGH A;  2LOO A;  1R5I D;  3JAM Z;  5BMZ A;  4R79 A;  3KYL A;  3F6O A;  5KFR A;  2BQR A;  3GV8 B;  2HTS A;  2R7Q A;  4YJ3 F;  5FRO A;  2W8K A;  4DR1 H;  3J7Y J;  4FX4 A;  1MJ9 A;  2FPG B;  2LH9 A;  3KAK A;  2AHQ A;  4IPA A;  4DR7 H;  4HA8 A;  4PJN A;  1MH3 A;  3R0J A;  1XCV A;  5E5S A;  3W2V A;  2MGQ A;  3K4K A;  2RDJ A;  1YX3 A;  3L2R A;  1TNS A;  3MFH A;  3T5X A;  1R4M B;  4RAY A;  4IOC F;  2HKO A;  2R86 A;  3H9J A;  3H1C A;  1IZ1 A;  3A01 B;  3PVX A;  1FP1 D;  3H3U A;  3I64 A;  2ELJ A;  3DTI A;  5H6Q A;  2R7S A;  1S72 I;  1P6R A;  4EJW A;  5FO5 A;  2ME6 A;  4OIO F;  3PW0 A;  3LSP A;  5E79 C;  3K5H A;  2IN8 A;  1RJP A;  1S7A A;  4KIB A;  3NAU A;  2DN0 A;  4DR3 H;  5KG5 A;  4NXN H;  3LMM A;  1XSV A;  3G4S I;  3QU3 A;  1CQI B;  2GXB A;  1D8K A;  1YX5 A;  1JGG A;  2HFH A;  1PUE E;  4XKB A;  1N3F A;  3DTE A;  5HOD A;  3K3V A;  1JKJ B;  4M9U A;  2WB1 N;  3E6C C;  1SFO A;  3IWZ A;  1ZGA A;  1XGN A;  2ZJP F;  2ACJ A;  1VQ7 I;  5IP7 G;  3HXL A;  1B9N A;  2JRT A;  3OOU A;  5FLM J;  3BJ6 A;  5GPA A;  4IZO A;  2EFQ A;  2FQ3 A;  3E5U A;  3P7N A;  3IRQ A;  4EGY A;  4UN9 G;  2G0E A;  1XC5 A;  2ZFW A;  4I7H A;  4O6J A;  1Z05 A;  2E35 A;  2IXS A;  3VYS B;  2KZG A;  3RCO A;  4O2B F;  3JCU C;  3BG9 A;  2CWE A;  3N05 A;  2FEZ A;  5D4R A;  5KG6 A;  3HOZ J;  5J4Y A;  4MV7 A;  4QSH A;  2EBI A;  3PUB A;  1A31 A;  2M4G A;  3GVA A;  5KFB A;  3MX9 A;  2MLK A;  3KEO A;  3NGD A;  3GQC A;  1XMA A;  3REO A;  3R23 A;  3SZP A;  3RB6 A;  3ORR A;  1XNQ H;  3HSE A;  2KQR A;  2ZB9 A;  2AQF A;  4F92 B;  2K5C A;  5CYV A;  2Y0S N;  3S8P A;  2BY2 A;  2R7Z G;  4HLX A;  2YZN A;  2QQ8 A;  2ZJR F;  1GPP A;  4RNO A;  2ALZ A;  3S15 J;  3G1O A;  2GBY A;  2C2E A;  4KA4 A;  4EJT A;  4EYI B;  3DBR B;  5JUM A;  2M45 A;  2FP4 B;  1ZH5 A;  3WHC A;  3SI8 A;  1L0O C;  1YW8 A;  3KLO A;  3GTK A;  1TTY A;  4FQG A;  3K4N A;  4F4X A;  1PUF A;  4AAD A;  4I50 F;  2OAZ A;  3KX2 A;  4HRI A;  3HOS A;  1VI0 A;  5E3L A;  2E1M B;  2NU9 B;  3RFC A;  1KQ9 A;  3IUO A;  2L54 A;  2X85 A;  3ECO A;  1WSC A;  3N41 B;  3RTR A;  5CVI A;  4M3D A;  2EWN A;  1FKA H;  1YYV A;  3CF2 A;  3TKY A;  3DQV C;  2VT3 A;  2JA8 J;  4DV2 H;  2LF7 A;  3TED A;  3OIQ A;  4ZYG A;  2LY9 A;  2LQM A;  2R7M A;  1U78 A;  1X3W B;  2VE9 A;  1I94 H;  4Q47 A;  3LQR A;  5KG7 A;  3TOA A;  4B3M H;  2KRC A;  5FFZ A;  2ESH A;  2VC0 A;  1P4X A;  4DQ2 A;  1HKT A;  3BP8 A;  1IDZ A;  4KJZ A;  2VBN A;  3UQ8 A;  1G6N A;  4LG0 A;  3EPG A;  1TA8 A;  5F6F A;  1HNW H;  1FOX A;  2A6H F;  3IHU A;  3P9C A;  4DR4 H;  3GFI A;  3N97 A;  1UST A;  2JUC A;  2JVG A;  2XGX A;  2KSW A;  3AAF A;  4Y4R A;  3DLA A;  4PZJ A;  1G4D A;  4UVA A;  2WC2 A;  3BTJ A;  4PJM A;  3F72 A;  3A1Y A;  5D8D A;  3DP7 A;  1Y8Q B;  1P92 A;  3K6G A;  3L4J A;  3H3V H;  4GYG A;  4G7H F;  3E6D A;  3HOV J;  1U0C A;  2P6T A;  3OWT A;  2X9D A;  4G6D A;  2NVQ J;  1ZG5 A;  2HVS A;  2M87 A;  1Y39 A;  1CS0 A;  3EUA A;  2LDU A;  2FJZ A;  5CQG A;  3WTV C;  3HOV G;  2VQD A;  3B6C A;  2EZH A;  5FD5 A;  1JIH A;  5HLG A;  2VQF H;  1T95 A;  4I99 C;  1NK3 P;  2FXA A;  4HOB A;  3JRG A;  1BJT A;  2GWR A;  1B1B A;  5BPI A;  5KFK A;  1B04 A;  4KFC A;  2XPV A;  4M7E A;  2N8G A;  1FBQ A;  5BQT A;  3S1N J;  2GLT A;  3MKW B;  1S9F A;  4GYI A;  5HNH A;  3RB3 A;  4UNB A;  3WTW C;  2JJ7 A;  2QKL B;  4LGW A;  5CA1 F;  4RGX A;  2Y31 A;  5FKO A;  4IRI A;  3T5J A;  3BZ6 A;  3MMY B;  2O3F A;  3U9G A;  4CSW A;  3E97 A;  2HDC A;  4D5F A;  2X1E A;  1DPR A;  5L3B A;  4B4C A;  4J9S A;  4UN8 G;  2FPI B;  1DQ3 A;  2UU9 H;  2XUB A;  4E4H A;  2OPT A;  2OV7 A;  3L7W A;  4JX4 A;  2CH0 A;  2WAE A;  1JJ8 C;  1AHD P;  2CV0 A;  1JUS A;  4HF0 A;  4A3F G;  3DEW A;  1ONV A;  1TT5 B;  4KYW A;  3FM5 A;  4A3J J;  3M9M B;  1KU9 A;  2CO5 A;  4AC0 A;  5K5O A;  1FJG H;  3LOC A;  3N6X A;  5KG3 A;  1IGN A;  3HKZ E;  4DL6 A;  4ZTJ A;  2JVH A;  2RV8 A;  4G6Q A;  2XC9 A;  4JI8 H;  4XLE A;  5EGO B;  1I7L A;  3QFF A;  4BE0 A;  1T9I A;  2JPB A;  4GKJ H;  1NTC A;  4IRC A;  4EJO A;  5L1L A;  1W5C C;  2CS3 A;  1YRN A;  1T38 A;  2CG4 A;  2BHZ A;  1S3J A;  2MD5 A;  1C0W A;  3BG3 A;  1XB4 A;  4DBR A;  3RB4 A;  1E4E A;  5H2F C;  2CKZ B;  2J5P A;  3AYH B;  2LKS A;  4EM1 A;  1RRJ A;  4ZQI A;  2VQG A;  1G9Y A;  5CQE A;  1AKH B;  3OUZ A;  3GTO J;  2M2E A;  1OYW A;  2JEJ A;  3FIW A;  2AQ4 A;  5GON F;  4WXD A;  2W6O A;  1EF0 A;  3CLQ A;  4A0Z A;  4AIJ A;  2IW5 A;  4C2U A;  3BR6 A;  4BJ5 C;  4KMF A;  1BI3 A;  1YLF A;  2ID6 A;  2IGM A;  2FSW A;  2VQL A;  4UY8 I;  4UN7 A;  1S29 A;  1W5S A;  1ZG3 A;  4XRF A;  1WQ2 A;  4CC5 A;  4JUZ A;  4FE7 A;  4YHH H;  2L9R A;  5L9X A;  4YAK B;  2NS8 A;  3GIL A;  4F7Z A;  1CE8 A;  2FKL A;  1YFH A;  3OIP A;  2R7U A;  1LEA A;  2VC1 A;  3ZN1 A;  3K10 A;  1ZYR F;  4BUP A;  3G8C A;  3J80 W;  4AWX B;  4ESF A;  4ETS A;  2DK5 A;  1D8J A;  2Y9Y A;  3M7G A;  1UHM A;  3QU6 A;  1Y0N A;  4F55 A;  2L3D A;  4TUY F;  1QU3 A;  2M4K A;  1E2X A;  4C5C A;  1T33 A;  2J5O A;  2RGV A;  4QPO A;  4IHV A;  2GA2 A;  5C1O A;  3LST A;  3OSF A;  3HOU G;  1F5T A;  3CF5 F;  2OTJ I;  4Z2Y A;  3I12 A;  5C4J J;  1D0X A;  1VKZ A;  3K4C A;  3AG2 H;  4OOI A;  5J8F A;  2VJI A;  3TMO A;  5CJ9 A;  4YHX A;  9ANT A;  4MV4 A;  1GSH A;  4UUV A;  5ICG A;  1KON A;  2MFZ A;  5HDG A;  4TV7 A;  1XPX A;  1IV6 A;  4JI0 H;  2VBL A;  3PO2 G;  4UCR A;  3KHR A;  1JHF A;  3PSI A;  2HQA A;  3VYT B;  3OYF A;  4BXX J;  5B1A H;  4G9Y A;  2WB1 E;  3ZMZ A;  3RKY A;  1U8B A;  2JWT A;  2G9W A;  2R92 A;  5IY5 H;  5L3E A;  5AIQ A;  1T36 A;  5HBR B;  3KYC B;  3FMS A;  1K78 B;  5F0C A;  3CQZ A;  4M6V A;  3LA2 A;  1ETO A;  5AIP A;  3RPQ A;  4CH7 A;  1WR2 A;  3N42 B;  4FT8 A;  3DXJ F;  4FS1 A;  5EOY A;  4IQJ A;  2XGQ A;  3H20 A;  1RUN A;  3LFU A;  4RUA A;  3MFI A;  1LDJ A;  1VQ5 I;  3GII A;  2ZNY A;  4XYL B;  3OTO H;  1OLT A;  2A69 F;  4UFZ A;  1G59 A;  2KHM A;  4Q43 A;  5KFH A;  2D1V A;  1WJ5 A;  1W36 D;  1IOW A;  3HOW G;  3F8C A;  1POG A;  3WG9 A;  3H5R A;  4HG2 A;  1ULY A;  1T08 B;  3Q0W A;  4BJ6 C;  4PFO A;  4E2U A;  4JI4 H;  2H8W A;  4DJA A;  5EJC A;  1TWC A;  1U5T C;  4AAG A;  1O7L A;  2ISZ A;  3S2D J;  3G1L A;  3PIP F;  3FHZ A;  3CMM A;  4UB8 C;  2XC7 A;  3QYF A;  2F5D A;  2CFO A;  5LP6 F;  5KFC A;  3OYG A;  3ZMU A;  3MKZ A;  3OYC A;  4ED7 A;  1TNT A;  2UUZ A;  4EMS A;  3I9V 2;  4XRS A;  3IWF A;  2W84 A;  1YIT I;  4ESB A;  2XGC A;  1IBM H;  3T1B A;  3OR2 C;  1SD4 A;  1TWG A;  1H0M A;  4O3Q A;  1J0R A;  2DIK A;  3CCS I;  3BPX A;  4DZP A;  4EFE A;  4EFB A;  2DPI A;  3HPG A;  3CLO A;  2LMD A;  4TV8 F;  1I39 A;  4BAY A;  1JLL B;  1DGW Y;  1MMN A;  2XAH A;  4YEL A;  2VKD A;  2H6C A;  2X6W A;  3DEE A;  1HR0 H;  3F3X A;  5L3D A;  3GWZ A;  2Z1D A;  2YZG A;  2YRW A;  3SYT A;  3DPT A;  2FOK A;  3OS0 A;  2D45 A;  2DT7 B;  5BPD A;  1K4S A;  4A12 A;  1D0Z A;  4RB2 C;  2FOW A;  2A07 F;  2FA5 A;  4CZC A;  3K4B A;  3HHG A;  3KXY T;  2ZSH B;  4BBS J;  2JMZ A;  5JVG F;  2ASJ A;  1SFE A;  4BXF A;  3BTI A;  1S5L C;  4RNM A;  1XDN A;  1SVM A;  4JK1 X;  5JHU A;  4EG0 A;  3DWL E;  5C44 G;  4BXU A;  1LFB A;  5B1B H;  4G8X A;  3RI4 A;  2BZT A;  3JRD A;  2DA3 A;  2E7W A;  1MKM A;  2GQQ A;  5D4S A;  3JSO A;  3TIG A;  1HNX H;  4KZS A;  5EDW A;  1TQI A;  2M8E A;  4I6Z A;  5IOZ A;  3BR5 A;  1W1W E;  2M7B A;  3CD6 I;  2D2W A;  2R8J A;  2CUF A;  2XAU A;  5E8I A;  1KU3 A;  1V55 H;  5DV5 A;  4EM2 A;  2K4B A;  2K86 A;  2W85 A;  2XRL A;  3A03 A;  1K1S A;  2J6U A;  1FNN A;  1VQM I;  2M9H A;  1CQT A;  3C1D A;  3CTA A;  2HYG D;  3RIR A;  4J9R A;  1GXQ A;  5J4V A;  2DQL A;  4XOT A;  4JV2 A;  1R22 A;  4M9X A;  2FMY A;  1DV2 A;  4YFK F;  4OAZ A;  2VOB A;  1HA8 A;  3CUQ C;  1LWT A;  1Z0X A;  2DU9 A;  3WU0 A;  4II2 A;  3DBH B;  4J9O A;  4FAS D;  4HNU A;  2BEO A;  5EYR A;  2BW3 A;  3DKX A;  5A74 A;  4L1K A;  5DG7 A;  2VA2 A;  1FLI A;  2F48 A;  2GAU A;  2L7K A;  5HNF A;  1ITY A;  3OV8 A;  4BWS C;  3SZT A;  1DU0 A;  3TIN A;  1YTY A;  3N40 P;  1BIB A;  1KQ0 A;  5KG2 A;  4XLF A;  1Z7L A;  4LFU A;  4DYQ A;  1OWT A;  3MZY A;  1MMA A;  4YG2 F;  1MZB A;  2IBK A;  1UNN C;  2DDB A;  2KJB A;  1K6Y A;  3VWB A;  2DMP A;  4O1R A;  4J9N A;  3BQ1 A;  4HR7 A;  3I4M G;  2Y75 A;  3K70 C;  1U0D A;  3M3Y J;  3JAM W;  3WNZ A;  4LB6 B;  1O75 A;  3E5Q A;  5C44 J;  2GLO A;  2RVC A;  4AIH A;  1D0Y A;  3AG1 H;  1STZ A;  1RUO A;  2PFB A;  4M3G A;  4J01 A;  1W0U A;  1T56 A;  1FBU A;  1AWC A;  3TO9 A;  4ED2 A;  4C9Y A;  1UMQ A;  2R7O A;  3W2W A;  2M0M A;  3Q1K A;  2ZO4 A;  5M5X J;  3DPU A;  3OOL A;  1D5V A;  2HOE A;  2Z2S B;  2R0Q C;  1EYZ A;  5GAD J;  4A3C G;  1SAU A;  4LIT A;  4XRM A;  4NDL A;  2JMW A;  2E1N A;  4KN7 X;  1MMS A;  3Q8P B;  3LL7 A;  3A02 A;  1MI8 A;  4D7M A;  2R92 G;  3RYP A;  4CO8 A;  3FK7 A;  1IRZ A;  4ZI7 F;  5J2U F;  3E3V A;  2O8K A;  2QBY B;  3WTU C;  4OIQ F;  3AG4 H;  1F9N A;  4IJA A;  2E2I A;  1ETV A;  3MFK A;  2RDP A;  3C2H A;  1QA6 A;  1X4O A;  2QF7 A;  4EGJ A;  2LRD A;  3ORQ A;  4QWA A;  4A3E J;  1A04 A;  4DZJ A;  4NC7 A;  3MXB A;  1XNR H;  2LYC A;  2W6Q A;  2IGO A;  3I54 A;  4YAJ B;  5A0M B;  4R8U A;  4PWQ A;  3I53 A;  4LOC A;  2B7E A;  4O3M A;  3QOE A;  4I4T F;  2R4G A;  2HVR A;  3DF8 A;  4KNY A;  1KYW A;  2DPD A;  2OJE D;  5ERI A;  3M8F A;  2W1O A;  4JI6 H;  4XOP A;  3PQJ A;  4FIS A;  3C0W A;  2R5Y A;  1ZG1 A;  1APL C;  2TDX A;  5M3M J;  2QQ9 A;  3BQZ A;  4LIV A;  3NRV A;  1MDM B;  2KT0 A;  5FGM A;  4LF5 H;  1FSE A;  3JSN A;  5A77 A;  5IP9 G;  3SDG A;  1Z6R A;  2LBF B;  4L9T A;  2AGO A;  4WXC A;  5DQG A;  2W24 A;  1LUJ B;  2DO7 A;  2ECB A;  2K3P A;  4GO1 A;  5KCM A;  1MW7 A;  3T5L A;  2LNB A;  5DTD A;  1HLV A;  1TWA A;  1WH5 A;  1V9P A;  1GT0 C;  1MGT A;  1F36 A;  2OF7 A;  2VBY A;  3KLN A;  1RIO H;  1W93 A;  4DLK A;  1O4X A;  4Z1X A;  3C18 A;  4L5J A;  2W8L A;  5IYC G;  4G6T B;  1Y1V A;  3PR5 B;  1JXL A;  5D6F A;  5GTI C;  3JSL A;  5A78 A;  1JTY A;  1ETQ A;  5D8L B;  3BZK A;  5CAE B;  2HOA A;  2LG4 A;  3LAP A;  1U5T A;  1N48 A;  2ZXW H;  2PBI A;  3L1P A;  1YS6 A;  4RB1 A;  4I2O A;  2OQR A;  1ORK A;  1GLV A;  1X4P A;  5F08 A;  4JV5 H;  5IOY A;  4S04 A;  3H36 A;  4FBU A;  3HJE A;  2K3F A;  3A0B C;  2F4M B;  5IP9 J;  3E1S A;  4UCS A;  4HDU A;  3V6K A;  3TP3 A;  5KFJ A;  3HUG B;  1JT6 A;  2BQ3 A;  2UUB H;  2JA6 G;  4GIG A;  1FOW A;  1Y0U A;  3BAA A;  2NXN B;  4Y17 A;  3WTZ A;  3E6B A;  4FU0 A;  3UKG A;  2M1B A;  3FMR A;  5LGU A;  2Z5U A;  3FX3 A;  2FLL A;  2BY1 A;  3LSM A;  2A68 F;  2RRE A;  4HV6 A;  2BYV E;  4FS2 A;  2K4J A;  4KIF A;  4XLN F;  2WTE A;  1JKP C;  3GIM A;  4JI1 H;  2DCE A;  3K4L A;  1OFC X;  1ON2 A;  3U2R A;  3EPI A;  1I1G A;  1Y8R B;  1W96 A;  3L9F A;  4S0H B;  4QWB A;  5KT6 A;  4K0K H;  3RGZ A;  1S8N A;  3G6X A;  2RDI A;  1ZEL A;  4DV1 H;  2IA1 A;  1KGS A;  2L7F P;  1XD7 A;  5IYB J;  4DR2 H;  1SAX A;  1Z91 A;  1MBH A;  3A4C A;  3G2B A;  2JA6 J;  4ENK A;  3L2W A;  5TGT A;  2JA5 G;  2C22 A;  2ZM6 H;  2FNP A;  2FE3 A;  1KJQ A;  2LWY A;  1VQO I;  2R7K A;  3OS1 A;  5EGO A;  2ZCW A;  3ABK H;  2UXC H;  1GVD A;  3CDL A;  5E3M A;  3CCQ I;  2HTJ A;  5IT9 K;  5HV6 A;  5E1Z B;  2RGR A;  4O2A F;  4RS8 A;  3J7Z I;  2Z16 A;  1D1C A;  4OX9 H;  3ESW B;  1MDM A;  2GXG A;  1GXP A;  1R7M A;  2DA2 A;  1QBJ A;  3HSR A;  3R5F A;  1G3W A;  2A6E F;  5KFW A;  4LF9 H;  2LFB A;  2ADU A;  2NAZ A;  2O03 A;  1N33 H;  4MV3 A;  1WWX A;  1PP8 F;  2P0W A;  2GOX B;  2V59 A;  3CC4 I;  2HGS A;  2DFF A;  2WY7 Q;  3TW7 A;  2E2H A;  2DJI A;  3TOB A;  4Q5S F;  3TDZ C;  4NNJ A;  2NNN A;  1SD5 A;  3ROU A;  3N8D A;  3M8J A;  2VE8 A;  2R3S A;  1S0N A;  2KIQ A;  4GXO A;  3FDY A;  1WCM J;  2V7F A;  2CW8 A;  3O8H A;  1A35 A;  1B33 N;  2Q2T A;  1W7P B;  4KHP H;  4UCT A;  4G7Z F;  2EQR A;  5AON A;  4ECU A;  4R1H A;  5KFP A;  4ECW A;  2PBZ A;  4KIC A;  1FBS A;  4ECQ A;  2O61 A;  3GIP A;  4D7N A;  3HOU J;  1HCR A;  4X65 H;  2R93 J;  4DR5 H;  1ON1 A;  1XMO H;  1O3S A;  1S0O A;  1ZRC A;  1A36 A;  4IVN A;  3GTM A;  3KP6 A;  3OYM A;  1E17 A;  2AO9 A;  3H3V K;  1M0W A;  2YYA A;  2DXI A;  2ZDH A;  4NQW B;  4DV7 H;  3CCL I;  5AKF A;  4OIR F;  2VXD A;  3H9G A;  1E4E B;  2W4S A;  2ZXI A;  4Q44 A;  5LXT F;  1IBL H;  3OHB A;  2RNG A;  3SQN A;  2L7Z A;  5K7H A;  3KP5 A;  4M9Z A;  2RAE A;  1GSO A;  2XAS A;  4YIT A;  1ULZ A;  3EYI A;  1UCR A;  2ZSI B;  1EF4 A;  3E6M A;  4RZQ A;  4QWC A;  2XDV A;  3SFZ A;  4C3J J;  1BI0 A;  3FMA A;  2EK5 A;  4X1E A;  4BQN A;  3AL0 B;  2DMN A;  1RZ4 A;  3F22 A;  3KO2 A;  2YW2 A;  3GYH X;  2JN6 A;  5F9N A;  4HX4 A;  3PNT A;  4Z1Z A;  1Y6I A;  2BOL A;  3HIF A;  4M71 A;  2NU8 B;  4EBC A;  1SFK A;  2E5Z A;  1JI8 A;  5LD2 C;  1KJ8 A;  2MG4 A;  3K1M A;  1U6G A;  4L9N A;  4JI3 H;  3CUQ B;  3H35 A;  3PNY A;  4YFX F;  1AN7 A;  3KAL A;  1A5J A;  1I3Q J;  3P9I A;  3LFK A;  5KFI A;  1IW7 F;  1T6S A;  4IRH A;  2QOJ Z;  1P9Q C;  3FKI J;  3K9T A;  5J8C A;  1RJR A;  1R23 A;  3PL8 A;  2IMZ A;  5D1O B;  2YS9 A;  2NVX A;  2OLS A;  2QGU A;  3PFY A;  1R00 A;  1UEL B;  1REP C;  1JTX A;  3QQY A;  4IWY A;  4YR3 A;  2DTZ A;  1MH4 A;  2HI3 A;  3HUG A;  1ETK A;  2R5Y B;  1GO3 E;  5FJ8 G;  4EBD A;  4E6K G;  4A3B G;  3K1N A;  2VKH A;  5DGA A;  3H0G G;  4ECR A;  3A0H C;  2R84 A;  3Q8Q B;  3I4M J;  4F52 A;  1OMI A;  2VPR A;  3QP5 A;  1R1U A;  2JK3 A;  4LLL A;  5KNL A;  1IG7 A;  3G6Y A;  1IRX A;  4B1R A;  2F2E A;  2BVM A;  1GLN A;  5D5V B;  1IJW C;  4A3L J;  1WZ2 A;  2W6M A;  3I71 A;  4A3D J;  3ZQG A;  4BGD A;  3T5K A;  3ABT A;  5KFX A;  4AAF A;  1JKO C;  3UNG C;  4RDU A;  1TWF A;  5KFL A;  5DD8 A;  2X0L A;  2FK1 A;  1RK6 A;  3E0J B;  2E2I J;  2UXD H;  4WBN F;  2ZDG A;  2E36 A;  3J7A K;  1W7P A;  2NNY A;  4UN9 A;  3KFW X;  1QHG A;  2FRH A;  4JQF A;  3VSK A;  2IVM A;  4A6D A;  1Z2P X;  4YB8 B;  4EBE A;  2BV6 A;  2ZJ2 A;  3WOD F;  4A3F J;  4A0Y A;  3TDU C;  5GPC A;  2W6N A;  2BE5 F;  3U9T A;  2R8G A;  2VPL A;  5KG0 A;  4E7L A;  1FYK A;  2V1U A;  2OH2 A;  2V4J C;  4B47 A;  1O57 A;  1U5T B;  3VB2 A;  2KMU A;  2ATL A;  4XOR A;  3HRT A;  3HRU A;  3G71 I;  5KG4 A;  1C3O A;  1M6V A;  4WD3 A;  5LGN A;  5DLG A;  4FBT A;  4KT5 C;  1EKE A;  4PDB A;  1VAJ A;  2R7Z A;  1YJN I;  3ABM H;  3QPL A;  3FM3 A;  2P5L C;  2DW4 A;  4M3B A;  4IHS A;  1OIS A;  2P8T A;  4F50 A;  2QKM B;  3IKT A;  3IFJ A;  1I6U A;  2D5V A;  5LYJ F;  1FX7 A;  3JW4 A;  3F8F A;  2ZXH A;  2XSD C;  1OCZ H;  2WDT A;  4F4Y A;  4XKV A;  5LMN H;  2X1C A;  3FD2 A;  4IOA F;  1FMW A;  3MD2 A;  3IKV A;  1OCO H;  4LF6 H;  4YIR X;  1C30 A;  3VOE A;  5J1R A;  2F4I A;  2WV0 A;  4FE4 A;  4YRV A;  3S3O A;  4CIC A;  2Z9O A;  2XPW A;  1TW3 A;  3SJM A;  2TCT A;  3B6A A;  2PN6 A;  3C7J A;  4A93 G;  1D1A A;  2M30 A;  2OZU A;  3BLY A;  3JRB A;  1HKS A;  2QQB A;  2Y0M A;  4XIC A;  1UZC A;  4N9H A;  4HYE A;  2R7L A;  1ZAR A;  2MSY A;  4ZYA A;  3W3C A;  4E7I A;  4O4I F;  2WTF A;  2YCH A;  2DFH A;  2AGQ A;  1T39 A;  5JVL A;  2K40 A;  4BU2 A;  2MH9 A;  2Q2E B;  1KBL A;  2XAF A;  2VI6 A;  4XNF A;  5CPR B;  4UT0 A;  4E7J A;  3MXB B;  4QLC U;  1BXR A;  1UHW A;  2I80 A;  3I0T A;  1V4R A;  3V8J A;  2ZME B;  2EIK H;  5FLM G;  2IPQ X;  2HS5 A;  1TBX A;  4ON0 A;  4IHY A;  2UWM A;  4AQU A;  3J7A Y;  1N32 H;  1SVO A;  1OKR A;  1M7J A;  2B9S A;  3MWM A;  1SEU A;  2F5E A;  2KP6 A;  3F23 A;  1ACI A;  5HLH A;  4XR6 A;  2HVQ A;  1CF7 A;  1E4F T;  1IO2 A;  4ZDL A;  2CW7 A;  4A2U A;  3BDD A;  1VQ8 I;  5E18 F;  1Q1V A;  1P4A A;  3I58 A;  5L3G A;  4L9J A;  3CUO A;  4C2T A;  4DL3 A;  1Y14 B;  3ZMT A;  3OL4 A;  4LLG F;  3V8K A;  4J9P A;  5H80 A;  1YIO A;  1UC9 A;  2VR1 A;  3LNQ A;  1H8A C;  3M9O B;  4YR2 A;  5HS8 A;  1LE8 B;  1I50 A;  3X2Q H;  1IXR C;  5K1Y A;  3ML6 A;  2AB5 A;  1WPK A;  4LG0 B;  3HC7 A;  3RUP A;  5F9L A;  3BOQ A;  1RR8 C;  3MCZ A;  3V8L A;  5A2Q K;  4IQ4 A;  3R7P A;  2WAQ A;  2YS6 A;  4P9F A;  2VPS A;  4CYD A;  3NWT A;  3O3K A;  2YU9 A;  2LCJ A;  4BHC A;  5GTH C;  4KUM A;  3M4O J;  3KP4 A;  2M0C A;  3SE7 A;  4RGR A;  4BEH A;  4HQM A;  4NB5 A;  4D9J A;  4QTR A;  3ZPL A;  4IHW A;  1G3S A;  2XVC A;  2DA4 A;  3AG3 H;  4BBR J;  5EEA A;  1N77 A;  2V1D A;  4OMY A;  4S05 A;  2R87 A;  4C5B A;  2FMA A;  4DGW B;  2QSF X;  3KZY A;  5KKN B;  4WK8 F;  4IRD A;  3PIO F;  3NZM A;  3FKI A;  4NQW A;  4DW6 A;  2R8K A;  1I7N A;  2OQG A;  3VPD A;  2JEI A;  4XRS G;  4EQQ A;  1V5E A;  2C2R A;  5IT9 Z;  3GZ6 A;  1M0T A;  2A5Y B;  1UG0 A;  1P8L A;  2YS7 A;  2LRE A;  1IXS B;  4FM9 A;  4XN0 A;  1ZGW A;  2BY3 A;  4ZZD A;  1TWH J;  1P2F A;  4LLN A;  2PN1 A;  2QK4 A;  1R4N B;  1QQI A;  4AAE A;  3GFM A;  1EZ1 A;  5C3E G;  1BJZ A;  4X64 H;  1X58 A;  3GLL A;  4CC6 A;  2EFN A;  1JX4 A;  5CVV A;  2XAG A;  5E63 A;  1GHC A;  1LNW A;  1FTT A;  1BW6 A;  3GFL A; 
#chains in the Genus database with same CATH homology
 2X6W A;  3DEE A;  5I0A A;  3ZQQ A;  2HPM A;  1DGS A;  1HR0 H;  2Z1D A;  4N4O B;  4LFB H;  3SYT A;  3DPT A;  4IX7 A;  3OS0 A;  4NXM H;  1J09 A;  2DT7 B;  1D0Z A;  1B24 A;  1SYX B;  4RB2 C;  4CZC A;  3K4B A;  1SEI A;  3OYJ A;  3CJQ B;  2E60 A;  3HKZ A;  2ZSH B;  2JMZ A;  3KXY T;  1YE9 A;  2LY2 A;  4BXF A;  2V9K A;  1N78 A;  1XDN A;  3KAJ A;  3N44 B;  2L5Q A;  1X1B A;  2X51 A;  3T1H H;  3BCB A;  1T9J A;  3DWL E;  4LIU A;  2CV1 A;  2KDO A;  2W7N A;  4DR6 H;  3L2U A;  3CZ6 A;  3CJR B;  2WAF A;  1HNX H;  4B44 A;  3SEQ A;  1Z3Y A;  3OL3 A;  4UN8 A;  2VBL B;  2F5V A;  5IWA H;  2X6Y A;  4AYB A;  3EH8 A;  2M7B A;  4DBQ A;  3RF2 A;  4B43 A;  2MCT A;  2E5N A;  3RPU D;  4F93 B;  4UCO A;  3HL2 A;  5A2Q W;  1MMG A;  2XAU A;  2VS7 A;  2R7T A;  4DV0 H;  2DOA A;  4B3R H;  4MTD A;  5AKM A;  4BDZ A;  2WB1 A;  3N43 B;  3HPH A;  3VYR B;  4HSR A;  4OWR B;  1VZ0 A;  4XOT A;  5FLX W;  3W2A A;  4ITV A;  2PMZ A;  4B48 A;  4CCM A;  2Q2U A;  2VQC A;  4OAZ A;  4PJL A;  4ZDP A;  3IAS 2;  1W36 C;  1HA8 A;  1LWT A;  2VOB A;  3SEZ A;  4II2 A;  4UCV A;  4MLO A;  4FAS D;  4HNU A;  3ZCO A;  2UUC H;  5A74 A;  4JI5 H;  2BW3 A;  3DKX A;  3GBG A;  3PNV A;  4ZC3 A;  3DPL C;  3C0F B;  2CUZ A;  1G9Z A;  4D6N A;  2L7K A;  2DCH X;  5HNF A;  2M7A A;  2R7R A;  3IGD A;  1WJE A;  3MIS A;  2WAD A;  4D6O A;  4BWS C;  2I3Q A;  1V5G A;  2CMP A;  1DGR M;  2VIX A;  2BVL A;  2WY8 Q;  2O5R A;  1Z7L A;  4FET A;  4XLF A;  3IP4 B;  2WE6 A;  4RLQ A;  1X19 A;  3A2K A;  3RIZ A;  4XLC A;  3EPZ A;  1MMA A;  2IN9 A;  2I3P A;  3K4J A;  1MZB A;  4P1W A;  3VWB A;  1K6Y A;  3OR1 C;  4PJJ A;  3ZXS A;  5E67 A;  5HLT A;  4ZJZ A;  4O1R A;  2VL8 A;  2OWO A;  2UUA H;  4PSX A;  3K70 C;  1U0D A;  1DFA A;  2LY1 A;  1VDE A;  3JAM W;  4XKW A;  1O75 A;  4JYA H;  2GOM A;  5HVQ C;  4LSX A;  2XSJ C;  1D0Y A;  4CA0 A;  4J01 A;  1S03 G;  4NUB A;  3OS2 A;  4II3 A;  4RAZ A;  4C9Y A;  4LOX A;  4IAJ A;  2R7O A;  2IGK A;  3W2W A;  2HNH A;  2M0M A;  4HNT A;  4KIS A;  3OOL A;  3DPU A;  1Z21 A;  5A72 A;  4MV9 A;  2Z2S B;  3RGX A;  2F4V H;  3C2G A;  4DIQ A;  1SAU A;  3FHN A;  4LIT A;  4D1Q A;  3BG6 A;  3OYE A;  2IS6 A;  3MKY B;  1X9N A;  3LL7 A;  4JI7 H;  3CP2 A;  1MI8 A;  2VBO B;  1P8K Z;  3T1Y H;  3OY9 A;  1OR7 C;  3OYN A;  1WJF A;  2KPM A;  3S93 A;  2V26 A;  1IBK H;  4UCU A;  1NG7 A;  4UNC A;  3L2Q A;  4X66 H;  4EFJ A;  3C2H A;  1X4O A;  2LRD A;  2HZD A;  3MXB A;  1XNR H;  4NC7 A;  4O1S A;  2MAB A;  1LWS A;  2LYC A;  2L9S A;  2IGO A;  1LKX A;  3H0D A;  4BL0 B;  1UM2 A;  5A0M B;  4A2B A;  4EAT A;  2X6X A;  4YY3 H;  1AA7 A;  2IS4 A;  3QOE A;  4AVZ A;  4ZDO A;  4KL6 A;  2R4G A;  2HVR A;  2WYO A;  5KHD A;  4YIS A;  2W1O A;  4JI6 H;  4XOP A;  1N36 H;  3C0W A;  1WH2 A;  2LOO A;  3U21 A;  4LIV A;  4R79 A;  3KYL A;  3S3N A;  4LF5 H;  1X1C A;  1X1A A;  1N32 H;  5FD6 A;  2R7Q A;  3IAM 2;  3JSN A;  1NG6 A;  5A77 A;  5FRO A;  2W00 A;  2LBF B;  4DR1 H;  1D1B A;  4BJT A;  2XF7 A;  4PFP A;  5KCM A;  2LH9 A;  4BDY A;  2K3P A;  3KAK A;  4DR7 H;  4EEQ A;  4PJN A;  1MW7 A;  4BE2 A;  1TAE A;  2IS1 A;  5E5S A;  3W2V A;  1V9P A;  3K4K A;  4LH7 A;  3DKY A;  1YX3 A;  3L2R A;  4Z1X A;  4F91 B;  4UCS A;  2JNQ A;  4G6T B;  4RAY A;  3H9J A;  4RLF A;  3AL0 C;  3JSL A;  5A78 A;  2R7S A;  2ELJ A;  3DTI A;  2IS2 A;  4BE1 A;  2FLD A;  2KLO A;  4BQQ A;  5BR8 H;  4DOZ A;  2LG4 A;  2IN8 A;  4DV4 H;  4RB1 A;  4GRI A;  1X4P A;  4DR3 H;  4NXN H;  4JV5 H;  3LMM A;  1PJR A;  2HU9 A;  3S3M A;  5FRM A;  4OAY A;  3E1S A;  1YX5 A;  1LFP A;  1DQU A;  3CES A;  4PK4 A;  4XN3 A;  4XKB A;  1FMV A;  3FBN B;  3DTE A;  3DU5 A;  3HUG B;  3VSL A;  1N3F A;  4GIG A;  3K3V A;  2UUB H;  3BAA A;  4LFC H;  2IGN A;  3AFH A;  3HXL A;  3RSN A;  1ZHQ A;  3LSM A;  3OOU A;  5FRN A;  2RRE A;  3QYE A;  4UN9 G;  3N40 P;  4JI1 H;  3K4M A;  4I7H A;  4F3Q A;  2DCE A;  3K4L A;  2IXS A;  2MYS A;  3VYS B;  4Z20 A;  3RCO A;  1AT0 A;  3SDB A;  3PJR A;  1Z2O X;  3N05 A;  2XF5 A;  3SZG A;  3ONQ A;  1Y56 A;  5D1O A;  1TT0 A;  4K0K H;  4MV7 A;  3RGZ A;  4DV1 H;  1ZEL A;  4XLH A;  4E7K A;  3PUB A;  4AQX A;  4DR2 H;  2M4G A;  2XIG A;  2L8L A;  2Q1Z B;  3MX9 A;  3A4C A;  3G2B A;  1XNQ H;  3ZRG A;  2KQR A;  2VJ5 A;  5TGT A;  4XM3 A;  3L2W A;  3UVF A;  2ZM6 H;  2AQF A;  4AU7 A;  2FE3 A;  2LWY A;  2FUG 2;  4F92 B;  3OS1 A;  2K5C A;  1UAA A;  2UXC H;  3S8P A;  1N75 A;  3L4K A;  2RGR A;  1BP7 A;  1AF5 A;  4ZTF A;  2Z16 A;  1GPP A;  1D1C A;  4OX9 H;  1WJA A;  1R7M A;  4LF9 H;  2HPI A;  2VUG A;  4KL5 A;  1N3E A;  2O03 A;  4U7B A;  1N33 H;  2P0W A;  2GOX B;  2VBO A;  2HGS A;  4XON A;  4GLX A;  2WY7 Q;  4XMY A;  4OZ6 A;  4IKF A;  2DJI A;  3K4N A;  3F9K A;  4NNJ A;  4Q0Y A;  4DV3 H;  4B3S H;  2LBF A;  4AAD A;  3M8J A;  3M4I A;  2E1M C;  3KX2 A;  4P5O A;  4HRI A;  2WA0 A;  3HOS A;  2WBM A;  3FDY A;  4HST A;  2V7F A;  2CW8 A;  2E1M B;  5K08 A;  2Q2T A;  4KHP H;  3IUO A;  3OYH A;  1ZDE A;  2X85 A;  4UCT A;  3N41 B;  3RTR A;  1FKA H;  1BR2 A;  5AKN A;  4BQO A;  4DV5 H;  3CF2 A;  1BOB A;  3DQV C;  3L2V A;  2VB6 A;  4DV2 H;  2LQM A;  3OIQ A;  2XE0 A;  4X65 H;  3MXA A;  4DR5 H;  1XMO H;  2BW3 B;  2E5L H;  1I94 H;  4B3M H;  4R7R A;  2KRC A;  3UQ8 A;  3OYM A;  4DUY H;  1M0W A;  2VBN A;  4KJZ A;  4LF4 H;  2DXI A;  4NQW B;  1EA3 A;  4DV7 H;  5AKF A;  1HNW H;  2L9N A;  2XF6 A;  2VXD A;  3H9G A;  4DR4 H;  2W4S A;  2ZXI A;  4E2T A;  4C30 A;  3D5R C;  1IBL H;  2RNG A;  2KL4 A;  2JVG A;  2IN0 A;  2XE0 B;  2KSW A;  4Y4R A;  3CVZ A;  3DLA A;  2O7M A;  1U0J A;  4YIT A;  2ZSI B;  4PJM A;  5HOO A;  3A1Y A;  4RZQ A;  1MMD A;  2XDV A;  2X1D A;  3OYD A;  3FMA A;  2V1N A;  3K6G A;  3L4J A;  2AQE A;  4BQN A;  2PJR A;  3AL0 B;  3KO2 A;  1BGW A;  2W57 A;  1U0C A;  3PNT A;  4Z1Z A;  3OWT A;  1Y6I A;  4UNA A;  1L2Z A;  2BOL A;  5AK9 A;  2HVS A;  1SFK A;  2E5Z A;  1JI8 A;  5A0M A;  3EUA A;  5LD2 C;  3FKJ A;  5CQG A;  4AAB A;  1G8X A;  1WJB A;  2VJ4 A;  3H35 A;  3PNY A;  2VAS A;  3C0X A;  1AN7 A;  3KAL A;  5FD5 A;  2KZV A;  2VQF H;  1T95 A;  2EX5 A;  5IT9 W;  1LDK B;  2VBJ B;  2QOJ Z;  2PJR B;  1P9Q C;  1ERD A;  4UN7 G;  3PN1 A;  1BJT A;  3PL8 A;  2IMZ A;  5FPR A;  3K70 D;  4Y3O A;  1B04 A;  5D1O B;  4B3T H;  1ZHS A;  1E4G T;  3IG0 A;  3DTK A;  4M7E A;  3PFY A;  3QQY A;  1UEL B;  3MKW B;  1MND A;  2VXZ A;  1A0I A;  5HNH A;  4UNB A;  4E6K G;  2QKL B;  2VKH A;  2K9M A;  1Z3X A;  3H9Q A;  2CUJ A;  2LC2 A;  3MMY B;  4F52 A;  3RQ4 A;  3FBI B;  5KNL A;  2JUG A;  4PUS A;  2DT6 A;  3DF7 A;  1IRX A;  3OYA A;  4CSW A;  2BVM A;  1GLN A;  4B3X A;  2X1E A;  2HDW A;  3F8N A;  4BGD A;  2K9L A;  4NC8 A;  3HOT A;  4BEH B;  4AAF A;  2ZFU A;  4BAC A;  3UNG C;  4UN8 G;  3KEY A;  4JI2 H;  1DQ3 A;  2UU9 H;  5D1P A;  4XLA A;  4E4H A;  1ZD7 A;  2OUM A;  2R7X A;  2VS8 A;  3EYY A;  2OV7 A;  4Y33 A;  2CH0 A;  2WAE A;  3E0J B;  3OYK A;  2CV2 A;  2CV0 A;  3HYI A;  1HNZ H;  2UXD H;  3OYI A;  3J7A K;  4UN9 A;  1TA8 A;  4JQF A;  1QHG A;  3VSK A;  4KT6 A;  1AM2 A;  1Z2P X;  4LF8 H;  1E0E A;  1FJG H;  2VQH A;  3N6X A;  2OC6 A;  3BG7 A;  2V6E A;  3E54 A;  4ZTJ A;  3NWS A;  2JVH A;  2VPL A;  3BC8 A;  1WJC A;  4E7L A;  4JI8 H;  2V4J C;  4E7H A;  4XLE A;  4B47 A;  4MTE A;  4J0M A;  3ZGK A;  4BE0 A;  1T9I A;  4GKJ H;  2KMU A;  2UV1 A;  2UXB H;  1TZL A;  4XOR A;  4CUG A;  2CS3 A;  4E7S A;  2VLA A;  4PDB A;  3BA8 A;  3AKZ A;  3LSH A;  3H5N A;  3PSF A;  4DBR A;  1S68 A;  4JI3 H;  5LMN H;  2QKM B;  2L2O A;  3IFJ A;  4QPQ A;  4DUZ H;  1I6U A;  1GYF A;  3HYJ A;  3DU6 A;  2ZXH A;  2VQG A;  2WDT A;  4XKV A;  1VS0 A;  2X1C A;  3LSK A;  3TL4 X;  1FMW A;  3V42 A;  3VDX A;  4BS9 A;  3FD2 A;  3MD2 A;  1G9Y A;  2ZJT A;  4LF6 H;  5CQE A;  2F4I A;  2Y0S A;  4YRV A;  3S3O A;  1XMQ H;  1V5F A;  3J81 W;  1S9H A;  4N4N B;  1EF0 A;  3EUH C;  4RB3 C;  5CKT A;  3OMY A;  4CCO A;  1BR1 A;  4C2U A;  4E7Z A;  4BJ5 C;  4CCK A;  3I3L A;  1D1A A;  3BLY A;  5A0W A;  2IGM A;  2MC4 A;  4LQ0 A;  2VQL A;  4UN7 A;  3TBI A;  2F6C A;  2VBJ A;  4DV6 H;  4RMN A;  4X0G A;  4CC5 A;  2W82 A;  4ZYA A;  3W3C A;  4E7I A;  4LH6 A;  4YHH H;  4JOM A;  2YCH A;  3H5A A;  2MD0 A;  2VBN B;  1BR4 A;  4ANJ A;  3OIP A;  4BU2 A;  2Q2E B;  2R7U A;  4XNF A;  5CPR B;  4UT0 A;  5LFA A;  2A5W A;  4E7J A;  3MXB B;  3K10 A;  5E5O A;  2M3A A;  4LF7 H;  4BUP A;  3J80 W;  5LL6 b;  1FVI A;  4ETS A;  3M1C A;  4AQU A;  2A6T A;  2NOJ B;  2UWM A;  3J7A Y;  1LVK A;  1WFX A;  4F55 A;  4CCJ A;  1QU3 A;  2M4K A;  1Z2N X;  2VQE H;  4QPO A;  2RGV A;  3MWM A;  4CCN A;  4AQY H;  2KP6 A;  4XR6 A;  2HVQ A;  3OYL A;  4LSA A;  1E4F T;  4A2A A;  2R7V A;  4ZDL A;  2CW7 A;  1D0X A;  3VYU B;  1R6R A;  3K4C A;  2VJI A;  4J00 A;  3TMO A;  1J5E H;  4YHX A;  3RTX A;  4C2T A;  4RM2 A;  1KON A;  2MFZ A;  3OL4 A;  3S32 A;  1X1D A;  2HHH H;  2VBL A;  4JI0 H;  4UCR A;  1T0F C;  3PSI A;  2HQA A;  3VYT B;  4XQF A;  4H4K C;  4HEA 2;  4YEJ A;  1MNE A;  4RM3 A;  4KIT B;  3OYF A;  3RJ0 A;  3ZR8 X;  2AB5 A;  3HC7 A;  2R7W A;  4LMY A;  5LMU H;  3LSG A;  4IQ4 A;  4LG3 A;  4RB0 A;  3QYB A;  2JA2 A;  2I8D A;  3R7P A;  2WAQ A;  4CH7 A;  3N42 B;  4HPQ A;  4PSW A;  4IQJ A;  2VPS A;  3NWT A;  3H20 A;  3BCA A;  5EOY A;  3LFU A;  3MIP A;  4GKK H;  2LCJ A;  3OTO H;  1OLT A;  4UFZ A;  4APM A;  1G59 A;  2KHM A;  2JSP A;  3LSI A;  4BEH A;  4D9J A;  1WJ5 A;  1W36 D;  4XKC A;  4IZZ A;  2VJJ A;  1N77 A;  3LML A;  3H5R A;  4HG2 A;  4JI4 H;  4E2U A;  4BJ6 C;  3QOD A;  4PFO A;  4DGW B;  4DJA A;  3BA9 A;  4AAG A;  3NZM A;  3OOR A;  3UR3 C;  3HG9 A;  3CMM A;  3BAB A;  5FPO A;  2XC7 A;  3D5S C;  3QYF A;  1DP3 A;  2CFO A;  1V5E A;  3OYG A;  3MKZ A;  5JHF A;  3OYC A;  1N34 H;  2UUZ A;  1M0T A;  3I9V 2;  1UG0 A;  4U87 A;  1P8L A;  2LRE A;  4FM9 A;  1IBM H;  1WJD A;  4XN0 A;  3OR2 C;  4CCL A;  1QHH D;  3D5L A;  2KRH A;  3L2P A;  4AAE A;  4X62 H;  4EFB A;  4EFE A;  4X64 H;  3HPG A;  3EUK L;  1M5X A;  4CC6 A;  3OYB A;  1JVA A;  3CP8 A;  2RQQ A;  4XL9 A;  5E63 A;  1DGW Y;  1PYV A;  2KEQ A;  1MMN A;  4LFA H;  4YEL A;  2VKD A;  1MOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...