2CW7A

Crystal structure of intein homing endonuclease ii
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
537
structure length
537
Chain Sequence
SILPEEWLPVLEEGEVHFVRIGELIDRMMEENAGKVKREGETEVLEVSGLEVPSFNRRTNKAELKRVKALIRHDYSGKVYTIRLKSGRRIKITSGHSLFSVRNGELVEVTGDELKPGDLVAVPRRLELPERNHVLNLVELLLGTPEEETLDIVMTIPVKGKKNFFKGMLRTLRWIFGEEKRPRTARRYLRHLEDLGYVRLKKIGYEVLDWDSLKNYRRLYEALVENVRYNGNKREYLVEFNSIRDAVGIMPLKELKEWKIGTLNGFRMRKLIEVDESLAKLLGYYVSEGYARKQRNPKNGWSYSVKLYNEDPEVLDDMERLASRFFGKVRRGRNYVEIPKKIGYLLFENMCGVLAENKRIPEFVFTSPKGVRLAFLEGYFIGDGDVHPNKRLRLSTKSELLANQLVLLLNSVGVSAVKLGHDSGVYRVYINEELPFVKLDKKKNAYYSHVIPKEVLSEVFGKVFQKNVSPQTFRKMVEDGRLDPEKAQRLSWLIEGDVVLDRVESVDVEDYDGYVYDLSVEDNENFLVGFGLVYAHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endonuclease PI-PkoII
publication title Crystal structure of intein homing endonuclease II encoded in DNA polymerase gene from hyperthermophilic archaeon Thermococcus kodakaraensis strain KOD1
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 160
structure length 537
sequence length 537
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2005-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14528 LAGLIDADG_3 LAGLIDADG-like domain
A PF14890 Intein_splicing Intein splicing domain
A PF18714 PI-TkoII_IV DNA polymerase II intein Domain IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1010 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2cw7A02
2.170.16.10 Mainly Beta Beta Complex Endonuclease - Pi-scei; Chain A, domain 1 Hedgehog/Intein (Hint) domain 2cw7A01
3.10.28.10 Alpha Beta Roll Endonuclease I-creI Homing endonucleases 2cw7A03
3.30.1490.210 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2cw7A04
4AAEA 2VBLB 2VBNB 2L8LA 2LWYA 3KO2A 2CW8A 4AABA 1N3FA 4UN9G 4E2TA 1G9ZA 5K08A 1MOWA 1GPPA 5AKMA 5AKNA 4LQ0A 5A0WA 1R7MA 4GIGA 2IN0A 2VBJB 1AM2A 4UN8G 1DFAA 1VDEA 1B24A 4AADA 4UN7A 2VBLA 5A78A 2EX5A 2VBOB 2KEQA 3HYIA 2XE0A 4Z1ZA 4LOXA 5E63A 4AAGA 4Z1XA 2VBJA 4AQUA 3QQYA 4EFJA 3IGDA 4E2UA 4D6OA 1ZDEA 1N3EA 2AB5A 1U0CA 4OZ6A 3MXBB 2VBOA 5A0MB 2CW7A 4AAFA 4UNAA 1MI8A 5A72A 2I3QA 4YHXA 2DCHX 2VBNA 1U0DA 4KL5A 4O1SA 2IN8A 4UN7G 4YISA 1DQ3A 5AKFA 3HYJA 3C0WA 1AT0A 3E54A 2I3PA 5E5SA 1T9JA 5E67A 3NZMA 1T9IA 1BP7A 2IMZA 3MISA 4KL6A 4UNCA 3UVFA 1UM2A 2JMZA 2IN9A 2JNQA 2QOJZ 1LWTA 3OOLA 5E5OA 4Z20A 4UN9A 1P8KZ 3OORA 1AF5A 2VS7A 1G9YA 3MXBA 3MX9A 4UN8A 5A0MA 5A74A 1JVAA 3C0XA 2XE0B 5I0AA 5AK9A 4UT0A 4AQXA 5A77A 4UNBA 3IFJA 2LCJA 1LWSA 2LQMA 3R7PA 2O7MA 3EH8A 2VS8A 3MIPA 4YITA 4D6NA 3FD2A 1ZD7A 1EF0A 3MXAA 2FLDA 4O1RA 1M5XA
chains in the Genus database with same CATH superfamily
4WK8F 5FKNA 3EUHC 2K40A 2V1UA 4B3SH 1MIJA 3KO2A 5K7HA 3ASNH 3K1MA 4MV1A 4HEA2 1Z3XA 5KFEA 4X66H 1ACIA 3CCVI 5A0WA 3DCFA 4RGSA 4Q44A 3OS2A 3ZPLA 3HXLA 3F8MA 2F2EA 1E2XA 2JMWA 2QYOA 1Y0UA 2DA4A 3DKYA 2K02A 4IOCF 2IGNA 2Q8KA 1YJ9I 4J9NA 3CCMI 5D8DA 4Y4RA 2LTPA 2VBOB 3JSLA 3OIOA 3RJPA 3VFZA 2EA4A 4CYCA 1TW3A 1XSXA 4IHYA 4A5MA 1RJQA 2FPIB 3K69A 2MBFA 1OCZH 1E3OC 3DF7A 1Q1HA 3NAUA 2VJIA 4AAGA 2MC3A 2XKPA 1KYZA 3GZ6A 2A6HF 4CZZA 4B43A 4EFJA 2DOFA 2R82A 4Q45A 1LUJB 2VONA 2ECBA 1Y8QB 1WI9A 1ZDEA 1EHIA 1O75A 2HTJA 5C4XJ 2JSCA 4DR2H 4LLGF 5KFNA 5HNFA 3HPGA 3PO3J 2K3PA 4BE2A 3RAQA 2W7PA 5J4VA 1XS9A 1SEIA 3R23A 5F1JA 4DUYH 3OWTA 1MBFA 3GTKJ 5EWEA 3IC7A 2BQUA 1RPWA 3FMRA 3P7NA 1T0FC 2LKSA 3CDIA 5B1BH 4Q47A 3TP3A 5J2TF 1TWAJ 1RKWA 2DJIA 2R92J 3H40A 5DG9A 2QA4I 1FJGH 4RLQA 2DMUA 1J5EH 2OBPA 1BGWA 4CCNA 2XGEA 2EQRA 2CW0F 4EYHB 3G1LA 5CPRB 3TDZC 3V6JA 4ANJA 4KIFA 3BG5A 2JA5A 4BXFA 4MFEA 2AQFA 2QK4A 3GTMA 3R6SA 2K9SA 2IVMA 5E1XA 2WTEA 3DBHB 3RPUA 4KL6A 1R4NB 1Z2PX 3CUQC 3PFIA 2L9RA 5BS6A 1D5YA 3CF5F 4HYEA 2JA8G 2VA2A 2FK3A 2PQ8A 4BNCA 3FWEA 2YPRA 4OOIA 2IT0A 4EJVA 1DIKA 4A5NA 1W5SA 1K79A 3ZN1A 5BNGA 4LG3A 2GA2A 3BR3A 4LIVA 1QU3A 2G7HA 3CLOA 4M3GA 3RYRA 2UWMA 4I6ZA 1EH8A 3CCYA 3NRVA 3E5NA 2EZLA 5F0HA 2JA7J 3FKIG 5D1OB 4QTRA 2HZTA 2X1CA 3KE2A 2PJPA 4CYCB 1P4AA 4FISA 4LIUA 1WH7A 3BG3A 3HKZN 3H5NA 5L3DA 1XG1A 2Y0SE 4EBCA 4O2BF 3KLNA 5IYCG 4IRIA 4XLNF 2JT1A 3IH2A 4IF4A 4AVZA 5DDGA 3RI4A 3VPDA 1OYYA 1P7JA 3J7YJ 4HYKA 2COBA 4QSHA 2DT6A 2QBYA 2HKOA 3H35A 5ICGA 4H0EA 2DT5A 2E5NA 3SFZA 3E1SA 4A3IJ 4A3FG 2FU4A 2JA5J 5K2MA 2F4OB 3GTMJ 3G3ZA 1FSHA 3DBLB 2OZ6A 2W24A 1VAJA 1FLIA 1ZD7A 5L1LA 2M0MA 4YELA 4HX8A 2ACJA 2JEIA 1KQ0A 2XPVA 3IRRA 2WE6A 3VPRA 1XSVA 3U1DA 2ZJTA 2K5CA 2WV0A 5K1YA 1F4KA 3FM3A 4YG2F 1WJEA 4BBSJ 1A04A 1VQ4I 1PDNC 4CDGA 1G9ZA 2GA1A 1I50J 3BR6A 3HSEA 5FKLA 1QRYA 5GONF 3A1YA 2F4VH 1GHCA 3GZNB 1WCMG 3DLAA 1A35A 2NOJB 1REPC 1DFAA 1G6NA 3G6YA 4ECSA 4NHJA 2QSGX 3GIMA 1P4WA 1X2MA 4ECZA 4BH9A 5DQIA 3CCRI 1FIAA 3DP7A 3FM5A 4CCLA 2KQRA 2V6CA 1PP8F 1G59A 5FKOA 2IGOA 2EWNA 2VQLA 4LOXA 2R7RA 5E63A 3QYFA 4NQWB 3Q9VA 5DEQA 3OYHA 2YCHA 3C2BA 3BQYA 4ED6A 1S5LC 4HDUA 1WH5A 1XMQH 1OR7C 2Y9ZA 2A07F 3IGDA 1D8JA 4A3MG 2EFPA 3HPHA 5CVRA 1HW2A 3Q8SB 2GXGA 1GGOA 3HTSB 4C30A 2MC4A 1DPRA 2O61A 1BC7C 2ME6A 4A3JJ 2P7VB 2Y30A 3OSNA 2LY9A 3RV3A 4L0ZB 5BPHA 2EFQA 2OH2A 4W97A 1HW1A 5BPDA 1V51A 2MD5A 2IN8A 4L18B 1BXRA 5C8YF 4JI1H 4BQQA 4YISA 1YYVA 4XM3A 2B0LA 4G12A 2P5LC 4FU0A 2WAQE 1Y56A 2VQDA 3FHZA 3PW5A 3C3WA 5E5SA 4LB5A 3RIZA 2EPFA 2HGCA 2QVOA 3BZ6A 3P5JA 2BVMA 4HF1A 3JZIA 4AD9A 2HVQA 3MVPA 2MG4A 1WI3A 3F3XA 3BQ0A 1S29A 2NU6B 4O3PA 4C5BA 2X9DA 1R49A 4C5AA 1APLC 4BY7J 4Q8EA 3BDDA 1D1BA 2AXTC 2IN9A 4FBTA 1BL0A 3RPQA 2W6OA 5EOYA 1X3WB 1SAUA 3FHNA 1LWTA 1RYSA 5IYDG 3HOVJ 4XR6A 3DU6A 5IWAH 2HR3A 3ZMZA 2V1DA 3MXBA 5LD2C 4DL3A 3Q2OA 4J9LA 2AU0A 2Y0SA 1J7KA 3S32A 4I4TF 1T56A 3W2VA 3GTQA 3OUUA 1T36A 2NRAC 2PMUA 2OPTA 4UNBA 4KITB 4EGJA 5KFMA 2P4WA 1ZHQA 2O3FA 3QU3A 1MMSA 3E97A 4FHTA 5DS9A 4EM1A 2HOSA 3CC4I 3V8JA 2D5VA 1YW7A 5J6XA 2ISZA 3ZCOA 2YW2A 3OTOH 4GC7A 4IWYA 2VKHA 1DPUA 1HNZH 3JAMK 1IOVA 1WWXA 2DOAA 4YFNF 4ED1A 3HUGB 4B8XA 3HDDA 5HNHA 3RTXA 2CUZA 2Y9YA 4RM2A 4CCKA 2I8CA 4PDBA 1Z91A 2DI3A 1V4YA 2FLPA 3PIPF 2HXIA 5IP7G 2K4JA 3BA8A 1FIPA 3I71A 2YZMA 1S8NA 3HC7A 4E2TA 2ASJA 2FLLA 2UXBH 1RC9A 2ZCWA 3V7RA 2XASA 4Y7NJ 5E1WA 3M07A 4E4HA 5KFDA 3GIIA 5IT9W 1LE8B 3J7ZI 2FSWA 3R5HA 5KFFA 5ILVA 3UQ8A 1WZ2A 5FLXK 3FMQA 2ZDQA 2WY8Q 5GADJ 1U3EM 4BL0B 2EX5A 1IRFA 3GTQJ 1Z7UA 4XRFA 5HLIA 4C3HJ 3RKQA 3GBGA 3LAPA 3H0GA 2R8IA 2UVVA 1HNWH 3J7AK 1XMOH 4UCOA 2ZC2A 4ZYAA 3RKXA 4EFBA 3MR2A 3OMYA 4LGWA 5LEKA 4AQUA 3FXRA 4HX4A 1ZYRF 4U88A 4ENNA 1SEUA 3S3MA 1OCTC 4RB0A 3P9KA 2FE3A 4ZYEA 1FJLA 1EJ9A 2MLGA 4DIQA 4U0YA 3DEUA 3QPHA 3I58A 3LSRA 2X48A 3RJ0A 1VQPI 5D1PA 4O3OA 1SFOA 3IP4B 3MXBB 1WH2A 4A0YA 5IOYA 4U6PA 5FRMA 2NNYA 2CUEA 4IHXA 2Z1DA 3F8BA 2H27A 2HYFA 1XC5A 3HRSA 4I7HA 4XN0A 3BAAA 4PSWA 2VE8A 4X65H 2HHHH 1B9NA 5LRSA 2HPMA 2K9MA 1ZGAA 2L0KA 4R8UB 4G7HF 4BE0A 3LA7A 1BI0A 1BR1A 2DLNA 3KIOA 1I5ZA 2WAQA 3M1EA 3KHHA 1IC8A 3H92A 4PJLA 2I3PA 3I0TA 3LFKA 3QZ8A 2YRWA 4A3BG 1QVUA 3I64A 5M5YJ 1BN5A 1J09A 3PFYA 4BY1J 1MBJA 3LAJA 2NU8B 3IUOA 4RNNA 2EIMH 4RZQA 3I3LA 2P0WA 5LMNH 1P8LA 4J0MA 4M9UA 3FXQA 2OLSA 1D0XA 5JUMA 2MH2A 5H80A 3LP8A 2ZO4A 2QQAA 2B63G 2D1HA 4C3IJ 1SFOJ 1G4DA 1YRNA 3JSNA 3ONQA 3E7LA 3AFHA 2F4LA 4O3QA 1E0EA 4UVAA 3U9TA 3D5SC 3K7AJ 2HWVA 2I8DA 1OISA 1MMDA 4O6JA 2C2DA 5KVRA 1WFXA 3FZVA 5D6FA 1X9NA 2H6CA 3ZXSA 1XCVA 2VPRA 4XRSG 2FBHA 4AYBA 2DODA 2LNBA 2DU9A 1JHHA 1S7OA 4DBQA 1YX3A 1EH7A 2CGPA 4XONA 4DR1H 1KGSA 2D2WA 5E20A 2EFOA 5KFVA 3M4OJ 3I53A 2E5ZA 3LSPA 3MIPA 1Z6RA 2FJZA 4J01A 3I4MG 1ZRDA 5KFKA 3CLQA 2ATLA 3X2QH 4GCVA 1BJAA 4GLXA 4UY8I 1EF0A 2KPMA 3S2DJ 2R7FA 3KHRA 4C3JJ 5FJ8G 5KFZA 5C3EG 4D1QA 2BBYA 4DR7H 1UMQA 1FNNA 5KFQA 2MGQA 4L5IA 1I3AA 5KT4A 3OYBA 5IP9J 4QW9A 5K08A 1EF4A 1YJNI 2BOLA 2MD0A 4G94A 1R7MA 2FD5A 3FK6A 4N0BA 5KT7A 3ELKA 3HOZJ 2CMPA 3T8RA 2YR2A 3GTGA 1W7PD 3DQVC 4UN7A 4AADA 1U0JA 1UHWA 4HA8A 4WCGA 5A78A 3WGHA 4ECUA 2VOOA 2Y0SN 1IBLH 3Q8QB 2J5PA 2L9SA 3CP2A 5KFYA 4S05A 1X1PA 2VQHA 2UXXA 4HNUA 1MJ9A 3F9KA 3OR2C 5ICCA 2EIJH 1K83J 3R4KA 3F22A 1QZYA 1ON2A 1N36H 1SMYF 2VC1A 1BR4A 4CC5A 1FBQA 1Q1VA 3W6KB 5KKNB 2L9NA 1ZHSA 4NXMH 1RK6A 4EGQA 1JDBB 1JGSA 2WY7Q 1USTA 3WU2C 1U8BA 2DWCA 4CCMA 1Z0XA 2XGDA 3FXOA 1JKOC 1EZ1A 4A3LG 3LSKA 1ULYA 3LSMA 2NVYA 3BPXA 2V5AA 4F3QA 4ED8A 1ERDA 4HG2A 5LYJF 1G3TA 1HKQA 3AG4H 3V4GA 1MI8A 3WG7H 5A72A 1D0YA 1HW5A 2JPCA 4ED3A 4M3BA 2JEFA 5J3LA 3I4NJ 3JW4A 2ELKA 4OIQF 2Z9OA 2C6YA 2MSYA 1I6XA 1BJTA 2DA7A 2M45A 4PGGA 4EEFG 1W7PB 3ZQQA 3HYJA 2HNHA 1QBJA 3LSGA 3K4NA 3HIFA 3F0CA 2PMZE 3F8NA 2BY0A 4BUPA 2P5VA 4OAZA 1T9JA 4KT6A 1HQCA 1VQOI 3RKYA 2R93G 2NOGA 2R5ZA 2DQLA 3MISA 5DD8A 3O2PE 2KT0A 4LITA 1BI2A 2PN6A 5F6FA 2O6GE 4XLEA 1E4EB 4RGUA 3BCBA 1W36C 2DPJA 1B8IB 1QZZA 2JJ7A 4A3EG 3QPSA 4Z6YA 1TWFJ 2NYXA 5GAEJ 2RAEA 5BMVF 1X1BA 4RZRA 2OJED 1M1EB 3F6OA 2M8GX 4C2MJ 3P9IA 4JI8H 3H36A 2DA1A 3CCSI 1R9TA 4UN8A 2LBFA 2R7UA 1QHHD 4NXNH 1JVAA 1LVKA 4FE7A 3PN1A 1WKMA 3ZMVA 1B6SA 5I0AA 4MV8A 2AGPA 3ERED 2M7AA 3C7JA 1S0NA 2LRDA 4P96A 1KQ8A 2R86A 3CTAA 5DQGA 5D6EA 1YFHA 2V7FA 4G6QA 1ENHA 3RKWA 2Z33A 4IRKA 3MCZA 2OUMA 2WAQN 2XHKA 3N44B 2IP4A 3ROUA 1MH4A 3T5XA 2DN0A 3CMEI 1A6QA 3HL2A 3VYRB 3T5KA 3RB4A 4HSTA 2OC6A 1QVTA 3MKYB 3M9OB 2VQCA 1BW6A 2DA6A 3HOXG 1TT0A 2KIMA 1KQ9A 4AAEA 2JEGA 3DXJF 1YTYA 2L7FP 3IKVA 1P4XA 4R79A 1HSJA 2K4BA 4ON0A 2L8LA 5KFTA 1MGTA 5F08A 1TWCA 1R5HA 2ZFUA 4M9ZA 4A3GG 1Y39A 5KFAA 2XGXA 5TISC 2IGKA 3Q3SA 1N56A 4QWBA 2TDXA 4HZFA 2V59A 5BOXA 3HOWG 2BGCA 1Z9CA 3Q5FA 2DMNA 4FCYA 4A3KG 3GMEA 2R5ZB 1S7AA 4IAJA 2XAQA 1FBSA 4F92B 3OOUA 1A36A 3Q1KA 3RBEA 2KKOA 2KEQA 3OL4A 2CYYA 1YIJI 2KMUA 5EZYF 3HYIA 1FY7A 4RAZA 1JLLB 1PJRA 2FJ1A 3BG6A 4DZJA 4Z1ZA 1K61A 2XAGA 5E3NA 2HYGD 1V3FA 2VBJA 1P2FA 4Q48A 1KU2A 3DLLF 1LEBA 2KJCA 3FISA 3K4CA 1VFCA 3GLKA 2IBDA 5KG4A 1P6RA 4E2UA 2GLOA 5J4YA 2K27A 1S97A 3CDLA 1E4FT 4XSXF 4I55F 3DBRB 4OZ6A 1T33A 2CFOA 2LBFB 4M6XA 3EPZA 3V7CA 4CA0A 4IHSA 3JRCA 4IKFA 4LF5H 2CV1A 2LD5A 4BQAA 3BR0A 5KG2A 2IS4A 2DPIA 2ELHA 5IYBG 1Z6TA 2R7SA 1OCOH 2R7NA 4PWQA 2EJRA 2O8XA 2IA0A 3JR9A 2A68F 3Q8RB 1G3WA 4GYGA 4BHCA 1M7JA 2R8KA 2E5LH 3FMSA 1M6VA 5C44J 4KDPA 3I54A 1U9NA 1X3ZB 2JK3A 3CDHA 3K3PA 3NZMA 2ID6A 3IWFA 1A6IA 3JRGA 1ULZA 1N34H 3RCOA 5LGTA 1YITI 4UNOA 2F5VA 5GTIC 1BR2A 2ZJRF 4I0BA 1TT5B 2VT2A 4XLCA 3A01B 2EV5A 1AOYA 3N8DA 2OZUA 1IF1A 2BEOA 3EETA 3T5JA 2V9VA 1HDPA 1XGOA 2HZDA 2FF4A 5D8KB 1Z2NX 5JVDF 3H4BA 4GDFA 1MMNA 1GO3E 3LOCA 1MBHA 1Y0NA 4DZPA 2FBIA 1FYMA 1QPIA 4TQRA 3TO9A 1S9FA 2BE5F 1WSUA 3Q0UA 1X19A 2RNGA 2QKLB 1R1TA 1V55H 1AUXA 1WQ2A 2E2JJ 2JSPA 5KG7A 4DUZH 1Z77A 4M71A 2G9WA 4BEHA 2PN1A 4JI5H 4UVCA 4HQ6A 2QCOA 2IEKA 3K4LA 2IS2A 4UT0A 4L5EA 5BPIA 4F52A 1VS0A 3PR4A 2HPIA 3E0JB 5KFXA 2F5DA 5JR3A 2C2RA 3QWLA 4LF6H 3TO7A 2VUMG 5KFPA 1ZG5A 1KC7A 3J80K 5M5XJ 3DKWA 4UB8C 3ZOBA 4L9VA 3MKWB 2VOPA 4LFAH 2E7WA 5LXTF 2UU9H 3I55I 5HDGA 3LWBA 4NC7A 2M3AA 4IZZA 4O1RA 3OV8A 4I09A 1DP7P 2CO5A 4EGZA 4ECRA 4EVIA 4F91B 3SJMA 3JRAA 5EG0A 3U9GA 4P5OA 4IRCA 3WTVC 3WO1A 3ZQ7A 2R4GA 1CE8A 4LK1F 2WC2A 1D1CA 3E6CC 2NS0A 4V2GA 5AKNA 1DV1A 4O4IF 2W8KA 4LLLA 1I3QA 3CCJI 4JV0A 3LWFA 1H9TA 1AM2A 5KFSA 4A2BA 3KZZA 3GIJA 2XGPA 1SANA 4DV0H 3GTLA 4UV9A 5C1OA 3N6XA 2R92G 2FXAA 2VBLA 3ZN0A 1OCCH 3OSFA 3DFGA 3H3VH 1KZHA 5J1YA 1LKXA 2BY3A 3PQJA 2FPPB 3VWBA 3Q8PB 3HOYJ 1F9NA 1SFEA 5ILSA 3N4MA 2K7LA 2CUFA 2DBBA 3M1CA 2H1LA 3M4IA 2HOAA 3ZRGA 5CQGA 1Y1WG 2QKMB 1FYKA 2XCAA 1A5JA 2ZSHB 4IRGA 5L3BA 2RDJA 1K6YA 4U0VA 3MKZA 1J2XA 4LSXA 4YQWA 3GFLA 3QYEA 4S0HB 4J9PA 2AB5A 4P9UA 1IV6A 5HLHA 3JTGA 1FEXA 2QEXI 4E7LA 3ABLH 4L0YB 4O3NA 3KZYA 3MWMA 3B6AA 1QPMA 1CF7B 2JQ7A 1TWHA 2HJWA 2E2IA 4M6VA 2LDUA 2XRNA 4HSRA 4UHTA 2DMPA 4OIRF 1AHDP 1X58A 3NQOA 3DTIA 4D7MA 4MTDA 2XC9A 3F21A 1I27A 1Z3YA 2MW8A 3DWLE 1L2ZA 2ESHA 4HNVA 2R7VA 3ML6A 3L2QA 1W1WE 2JA7G 4GGGA 2QQ9A 5EZHA 5FLMG 1U78A 2LKXA 2PG4A 3TBIA 3I56I 2DYSH 3A03A 3M3YJ 1J59A 3T0YA 1YS7A 4YFXF 4BXUA 5K5QA 4UCVA 3MN2A 3VSKA 2L7KA 2NVXJ 1HXDA 4IZOA 2Y48A 3PO2G 1IG7A 1HKSA 2M8EA 1ZH5A 2JA6J 4UNCA 5EG0B 3B73A 3R0JA 2VL8A 4NUBA 2KRHA 4KN7X 3J80W 3GTJA 1GSAA 3V6HA 2WAFA 1RRJA 1A0IA 1MJBA 3K5IA 2V4RA 2FNAA 2QOJZ 4D0PA 1S0OA 3MZHA 1I1SA 3NWSA 3L09A 3N05A 3K70C 1KBLA 3T5LA 1Z7LA 2W9CA 1P8KZ 3BQ2A 4M72A 1VZ0A 2KP6A 3RGZA 3N40P 3OL3A 4LFBH 1TWHJ 2HS5A 2ZXIA 5EEHA 2VS7A 1BW5A 4LH7A 5ED4A 4XBFA 4MA0A 4CC6A 2M30A 5DG8A 2R7MA 2W7NA 3VEPA 4J9RA 2ZB9A 3BR2A 5B5EC 1VQ7I 1MBGA 2J5OA 1GYFA 3A02A 3FXMA 2BY2A 1QGPA 4UFZA 1B6AA 2MH9A 1PK8A 2GQQA 3BPVA 4QWAA 1VKZA 1JE8A 1T3NA 4FE4A 2GZWA 2PMZN 3EH8A 4I50F 2W6MA 2CQKA 4DV3H 4I0AA 5KG0A 5H2FC 2CWEA 4C5CA 2VASA 2DOEA 5CVVA 5J8CA 4BJ6C 4UUSA 1WHUA 2LYCA 4K2EA 1IN6A 2E1NA 4MLOA 5KHDA 3GTJJ 2VPLA 3RFCA 2ZDGA 5KFCA 2CW8A 3H9QA 2IP2A 4L9TA 2H09A 4WXCA 3W3CA 4DW6A 2B9SA 2W6NA 2DFEA 3ZQCA 2V4JC 4A3KJ 3OSGA 3W6VA 4QWQA 1QA6A 2NS7A 4EG0A 1XTAA 2R7XA 3RPUD 1T94A 3MJFA 2RQQA 3PW7A 3WHBA 2QLZA 4YIRX 2F6CA 1ZG3A 1VTNC 3ULQB 4Y3OA 1W96A 4Q0YA 3F23A 1ODDA 1TWGA 4ZYGA 2CRGA 1UZCA 1ZELA 4EM0B 4PCQA 3JSPA 2TRTA 1QZEA 2EBIA 4YEJA 3G6XA 3CCEI 1NHAA 2IA2A 4LX3A 1HF0A 4DR3H 1K1QA 1U5TA 1D5VA 4JV1A 2W82A 3JSOA 3JRWA 2R87A 3WTSC 1W5CC 4IWXA 4X0GA 2VPQA 4O3SA 2F5CA 2VC0A 5LBQA 2W9CB 5H20A 4HLYA 1BM9A 2DQRA 3E6MA 3HM5A 3SZGA 1V5GA 3HHHA 4CGZA 1OJLA 5F1RA 3F6VA 4U7CA 4BY7G 5FLVA 2E19A 2R7OA 3K5HA 1Y1VG 2VR1A 3ERMA 1RR7A 3MZYA 5LFAA 3FKIA 1S10A 3GLXA 1XDNA 5D8LB 3FMAA 1ETYA 3KXYT 3HOVG 3MWDA 1U9OA 2IPQX 2M34A 4IXAA 2VJ5A 2DCHX 5F64A 4Q8FA 5DV5A 1YX5A 2H1KA 4A2AA 4A0XA 4HR7A 5LOVF 1BBYA 3KEYA 2JN6A 1BOAA 5DYMA 2STTA 3EPIA 4OMZA 2RDPA 4V2FA 1DQ3A 5HS8A 1IZ1A 4LB6B 1ZRFA 1AT0A 1VI0A 3CVZA 3E54A 3RSNA 4LK0F 4BJTA 4F4WA 4A3DG 1IXSB 2JEJA 4P9FA 5DM7F 4U7BA 4UUSB 3CZ6A 4I02A 1T9IA 4DR4H 2XB0X 3DPUA 2FK2A 3KP6A 3U2RA 3CMYA 2G7UA 5J40A 1H0MA 1XNRH 4JI7H 5LRRA 4PJNA 1IDYA 1MKMA 3W2AA 4ECVA 3BZCA 4QIWE 3E5UA 1Z1DA 5E79C 3S14J 4ZI7F 3M7GA 2P5KA 1TLHB 3FKJA 2L2OA 5J2UF 3GQCA 2Z99A 1IUFA 3LMMA 3K9TA 3OOLA 2HKXA 3I4PA 5IPAA 2DFFA 3L2VA 5E5OA 2QBYB 4FM9A 3ZQHA 1FTTA 2PI0A 5AONA 4AQYH 1OMIA 3WE2A 4MV7A 3OOPA 5TRDA 4Y13A 1G9YA 1CQJB 1WCMA 1X4OA 3BLYA 2XVCA 1TQIA 2KHMA 3TMOA 4DR5H 3FF5A 2JUCA 5DLFA 3L2RA 3QFFA 4A6EA 5A77A 4HAMA 2DO7A 3IV5A 3ZQIA 3D5RC 3PVXA 1QNTA 5IYCJ 2BXZA 2G0EA 1IAWA 5KT5A 5LGNA 1DP3A 4WBNF 2FMLA 1VQ6I 1D8KA 5KFWA 3DPLC 3OYMA 4TUYF 2J6UA 2P6SA 2R7QA 2XD4A 2GPWA 1O3RA 2NU7B 4ZOLF 2GPSA 2IJLA 4KA4A 5E8GA 3MEXA 2PBZA 2RGVA 4NC6A 2IS1A 3BROA 5M3FJ 1F43A 3WODF 1EUDB 2EFWA 2M05A 3KETA 4NBQA 3C0FB 4N9IA 3TQ1A 1KYWA 3CF2A 1W36D 3F72A 2LREA 2XAHA 4G6DA 1JXLA 1F36A 1L0OC 4LF4H 2L54A 2ZM6H 5KAFC 4ZDOA 5DCMA 5F04A 5HDNA 3DF8A 4LOCA 1TA8A 2VQFH 1IW7F 2HOEA 5DGBA 2V9WA 5FB2A 3OYFA 2DYRH 1D1AA 2X6WA 4HW0A 3C2HA 1WCMJ 3H3VK 1VF9A 3A0HC 1VDEA 1SD7A 4XLPF 1B24A 2ETHA 2F4MB 2K9QA 3QP6A 2LF7A 4IO9F 1YE9A 3D1NI 3T1BA 3UKGA 4LG0A 4BJ5C 2HDDA 2CH0A 4UXNA 3G6EI 2HDWA 2X6YA 1JIHA 3IN5A 4JI2H 2DK8A 3SQNA 3TP0A 1Z05A 3G4SI 2P7CB 2CU7A 3GWZA 5L1JA 2OCEA 4CO8A 4UCTA 1N77A 4RB3C 4G7ZF 3PUFA 2D45A 4O4LF 2XPUA 2DMQA 4XLFA 2DAOA 2R7ZG 4GKKH 1UHSA 1H89C 2YU3A 5E3OA 2CQQA 4A3MJ 4DV5H 1VQNI 2KZVA 1VBGA 4AIHA 4PGHA 4JUZA 3CCLI 2PVPA 3G1MA 2BR0A 1I39A 1K4SA 3ISPA 5FFZA 5L3EA 5EF6A 3F8FA 4PFPA 1RIOH 2IXSA 2HQ5A 2HDCA 1G2HA 1ZTRA 1ON1A 3QP5A 2JRMA 3WTZA 2XV4S 3I59A 4QLCU 4KL5A 2FKLA 1BIAA 3GIQA 4TV9F 3CCQI 2EILH 2X6OA 4U0WA 2WTFA 3RB3A 3E5QA 4KYWA 3R5XA 2ASLA 1SVLA 2XCLA 2A5WA 2ZJPF 2BV6A 1EV7A 2GIZA 2BZTA 3PR5B 4G8XA 3R60A 2IMWP 3GTOA 3VDXA 1ZN2A 3PJRA 3S16J 1SCUB 4UCSA 2HYJA 5F0CA 1MBEA 1ETKA 1RZ4A 2QENA 1MSEC 3QODA 3VODA 4NLGA 4ZYDA 2XCPA 3L7WA 2A5YB 4BACA 4ENMA 4QIWA 4IHVA 1FZPB 2L9VA 4UCRA 1N75A 3RUPA 4JBAA 1MSFC 4LMYA 2M4GA 4BHBA 2ZMEA 4RDUA 3BG7A 3S2WA 4EM2A 1OFCX 4AWXB 1U6GA 3BQ1A 4II2A 1HNXH 3OORA 4F55A 3REOA 9ANTA 5IYDJ 4E6KG 2UVUA 2BVLA 3PW4A 1DDNA 5FD5A 2BW3A 1MMGA 4LG0B 2YL2A 2OF7A 2K9LA 2LCJA 3H0GJ 3HGYA 4ED0A 4FS1A 4Y52J 1R00A 3HHGA 1WJ5A 5E3LA 2LH9A 3GFMA 4ETSA 4GC6A 4MV6A 3AG1H 3JAMW 2BQRA 2LMDA 2L5QA 4B48A 2LF8A 3H5RA 2J6SA 1T2KA 4RBOA 2QM3A 3ZQLA 4J9MA 4QPOA 3O3KA 5DQHA 1QHGA 2WAEA 3J80Z 1S03G 1C0WA 2O9LA 4R8HA 4K0KH 4CCOA 4FS2A 5JHFA 3RTRA 1UFMA 1ETQA 2K86A 1VNDA 2PX9A 5IP7J 5CB4F 4BXXG 5LHGA 1XMXA 1YOVB 2V9PA 2AGQA 4IR9A 2GBYA 5FLXW 2AO9A 3LQQA 4IOAF 2P8TA 2JRTA 2A61A 4UB6C 3OYAA 4M7EA 1W93A 3OYJA 4RNOA 5BQTA 3H4DA 4OU0A 3PZPA 3CC2I 3G8CA 2XE0A 3K1PA 4MHGA 4XL9A 5KCMA 2DTRA 4AIDA 2VKEA 4Z1XA 3CQZA 5FO5A 4BAYA 1J5YA 1IN4A 1SYXB 4RAYA 1YS6A 4N4NB 4D6OA 1E3HA 2HVRA 5C4XG 2B63A 1USSA 4ZHQF 3ETHA 3RB0A 3C2GA 2W25A 5K5RA 3L2CA 3ZR8X 1NG6A 2XUBA 2ALZA 1OWTA 2YS6A 2XROA 4CZCA 4YR2A 3HGGA 2E35A 3UNGC 4MQ9F 1U0DA 3RIRA 3GVAA 2WDTA 3MFKA 5FKKA 1YHQI 4XRSA 2UXNA 1H88C 3OYDA 5FFXA 3K4MA 4XIDA 1WSCA 4PFOA 4UUTA 4RB1A 2L7ZA 1DGRM 1YRNB 1IXRC 3LNQA 2QGUA 2JVGA 1K7AA 5E67A 2X0SA 1RYRA 4CYDA 1X1DA 4Y8VB 1ZKGA 2XGCA 1UHMA 1AWCA 4A3BJ 2YYAA 2XAFA 3UVFA 2HXOA 3CMAI 2WBMA 2HQNA 2VIXA 5JHUA 4EYIB 4OMYA 2XF6A 2BQ3A 1TNSA 4CUGA 4EJTA 1UM2A 1X2NA 3CQZJ 5L1KA 3EUHA 4IPAA 1BJZA 1T98A 2DPDA 4A3CG 5HODA 5A2QK 4RAFA 4DL2A 4RGRA 2I10A 4HPQA 2WWYA 3FBIB 2DPUA 3LMLA 4NB5A 1S68A 2O7OA 1TQPA 4F4ZA 4A93G 4XICA 4FETA 1P92A 1SFXA 2EFNA 1AF5A 4NDLA 1EYZA 3VPCA 2RF4A 3KHLA 2EINH 2A3SA 3PL8A 4BE1A 1XGSA 3GTGJ 1Z67A 2Y31A 1KU3A 4EJWA 3LA3A 3JRHA 2KRFA 4LFCH 4RLFA 2DJNA 4AU7A 3U21A 2IS6A 2XE0B 2MCTA 2E71A 1LFUP 3EQLF 2E2HA 4S04A 4UUVA 4EQQA 3HZJA 2VBYA 4HV6A 3VYSB 4WX9A 2FBKA 2DFHA 3BOQA 2HVSA 4JI6H 2BHYA 2FLNA 2VBZA 3WU1B 3SDGA 4DNCA 3LSHA 3GIDA 3H20A 5HBRB 4OX9H 1YI2I 2XRLA 3N97A 4B09A 3R7PA 1MZBA 1GXPA 1S7EA 3HTUA 3AG2H 3PQKA 1R71A 2R84A 3FD2A 2UUAH 1AA7A 4WXDA 3I4MJ 2V79A 4YIIA 2C28A 1R58A 1K4TA 1IN5A 5IY5H 1RK5A 2NVYJ 1EUCB 4FBUA 1IRZA 4QIWN 3B6CA 4ZTFA 2LWYA 2DZDA 4AABA 2JVHA 5C3EJ 4CHUA 1XDUA 1LQ1A 1ETXA 1N3FA 5CKTA 1T0FA 1B4AA 1MOWA 3VYTB 5KFGA 4IHWA 3MWEA 4P1WA 3K70D 4DR6H 4JV2A 5K5OA 2QSHX 1HLVA 4DL5A 1DGWY 2E7XA 5DCFA 1BIBA 1UCRA 2FRHA 4BHPA 1S9HA 3M8FA 3L2WA 4FTHA 2O5RA 2KDZA 4NC8A 5GTHC 2H8RA 5BR8H 5KT3A 2IA6A 3RZDJ 3NWTA 3L4KA 2XKOA 1TC3C 1FTZA 3ZMDA 2R93A 1SD5A 1K6OA 4IEJA 5C44G 4AM3A 2FPGB 1AUVA 1XCBA 3QQYA 1OKRA 2UVWA 4RU9A 3WGIA 4F93B 5HDKA 2VB6A 4WF2A 4B1RA 1Y8RB 2XDVA 5ILUA 4J00A 3OHBA 3J7AY 1U0CA 1XNQH 2VI6A 4YAJB 1IGNA 5HV6A 2CW7A 4J9OA 3I9V2 1MNMC 2GM4A 3C1DA 4A3LJ 2W70A 4RM3A 2L3DA 2R5YA 1V54H 2X1EA 5A2QW 1R9TJ 2I3QA 2H6BA 4U7DA 2ZNYA 1FMVA 2BY1A 1EKEA 2UUZA 2LK2A 2UUCH 3WGGA 3HOUG 4OAYA 2ZNZA 3DTEA 2DDAA 2ICWG 5IYZF 3M8JA 4BKXA 1N32H 3BJAA 2KSWA 1LDDA 2A69F 1OCPA 3HRUA 4HQMA 3C0WA 3FDSA 1A9XA 3PIOF 2MABA 5EZGA 2LC2A 3ABUA 3CJQB 1MH3A 3SDBA 2A6TA 4ENJA 5I47A 3QPTA 2XSDC 1JKRC 1ZETA 2PEXA 3OR1C 1BP7A 3MFHA 1WPKA 2YU9A 4ABZA 4E7JA 1MW7A 1FX7A 3HSFA 2R93J 1S0MA 2V26A 4MV3A 3J81K 1O7FA 5KFIA 3H0DA 2AQEA 5E1ZB 5J47A 1TWCJ 4XX0B 3AKZA 4Z20A 4A3EJ 3N43B 2FP4B 1O3QA 2JTVA 1FMWA 1UNNC 1UG0A 3MAJA 1W4MA 1POGA 3R0AA 5E8IA 3RZOJ 5KG5A 2PMZA 2M5WA 3TDUC 4GYIA 3C0XA 2E1MC 1MMAA 4XKBA 1V5FA 1LWSA 3E5XA 2OU2A 4YBZB 1LDKB 5EGOA 1IXCA 5JLXA 5LLQA 3OSPA 5J1UA 1ZARA 4XYLB 1O7LA 1FP1D 4WWCA 3V6KA 2N8GA 2OCCH 3D5LA 5JH7F 4AIJA 5LHHA 4MAMA 2CQXA 1TTYA 2H94A 2QQBA 3K10A 2FX0A 4ZZLA 2R5YB 3IAM2 2QF7A 1NH3A 2V58A 4F4XA 4O5VA 1ZR4A 4MV4A 1R6RA 2YZNA 4BQOA 1FT9A 4IJAA 1E17A 4OWRB 4UN9G 3EPGA 3BR1A 2M87A 3A0BC 1X4PA 2DDBA 5AKMA 1BOBA 1AN7A 2COMA 3EUKL 4YJ2F 4A3GJ 5KFOA 4EGYA 1QQIA 4Y17A 3GV8B 3GLLA 1XPXA 2IN0A 2X1DA 2VBJB 1XB4A 5FPOA 4AUXA 2F48A 3VOEA 2P0AA 3HOWJ 1FYLA 4KIGA 3E6BA 2Q2EA 3RQ4A 2NU9B 2GAUA 1LNWA 4EJOA 5LGUA 1XGNA 4I01A 3RDIA 3RV4A 2HEOA 3BJOA 2JWTA 5E17F 3BABA 2C2EA 1SVMA 2IBKA 3WE3A 2ASDA 5DG7A 2CQNA 2E60A 1G3YA 2CJJA 4DYCA 1VQMI 4HNTA 4X6AJ 2ZXHA 3CCUI 2RC4A 1JJ6C 2YRXA 3WTXC 3KHGA 2OWOA 3JAMZ 2L01A 3TEDA 1SAXA 2DXIA 1N3EA 4XNFA 2J9GA 4YHHH 1AKHA 3PO3G 2R0QC 2ZFWA 1J0RA 2YX4A 2VBOA 5E3MA 4TV7A 3ZP5A 2OTJI 5HS7A 4GO1A 5KG3A 4L9JA 4JI4H 5L3CA 2F4IA 1EA3A 3OYKA 2WV1A 4M73A 1ZAOA 1T6SA 3BP8A 2CZGA 3DEWA 4OINF 3WTUC 2VOBA 2DK5A 5L3GA 4YAKB 3GTPA 1RUNA 5IYBJ 5EGOB 2HOTA 2UVRA 4PJ0C 4EBDA 4CICA 4KFCA 2UXCH 4EV0A 4RA2A 3BG9A 2RN7A 4Y15A 5F0FA 5FLXZ 3GEZA 1B59A 4OIOF 1UB9A 2EV0A 5KAIC 4DGWB 2VUMA 3U9SA 4BDZA 4JX5A 1VQLI 3KYDB 2HU9A 2IRFG 3IKTA 1TAEA 2W9AA 4LF9H 1FOYA 1FOWA 3HBLA 3G73A 1K78A 5KT2A 3QRFF 3HB9A 4R1HA 1DUXC 3S8PA 1O57A 2VKDA 4BEHB 1P7IA 2VT3A 2AQ4A 2FUG2 5CAEB 2QYZA 3DV8A 3COAC 5LA6F 5DD4A 5GP9A 2KZGA 3ZMTA 3WTTC 2XF5A 3R61A 1ZLJA 3IAS2 1DU0A 1Z21A 2NVUB 3S2HJ 1ETOA 1I1GA 2LOOA 2RDIA 1MDMA 1DQUA 1I3QJ 3BWGA 4XOPA 4XLHA 3FXJA 2W6PA 3GTKA 1IN8A 2Q2EB 4HX7A 3ZQGA 1JKPC 2C35B 3H9JA 4JP0A 1GUUA 4KIBA 4CSWA 3GILA 4HF0A 3QOEA 5KG6A 2VXZA 3GTLJ 4J9QA 4MTEA 2JUGA 3FK7A 3Q0VA 1UAAA 1NK3P 1V9PA 1VBHA 1TWAA 2R92A 3GTPJ 4A12A 3S1QJ 2FMAA 2Y69H 4DV6H 5TJJA 3IFJA 2D1VA 2HFHA 4JI0H 1RESA 2FOKA 2UXDH 1WJAA 1NG7A 1SMTA 3IWZA 4A3IG 2C22A 1B1BA 4G6TB 2JA5G 2XB5A 4BBRJ 1R36A 1AKHB 1Y1WA 5D1OA 3FDYA 2VUMJ 1FP2A 2VS8A 1N48A 3RB6A 4XKVA 2K85A 4N9HA 3WHCA 1KJ9A 2W48A 1TW2A 4B44A 2VQGA 1M5XA 2PBIA 2XC7A 2VBLB 4BBSG 2IAIA 2RKHA 2E2IJ 1JUMA 1CQIB 1N78A 3KALA 3BZKA 1KJIA 3WTWC 2NUAB 3VB2A 1GDTA 2LKPA 3GIKA 4LQ0A 1GPPA 2VPSA 2PLYA 2JA7A 5FGMA 3EUAA 4QW8A 1ZLKA 4ECTA 2UUBH 3TINA 1KJQA 2GXAA 2Z5UA 4I98B 2SCUB 3FXUA 3MD2A 4ZQIA 1K78B 1WRJA 2PJRA 3G71I 2L4AA 3GYHX 4KISA 3PW2A 2RREA 4HV5A 2EZIA 2V9KA 4PZJA 1ETWA 4G9YA 1HBXG 1OQYA 2VUGA 1Y1WJ 4C2TA 1IRGA 2ZXWH 1WVRA 1UJ8A 1C30A 1HR0H 1R5GA 3IH4A 1MDMB 4DV2H 1T08B 3Q0WA 2A05A 4YRVA 3FBNB 4LH6A 1A31A 4A3JG 3SI8A 3KP4A 3LSIA 2NNNA 2STWA 4YR3A 3ABMH 4BQNA 1R22A 4OIPF 1DGSA 4NQWA 2ECCA 4TV8F 1I50A 3ZMUA 4JV5H 2GOXB 4ECWA 2CV0A 4H4KC 2X0LA 4ECXA 1R5ID 3U1KA 3CO7C 1WGXA 3S93A 3RBDA 3K4BA 1P9QC 5KFRA 1OCRH 5FLMJ 1J75A 3I12A 2MFZA 1F1ZA 3ASOH 4ENKA 4O2AF 3M9AA 5D5WB 2NVQJ 3MR5A 2WADA 4B4CA 2X6XA 5GAHJ 1TBXA 3FX3A 4M3DA 4ZTJA 1JI8A 1KONA 5M3MJ 3MQ0A 1H9GA 2WB1E 5JQWA 4A0ZA 4L1KA 2H8WA 4QJFA 2HGSA 2M9HA 4HDVA 5ERIA 4WXHA 3PO2J 5IT3A 4X62H 6PAXA 4G7OF 2O8KA 4ITVA 4NNJA 1CS0A 4P55A 1T95A 2KFDA 4E4TA 3RYPA 3BR5A 1FOKA 5H6QA 2JMZA 2JNQA 1S6LA 3BJ6A 5AIQA 3O8GA 4KT5C 3ZMSA 1NK2P 5FROA 4E7HA 3V8KA 2AGOA 2Y0MA 3N42B 3K2ZA 3K4JA 4KUMA 5LEJA 3CP8A 2F5FA 3TKYA 3V42A 2I87A 2HTSA 2DT7B 5CVUA 2PJRB 5A2QZ 2KL4A 3HG9A 5GPCA 1O3SA 1F5TA 1ZREA 1TWGJ 1FSEA 4EMSA 1RJPA 5F9NA 1YG2A 4LF7H 4GXOA 1XGMA 1JDEA 4LF8H 2RGRA 1I7LA 4KICA 4M74A 1BI3A 3OIQA 5AK9A 3FXLA 2XSJC 3PUBA 3IL2A 4RUAA 4ECYA 3B02A 2M2EA 2LQMA 1N33H 1CGPA 1RI7A 3LQRA 3TW7A 3CO6C 5D4SA 1M0WA 2R7DA 3KLOA 3OS0A 5D4RA 5DUIA 3K0LA 2JA8J 2CSOA 1RNLA 3HEFA 2W57A 2JA2A 2V4QA 4O3RA 1C3OA 3VPBA 2VE9A 3H5AA 1WJBA 4BS9A 5CYVA 5DTDA 1PYVA 2GWRA 4ESFA 1ZQ3P 1TNTA 2E1CA 3OYIA 2CV2A 5K7FA 3ETJA 1Y1VA 3FKIJ 3CMMA 1YO5C 3EDPA 1U5TB 3K1NA 4E70A 2YS7A 1HA8A 1W5TA 3PSFA 4PK4A 3KP5A 4IVNA 2P6TA 3L4JA 1JUSA 4R7RA 5IT9K 4M9SA 3HUGA 4D9JA 1IV8A 2EZHA 2RQPA 4IL6C 3OHAA 2M1BA 1GXQA 2Z16A 1YW8A 4ZDPA 4II3A 4IR1A 3OIPA 2EV6A 3SXYA 3D0SA 4DYRA 1ZGWA 2LP0A 4A3FJ 3S3OA 4J9SA 2Q2UA 4KZSA 4JOMA 3I5UA 1R4MB 1MJAA 1JKQC 2EZKA 3HRMA 1JT6A 4ESJA 3S1RJ 4JYKA 4FQGA 1LE8A 3JCUC 3GXOA 2IGMA 4MV9A 4YR0A 3M9NB 3KP7A 4XKCA 2JPBA 1O3TA 1X3UA 1T8IA 1LFBA 1LPQA 4FT8A 3HRTA 3VMMA 3H3UA 1Y1VJ 2QWWA 3GO5A 4XRMA 5L1IA 2VBWA 4YY3H 1R23A 4LLNA 5ICFA 4PDKA 3SEQA 3GCMA 2FMYA 2FOWA 5CVIA 1RETA 2DW4A 3V4SA 3GV7B 4I2OA 2VBXA 1PUFA 4M6YA 1PP7U 1PVEA 2WB1A 4BY1G 3H0GG 5L9XA 3RGXA 2DCEA 4EEYA 2IMZA 3O8HA 4MEXF 4A3DJ 5D5UB 4C2UA 5IP6A 1HOMA 5DGAA 1HSTA 1U2WA 2KIFA 4ZYHA 4AYBE 1V4RA 1AU7A 2EA2A 1IUYA 3TW6A 4R8UA 3SFIA 3H3ZA 3IRQA 2VKVA 3GW2A 5IOZA 4RS8A 2CQ7A 1B6RA 3GV5B 1R1UA 2L4MA 5GPAA 2R7LA 2XPWA 5KFLA 3PSIA 3J81Z 3LSJA 3O6BB 3JTHA 3LA2A 4L9NA 5CQEA 4A6DA 1PX2A 2W71A 2DMTA 4MFDA 3WTYC 3QZ7A 1RJRA 3MX9A 3M9MB 2OTLI 1KA8A 3L00A 2R7WA 1U8RA 3KCCA 2VN2A 1I7NA 1T39A 4ME6A 5DUKA 4O3MA 1UC9A 4FASD 5HVQC 1JKJB 1ZK8A 3T8TA 3TL4X 1WJDA 1ONVA 2ZBKA 3GZ5A 4ECQA 4EFEA 2OQGA 2PMHA 4U87A 2HQRA 4X1EA 5M5WJ 5BMZA 4JX4A 5D5VB 1S72I 1JX4A 1IN7A 5F27A 3ECHA 3SZPA 4BGDA 2O7MA 5DCMB 5C1PA 4IRDA 2I5UA 3SE7A 4D6NA 1IRXA 3K6GA 4I99C 2Z2SB 2R7ZA 2LSOA 3KAKA 4XYMB 2BXYA 3OY9A 3GFJA 1FVIA 3ORRA 3M8EA 1B33N 3PM1A 2DFIA 2EIKH 3H9GA 1Y6IA 4RGXA 4ESBA 2Q2TA 5IP9G 4ZZDA 5B66C 3TGNA 3JRDA 2F5EA 2R85A 3TOBA 1GV5A 3BTCA 2KIUA 3RAXA 1XMKA 1KJJA 1OPCA 1ETVA 4EJUA 1SFKA 2QZ8A 1I94H 5T14A 3HOZG 3S15J 4GIGA 1PUFB 1X1CA 1DU6A 2CQYA 1JTYA 4YB8B 2FQ4A 1HCRA 1GV2A 5JLWA 1O4XA 5EDNA 2LY2A 4LJZF 3GTOJ 2KRCA 1GT0C 1X1AA 2ZSIB 3SEZA 5EYRA 4B3RH 2ELJA 2YX7A 3CJTB 2X85A 4Q4ZF 4B3MH 2K9NA 2B7EA 4J19A 3BTJA 4JX6A 3MR6A 4EBEA 2MLKA 4Q43A 4KN4X 5J1RA 1RR8C 3I59B 3NARA 2GLTA 2GXBA 4IQ4A 4MQVA 2EB7A 3VYUB 4BU2A 5E18F 2O0YA 2R7ZJ 2X4HA 2ZDHA 3MR3A 3KYLA 3G2BA 1K1SA 4A2UA 4QPQA 5EDWA 4CH7A 3JREA 4XOTA 3I4NG 4YHXA 5KFJA 3DKXA 5KFHA 2JZYA 2VBNA 1DV2A 3S3NA 2LVSA 3IG0A 4HQEA 4IHJF 1LJ9A 4YP3A 4IQJA 4DYQA 1EH6A 1ZGJA 4PSXA 4RMNA 1FOXA 4UN7G 2ZMEB 1HC8A 1YIOA 4LSAA 4BDYA 3BT9A 5CA1F 2E1MB 2CKZB 3LL7A 1JJ8C 4DBRA 1KEEA 2DA2A 1U5TC 4WD3A 1Y14B 3HOSA 3V4ZA 2ME0A 4QFQA 1UELB 2Y2ZA 2BW3B 2GOMA 1K83A 4XQFA 1BC8C 3FXKA 1XDSA 5GAGJ 4UCUA 2KISA 5EEGA 3KP2A 1JUPA 1KJ8A 4TQSA 1W7PA 1ZHFA 3BTIA 4PJMA 3AAFA 1UG2A 4MIMA 5HLGA 1ITYA 4QWCA 3OS1A 1W0UA 5D5XB 3MZ8A 2W84A 5KX5F 1PUEE 2E36A 2CUJA 3H1CA 2CFXA 2HI3A 5FKMA 5A0MA 3OYGA 4B3XA 2LFBA 2VLAA 3CJRB 2VXDA 1E4EA 3PW0A 4DQ2A 1B8IA 2I80A 2OD5A 1MNDA 4KHPH 2DTZA 4UVBA 2TCTA 2IW5A 3QOPA 2R8HA 2BHZA 1ORKA 1NTCA 3MMYB 4RAGA 2CG4A 4ASNA 4D7NA 2UV1A 4EEQA 2NXNB 2LG4A 4ED2A 3EYIA 1GVDA 1FPQA 2CS3A 3KEOA 3PNYA 5B1AH 5HOOA 4YITA 2WB1N 5LP6F 3HJEA 2B63J 4RUCA 3S17J 4M3FA 2R3SA 1VQ8I 2FQ3A 2R7TA 3KAJA 3NGDA 1LVAA 4I76A 4N4OB 2VBNB 2AXLA 3KP3A 1W0TA 1GSOA 2Z3YA 1GVJA 2W6ZA 1TWFA 1OYWA 2VJJA 2YUSA 1BNCA 1L3LA 4C2MA 4BYYA 3MKLA 5K7ZA 5LMUH 4J9KA 1YW9A 5JVLA 1D3YA 2WA0A 4D5FA 1J9IA 1JHFA 2E1OA 4UN8G 4B3AA 3KPHA 4BXXJ 5HLTA 3QAHA 2VJ4A 3BC8A 5HS9A 3WU0A 4D5CA 3MFIA 4XMYA 3J7AO 1B9MA 4JQFA 2DA5A 3L2PA 3BJYA 2V1XA 3JRBA 1YLFA 3GF2A 1GSHA 4JK1X 3FIWA 3KX2A 5KFBA 4IX7A 2NVTJ 4F7ZA 2W8LA 4XLAA 3DPTA 3QQAA 4ZJZA 2KIQA 2W85A 2QQ8A 4XSZF 3SYTA 1JGGA 4GRIA 5FJ8J 2C00A 4APMA 3WG9A 2E34A 1R7JA 4PJJA 4RNMA 3F8CA 2Q1ZB 4A69C 3W6JB 1RUOA 3AL0B 5A0MB 4Z2YA 1HDDC 2YS9A 2VQEH 1WJFA 4AAFA 3AYHB 2DA3A 4L5JA 4UNAA 4E7IA 3QYBA 3QU6A 2DIKA 3C18A 1SC7A 3HKZE 1FKAH 3KYCB 3ECOA 5BPFA 2FB9A 1FBUA 2FA5A 3HSRA 3DU5A 5KT6A 1SFUA 5CLSA 4IHTA 2E2HJ 4O1SA 1B04A 4V19K 2QUFA 2X51A 2OAZA 4KJZA 3ZQFA 3CUQA 5KK1A 4KMFA 3CJNA 1JXSA 3ABTA 2Y75A 2R8JA 4XK4A 2DLLA 1JT0A 1FWZA 1STZA 3CC7I 3K3VA 4F50A 3T1HH 2VODA 5KNLA 1M0TA 3BQZA 3BCAA 1IBKH 2MYSA 5KG1A 3T1YH 1XSDA 3IH3A 4LFUA 2YZGA 1VQKI 2LY1A 3CD6I 1G8XA 4HRIA 3BA9A 4ZDLA 5JI6A 3L1PA 4JYAH 1UC8A 3KEQA 4A3CJ 3TIGA 3EYYA 5DM6F 1GLVA 2XGQA 3ESWB 2V6EA 2VA3A 3AG3H 4A93J 1MD0A 1HKTA 4IRHA 1V5EA 1WJCA 2OA4A 4W1UA 3V8LA 2RV8A 3VSLA 3A01A 1LDJA 4CXFA 4XZ3B 3A4CA 4MEYF 3L9FA 2LLKA 3QPLA 5EJCA 4DL7A 4DOZA 1IJWC 2KLOA 3OYLA 2EH3A 4YJ3F 5LHIA 5DLGA 3OYNA 5FD6A 4YFKF 4RB2C 4DV4H 1OLTA 1SVOA 5L3FA 4B47A 5LL6b 5JFRA 3PNTA 4DV7H 1VQ5I 4ZH4F 2M4KA 2L7MP 3MXAA 2FLDA 4QWEA 2ZKZA 4AYBN 2W1OA 4B3TH 3UFXB 1B72A 2FNPA 3P9CA 1SD6A 1MBKA 2ZMEC 2ESNA 4Q5SF 3ABKH 1BA5A 1CQTA 2W7OA 1H8AC 3K4KA 1JTXA 4DJAA 2R6FA 4ED7A 4E7KA 5EWGA 3CUQB 1TL8A 2XAUA 4HBLA 2XAJA 3G1OA 5B3SH 3JRFA 2W9BA 3S1NJ 1E3PA 4M9XA 4MNUA 1LFPA 3T5HA 2PFBA 4LD5A 2ISYA 3W2WA 2O03A 1XX5A 4AC0A 3OUZA 2ADUA 3HOYG 5JVTA 1N25A 3OYEA 1OR7A 3K2AA 1OYIA 5TGTA 3LFUA 5IT9Z 3V7SA 2YU9J 4DV1H 2M0CA 4KNYA 3TOAA 5EWFA 1BI1A 1T38A 3PNVA 2J6TA 2A6EF 3E3VA 1TP4A 1YJWI 3IHUA 2MA3A 2OQRA 4CCJA 3GIPA 4UV8A 2W00A 4XKWA 5CJ9A 3KFWX 3HOXJ 5JVGF 1KU9A 2EK5A 2YSRA 5J8FA 3N41B 2XIGA 3TQTA 3RQIA 1G3SA 1S3JA 2XF7A 3ZGKA 4ZC3A 2IA1A 2K3FA 2RNJA 3HKZA 4G3IA 5H6RA 1IOWA 2P81A 4GFBA 1TQMA 4FX0A 2L02A 3LSTA 3TIIA 1SD4A 4X64H 2Q0OA 4BWSC 4MGRA 1XD7A 1R1VA 4FX4A 4DLKA 5FRNA 3HOUJ 4DL6A 3JRXA 1I6HJ 5AKFA 3KTMA 1CF7A 3TQNA 2ZJQF 2HQAA 1ZRCA 2ZXJA 3WO0A 2OV7A 2NS8A 3BY6A 3WNZA 4F4YA 4QWDA 3CESA 1I6UA 5C4JJ 2JA6G 3OYCA 1B72B 2GIVA 4AIKA 4BBRG 5ICEA 1GLNA 4PUSA 3UR3C 2RVCA 3Q9SA 3J81W 4DL4A 1ZQ7A 4HOBA 3ORQA 3GX4X 5CVJA 1ZG1A 1D0ZA 2LR8A 4YIFA 5EEAA 3GUDA 2KJBA 1VQ9I 1FC3A 2R7KA 2AHQA 2NAZA 1XN7A 4EATA 1MNEA 2W9BB 4UN9A 2R8GA 3DEEA 1Z2OX 4HLXA 3KZIC 1RKTA 3A2KA 5KFUA 5CA0F 5AIPA 2W4SA 3CUOA 1KU7A 4GKJH 1QO0D 1LEAA 2WYOA 4XORA 4JI3H 3NEUA 4KMUX 3JRIA 1ZR2A 5A74A 2QSFX 4HF2A 4E7SA 2AS5F 3BTLA 5C5JA 4AQXA 1E4GT 1IO2A 1XMAA 1WR2A 2V1NA 4Y33A 3RF2A 4C9YA 2W6QA 2UZKA 3R5FA 5FPRA 2FK1A 3AL0C 3GFIA 4MO7A 1TZLA 2BYVE 4O4HF 4AVPA 3S1MJ 3SHFA 3DTKA 2NVXA 1IBMH 3L2UA 2ZJ2A 4MA5A 2FEZA 3E6DA 2M7BA 4XN3A 1IDZA 3G6VA 2KDOA 3TO6A 4M3EA 5F9LA 4E7ZA 2ID3A 2JA6A 3HOTA 1YQAA 1LB2A 3SZTA
chains in the Genus database with same CATH topology
1QHGA 2WAEA 4AAEA 4R79A 3OYIA 2CV2A 3EUHC 4B3SH 2L8LA 3KO2A 4K0KH 3CMMA 4CCOA 4HEA2 1Z3XA 2ZFUA 1HA8A 4X66H 5JHFA 3RTRA 3PSFA 4PK4A 5A0WA 3L4JA 2IGKA 3OS2A 4R7RA 3HXLA 3DKYA 2IGNA 4D9JA 5FLXW 2Z16A 4Y4RA 4IAJA 4F92B 4ZDPA 4II3A 3OOUA 3OYAA 2VBOB 3JSLA 3OIPA 2Q2UA 4M7EA 2KEQA 3OL4A 3S3OA 2KMUA 3OYJA 3HYIA 4JOMA 4RAZA 2XE0A 1PJRA 4XL9A 3DF7A 3BG6A 2VJIA 5KCMA 4Z1ZA 4AAGA 4Z1XA 2VBJA 4B43A 4EFJA 1SYXB 3K4CA 4RAYA 4N4NB 4E2UA 4D6OA 1ZDEA 2HVRA 2IGMA 1O75A 4MV9A 1E4FT 4XKCA 4DR2H 4OZ6A 3C2GA 5HNFA 3HPGA 2CFOA 2K3PA 2LBFB 3ZR8X 3EPZA 4CA0A 1NG6A 4BE2A 4IKFA 4LF5H 2CV1A 1SEIA 4DUYH 3OWTA 2IS4A 4CZCA 1T0FC 2R7SA 3UNGC 1U0DA 4YY3H 2DJIA 3SEQA 1FJGH 4RLQA 2WDTA 1J5EH 1BGWA 4CCNA 3OYDA 5CPRB 3K4MA 4ANJA 2E5LH 4PFOA 2WB1A 4BXFA 4RB1A 1DGRM 5E67A 2AQFA 2JVGA 3NZMA 3RGXA 2DCEA 2IMZA 1X1DA 4C2UA 1N34H 3RCOA 4KL6A 3UVFA 2F5VA 1Z2PX 1BR2A 2WBMA 2VIXA 2XF6A 4XLCA 4CUGA 1UM2A 1Z2NX 2HZDA 4HPQA 3FBIB 4LG3A 3LMLA 1MMNA 1S68A 3PSIA 4LIVA 1QU3A 5CQEA 4FETA 2UWMA 1AF5A 5D1OB 3PL8A 2X1CA 4BE1A 1X19A 2RNGA 2QKLB 3MX9A 2R7WA 4DUZH 2JSPA 4LIUA 4BEHA 3H5NA 4JI5H 4LFCH 4RLFA 4AU7A 3U21A 2IS6A 2XE0B 2MCTA 3K4LA 2IS2A 4UT0A 4AVZA 4FASD 5HVQC 4F52A 1VS0A 3VYSB 3TL4X 2HVSA 1WJDA 4JI6H 2HPIA 3E0JB 4EFEA 2DT6A 3H35A 3LSHA 4U87A 3H20A 2E5NA 4LF6H 4OX9H 1FKAH 3E1SA 3R7PA 2O7MA 1MZBA 4BGDA 4D6NA 1IRXA 3MKWB 3K6GA 3FD2A 2Z2SB 2UUAH 4LFAH 1ZD7A 2UU9H 3KAKA 1AA7A 2M0MA 4YELA 4NC7A 2M3AA 4IZZA 3OY9A 4O1RA 1FVIA 1IBKH 2WE6A 2ZJTA 2K5CA 4F91B 3H9GA 4ZTFA 1Y6IA 2LWYA 2Q2TA 1WJEA 4AABA 2JVHA 4P5OA 1N3FA 2R4GA 5CKTA 1G9ZA 1MOWA 3VYTB 1D1CA 5AKNA 1I94H 1SFKA 4P1WA 3A1YA 3K70D 2F4VH 4DR6H 4GIGA 1X1CA 3DLAA 1AM2A 2NOJB 4A2BA 1DGWY 1DFAA 4DV0H 2LY2A 1S9HA 3L2WA 3N6XA 2VBLA 2O5RA 4NC8A 5BR8H 2KRCA 1X1AA 2ZSIB 3NWTA 3SEZA 1LKXA 3L4KA 4B3RH 2ELJA 3VWBA 4CCLA 2KQRA 2X85A 1G59A 4B3MH 3M1CA 3M4IA 2IGOA 3ZRGA 5CQGA 2QKMB 2VQLA 2R7RA 5E63A 3QYFA 4LOXA 2ZSHB 4NQWB 2YCHA 3OYHA 1K6YA 3MKZA 3QQYA 4LSXA 1XMQH 1OR7C 4IQ4A 3QYEA 4F93B 3IGDA 2VB6A 4J00A 2XDVA 3HPHA 3VYUB 2AB5A 4BU2A 3J7AY 1U0CA 1XNQH 4E7LA 4C30A 3KYLA 2MC4A 3MWMA 2CW7A 3G2BA 3I9V2 4HSRA 4RM3A 4QPQA 4CH7A 2X1EA 4XOTA 2I3QA 3DTIA 5A2QW 4MTDA 4YHXA 1FMVA 1Z3YA 3DKXA 3DWLE 1L2ZA 2VBNA 2R7VA 2UUZA 3S3NA 3IG0A 3L2QA 2UUCH 4IQJA 4OAYA 3DTEA 2IN8A 4JI1H 1N32H 3M8JA 4BQQA 4PSXA 4RMNA 3TBIA 2KSWA 4YISA 4UN7G 4XM3A 3C0WA 2MABA 1Y56A 4BDYA 2LC2A 4LSAA 3CJQB 2E1MB 3VSKA 3LL7A 5E5SA 3SDBA 2L7KA 2A6TA 4DBRA 4UCVA 3RIZA 1BP7A 3OR1C 3HOSA 2BVMA 4E7JA 1MW7A 2HVQA 4UNCA 1UELB 2BW3B 2GOMA 4NUBA 2V26A 2VL8A 4XQFA 2KRHA 4UCUA 3J80W 3H0DA 2AQEA 2WAFA 1D1BA 2IN9A 4PJMA 1A0IA 2QOJZ 5EOYA 1SAUA 3FHNA 3OS1A 1LWTA 3NWSA 3N05A 3AKZA 3K70C 4Z20A 3N43B 1Z7LA 4XR6A 1P8KZ 3DU6A 1VZ0A 2KP6A 3RGZA 3N40P 1FMWA 3OL3A 5IWAH 1UG0A 2VS7A 2CUJA 2ZXIA 4LH7A 4LFBH 3MXBA 4CC6A 2PMZA 5LD2C 5A0MA 3OYGA 2Y0SA 4B3XA 3S32A 2W7NA 2E1MC 3CJRB 2VLAA 2VXDA 3W2VA 3C0XA 4UNBA 1MMAA 4KITB 1GYFA 4XKBA 1MNDA 4KHPH 1ZHQA 1V5FA 1LWSA 1LDKB 3MMYB 4EEQA 2UV1A 3EH8A 2LG4A 3ZCOA 3OTOH 5HOOA 4DV3H 2CS3A 3PNYA 3D5LA 2VKHA 4YITA 1HNZH 2VASA 2DOAA 3K10A 3HUGB 3IAM2 4BJ6C 5HNHA 3RTXA 2R7TA 1R6RA 2LYCA 3KAJA 4N4OB 4BQOA 2CUZA 4MLOA 4RM2A 4CCKA 5KHDA 2VPLA 2VBNB 4PDBA 2CW8A 3H9QA 4OWRB 3W3CA 4UFZA 3BA8A 4UN9G 2V4JC 3HC7A 4E2TA 2UXBH 2VJJA 1X4PA 3RPUD 2R7XA 1BOBA 5AKMA 2RQQA 3EUKL 1AN7A 2F6CA 5LMUH 4E4HA 2WA0A 4Y3OA 2IN0A 2X1DA 2VBJB 4Q0YA 5IT9W 4UN8G 3UQ8A 5FPOA 5HLTA 1ZELA 2VJ4A 3BC8A 2WY8Q 4XMYA 4YEJA 4BL0B 2EX5A 3RQ4A 4JQFA 1HNWH 3L2PA 3J7AK 3GBGA 4DR3H 3BABA 2W82A 1XMOH 4JI7H 4UCOA 4ZYAA 4EFBA 3KX2A 3OMYA 4IX7A 2E60A 4X0GA 4AQUA 4HNTA 2ZXHA 3DPTA 4XLAA 4ZJZA 3S3MA 4RB0A 3SYTA 2FE3A 4GRIA 4APMA 2OWOA 2DXIA 4DIQA 1N3EA 4YHHH 4PJJA 4XNFA 3RJ0A 5D1PA 2Q1ZB 3SZGA 3IP4B 3MXBB 1V5GA 2VBOA 1WH2A 3AL0B 5FRMA 5A0MB 2R7OA 2VQEH 4JI4H 5LFAA 1WJFA 2Z1DA 4AAFA 2F4IA 1EA3A 3OYKA 4UNAA 4E7IA 3QYBA 1XDNA 3FMAA 4XN0A 3BAAA 3KXYT 4I7HA 4PSWA 2HHHH 4X65H 2VJ5A 2DCHX 2VOBA 2HPMA 1YX5A 3DU5A 2K9MA 4A2AA 3KEYA 4O1SA 2UXCH 1B04A 4BE0A 1BR1A 2X51A 2WAQA 1DQ3A 4KJZA 3CVZA 1AT0A 3E54A 2I3PA 4PJLA 3RSNA 4DGWB 4BJTA 4BDZA 2HU9A 1TAEA 4LF9H 4U7BA 3K3VA 1T9IA 3CZ6A 4DR4H 3T1HH 1J09A 3DPUA 3PFYA 3IUOA 5KNLA 1M0TA 1XNRH 4RZQA 3BCAA 4PJNA 2MYSA 3I3LA 2P0WA 5LMNH 1P8LA 3W2AA 3S8PA 4J0MA 3T1YH 2VKDA 1D0XA 4BEHB 2LY1A 2FUG2 1G8XA 4HRIA 3BA9A 3FKJA 4ZDLA 2L2OA 4JYAH 3EYYA 3LMMA 3OOLA 2XF5A 3L2VA 3IAS2 5E5OA 1Z21A 3JSNA 4FM9A 3ONQA 2LOOA 2V6EA 4AQYH 1DQUA 3AFHA 4XOPA 4MV7A 4XLHA 1E0EA 1G9YA 2Q2EB 1X4OA 3D5SC 3BLYA 1V5EA 3H9JA 4CSWA 2KHMA 1WJCA 3TMOA 2I8DA 4DR5H 1MMDA 3QOEA 1HNXH 2VXZA 3VSLA 4MTEA 2JUGA 1WFXA 3L2RA 1UAAA 1V9PA 5A77A 3A4CA 1X9NA 4DV6H 3ZXSA 3D5RC 3IFJA 4AYBA 4DBQA 4DOZA 4JI0H 2KLOA 3OYLA 2UXDH 1YX3A 1WJAA 1DP3A 1NG7A 4XONA 4G6TB 4DR1H 3OYNA 5FD6A 3DPLC 4RB2C 4DV4H 1OLTA 3OYMA 5D1OA 3FDYA 4B47A 2E5ZA 2R7QA 2VS8A 3MIPA 5LL6b 3PNTA 4J01A 4DV7H 2M4KA 2RGVA 4XKVA 2IS1A 4GLXA 1EF0A 3MXAA 2FLDA 4B44A 2KPMA 2W1OA 2VQGA 1M5XA 2XC7A 2VBLB 4B3TH 4D1QA 4DR7H 1N78A 3C0FB 3KALA 3K4KA 3CF2A 1W36D 4DJAA 2LREA 3OYBA 4LF4H 2ZM6H 4E7KA 4ZDOA 5K08A 1GPPA 4LQ0A 1TA8A 2VPSA 2VQFH 1R7MA 2BOLA 2MD0A 2XAUA 3OYFA 2X6WA 1D1AA 3C2HA 2CMPA 3EUAA 1LFPA 2UUBH 1VDEA 3DQVC 1B24A 4UN7A 4AADA 1U0JA 3W2WA 5A78A 2O03A 3MD2A 1YE9A 2PJRA 4BJ5C 3OYEA 1IBLH 2CH0A 2HDWA 2X6YA 2L9SA 3CP2A 3LFUA 5TGTA 4KISA 4JI2H 4DV1H 2VQHA 4HNUA 3F9KA 2RREA 3OR2C 1N36H 3PNVA 2V9KA 4CCJA 2VUGA 1BR4A 4UCTA 4XKWA 2W00A 1N77A 4C2TA 4CC5A 4RB3C 1HR0H 2L9NA 1ZHSA 4NXMH 4GKKH 4XLFA 4DV2H 4YRVA 2WY7Q 3FBNB 3N41B 2XIGA 4CCMA 4LH6A 4DV5H 2KZVA 3LSKA 2XF7A 3ZGKA 3LSMA 3LSIA 4ZC3A 3HKZA 4F3QA 1ERDA 4HG2A 1MI8A 4PFPA 5A72A 2IXSA 4BQNA 1D0YA 1DGSA 4JV5H 2GOXB 4KL5A 2CV0A 4X64H 4H4KC 4BWSC 3S93A 3K4BA 1BJTA 5FRNA 2A5WA 1P9QC 3ZQQA 5AKFA 3HYJA 2HNHA 2MFZA 3LSGA 3K4NA 2HQAA 3F8NA 2OV7A 2WADA 3VDXA 4BUPA 4OAZA 3PJRA 1T9JA 2X6XA 4ZTJA 1JI8A 3CESA 4UCSA 4KT6A 1KONA 1I6UA 3QODA 3OYCA 3MISA 2HGSA 4BACA 1GLNA 4LITA 4PUSA 3UR3C 4UCRA 1N75A 3J81W 4X62H 4ITVA 4NNJA 4LMYA 1D0ZA 1T95A 2M4GA 4XLEA 1W36C 3BCBA 2JMZA 2JNQA 3BG7A 4EATA 1MNEA 4II2A 5FROA 4E7HA 4UN9A 3DEEA 1Z2OX 1X1BA 3K4JA 3N42B 3OORA 4F55A 3A2KA 4JI8H 2W4SA 3CP8A 4GKJH 4E6KG 3V42A 2BVLA 4XORA 2WYOA 2DT7B 5FD5A 2PJRB 2BW3A 1MMGA 2KL4A 3HG9A 4JI3H 4UN8A 2LBFA 2R7UA 1QHHD 5A74A 4NXNH 1JVAA 1LVKA 4E7SA 4LF7H 3PN1A 2K9LA 4LF8H 2RGRA 3OIQA 5I0AA 5AK9A 4AQXA 4BS9A 1E4GT 2M7AA 2V1NA 2XSJC 3PUBA 2LRDA 4Y33A 4C9YA 2LCJA 3RF2A 5FPRA 3AL0C 2V7FA 2LQMA 1TZLA 1M0WA 1N33H 1WJ5A 2OUMA 2LH9A 3N44B 3DTKA 4ETSA 3OS0A 1IBMH 3L2UA 2M7BA 4XN3A 3HL2A 3JAMW 2KDOA 3VYRB 2L5QA 4B48A 4E7ZA 3H5RA 2OC6A 4HSTA 3HOTA 2JA2A 3MKYB 2W57A 2VQCA 3H5AA 1WJBA 4QPOA 1TT0A 1S03G 1PYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AAE A;  2VBL B;  2VBN B;  2L8L A;  2LWY A;  3KO2 A;  2CW8 A;  4AAB A;  1N3F A;  4UN9 G;  4E2T A;  1G9Z A;  5K08 A;  1MOW A;  1GPP A;  5AKM A;  5AKN A;  4LQ0 A;  5A0W A;  1R7M A;  4GIG A;  2IN0 A;  2VBJ B;  1AM2 A;  4UN8 G;  1DFA A;  1VDE A;  1B24 A;  4AAD A;  4UN7 A;  2VBL A;  5A78 A;  2EX5 A;  2VBO B;  2KEQ A;  3HYI A;  2XE0 A;  4Z1Z A;  4LOX A;  5E63 A;  4AAG A;  4Z1X A;  2VBJ A;  4AQU A;  3QQY A;  4EFJ A;  3IGD A;  4E2U A;  4D6O A;  1ZDE A;  1N3E A;  2AB5 A;  1U0C A;  4OZ6 A;  3MXB B;  2VBO A;  5A0M B;  2CW7 A;  4AAF A;  4UNA A;  1MI8 A;  5A72 A;  2I3Q A;  4YHX A;  2DCH X;  2VBN A;  1U0D A;  4KL5 A;  4O1S A;  2IN8 A;  4UN7 G;  4YIS A;  1DQ3 A;  5AKF A;  3HYJ A;  3C0W A;  1AT0 A;  3E54 A;  2I3P A;  5E5S A;  1T9J A;  5E67 A;  3NZM A;  1T9I A;  1BP7 A;  2IMZ A;  3MIS A;  4KL6 A;  4UNC A;  3UVF A;  1UM2 A;  2JMZ A;  2IN9 A;  2JNQ A;  2QOJ Z;  1LWT A;  3OOL A;  5E5O A;  4Z20 A;  4UN9 A;  1P8K Z;  3OOR A;  1AF5 A;  2VS7 A;  1G9Y A;  3MXB A;  3MX9 A;  4UN8 A;  5A0M A;  5A74 A;  1JVA A;  3C0X A;  2XE0 B;  5I0A A;  5AK9 A;  4UT0 A;  4AQX A;  5A77 A;  4UNB A;  3IFJ A;  2LCJ A;  1LWS A;  2LQM A;  3R7P A;  2O7M A;  3EH8 A;  2VS8 A;  3MIP A;  4YIT A;  4D6N A;  3FD2 A;  1ZD7 A;  1EF0 A;  3MXA A;  2FLD A;  4O1R A;  1M5X A; 
#chains in the Genus database with same CATH topology
 4WK8 F;  5FKN A;  3EUH C;  2K40 A;  2V1U A;  4B3S H;  1MIJ A;  3KO2 A;  5K7H A;  3ASN H;  3K1M A;  4MV1 A;  4HEA 2;  1Z3X A;  5KFE A;  4X66 H;  1ACI A;  3CCV I;  5A0W A;  3DCF A;  4RGS A;  4Q44 A;  3OS2 A;  3ZPL A;  3HXL A;  3F8M A;  2F2E A;  1E2X A;  2JMW A;  2QYO A;  1Y0U A;  2DA4 A;  3DKY A;  2K02 A;  4IOC F;  2IGN A;  2Q8K A;  1YJ9 I;  4J9N A;  3CCM I;  5D8D A;  4Y4R A;  2LTP A;  2VBO B;  3JSL A;  3OIO A;  3RJP A;  3VFZ A;  2EA4 A;  4CYC A;  1TW3 A;  1XSX A;  4IHY A;  4A5M A;  1RJQ A;  2FPI B;  3K69 A;  2MBF A;  1OCZ H;  1E3O C;  3DF7 A;  1Q1H A;  3NAU A;  2VJI A;  4AAG A;  2MC3 A;  2XKP A;  1KYZ A;  3GZ6 A;  2A6H F;  4CZZ A;  4B43 A;  4EFJ A;  2DOF A;  2R82 A;  4Q45 A;  1LUJ B;  2VON A;  2ECB A;  1Y8Q B;  1WI9 A;  1ZDE A;  1EHI A;  1O75 A;  2HTJ A;  5C4X J;  2JSC A;  4DR2 H;  4LLG F;  5KFN A;  5HNF A;  3HPG A;  3PO3 J;  2K3P A;  4BE2 A;  3RAQ A;  2W7P A;  5J4V A;  1XS9 A;  1SEI A;  3R23 A;  5F1J A;  4DUY H;  3OWT A;  1MBF A;  3GTK J;  5EWE A;  3IC7 A;  2BQU A;  1RPW A;  3FMR A;  3P7N A;  1T0F C;  2LKS A;  3CDI A;  5B1B H;  4Q47 A;  3TP3 A;  5J2T F;  1TWA J;  1RKW A;  2DJI A;  2R92 J;  3H40 A;  5DG9 A;  2QA4 I;  1FJG H;  4RLQ A;  2DMU A;  1J5E H;  2OBP A;  1BGW A;  4CCN A;  2XGE A;  2EQR A;  2CW0 F;  4EYH B;  3G1L A;  5CPR B;  3TDZ C;  3V6J A;  4ANJ A;  4KIF A;  3BG5 A;  2JA5 A;  4BXF A;  4MFE A;  2AQF A;  2QK4 A;  3GTM A;  3R6S A;  2K9S A;  2IVM A;  5E1X A;  2WTE A;  3DBH B;  3RPU A;  4KL6 A;  1R4N B;  1Z2P X;  3CUQ C;  3PFI A;  2L9R A;  5BS6 A;  1D5Y A;  3CF5 F;  4HYE A;  2JA8 G;  2VA2 A;  2FK3 A;  2PQ8 A;  4BNC A;  3FWE A;  2YPR A;  4OOI A;  2IT0 A;  4EJV A;  1DIK A;  4A5N A;  1W5S A;  1K79 A;  3ZN1 A;  5BNG A;  4LG3 A;  2GA2 A;  3BR3 A;  4LIV A;  1QU3 A;  2G7H A;  3CLO A;  4M3G A;  3RYR A;  2UWM A;  4I6Z A;  1EH8 A;  3CCY A;  3NRV A;  3E5N A;  2EZL A;  5F0H A;  2JA7 J;  3FKI G;  5D1O B;  4QTR A;  2HZT A;  2X1C A;  3KE2 A;  2PJP A;  4CYC B;  1P4A A;  4FIS A;  4LIU A;  1WH7 A;  3BG3 A;  3HKZ N;  3H5N A;  5L3D A;  1XG1 A;  2Y0S E;  4EBC A;  4O2B F;  3KLN A;  5IYC G;  4IRI A;  4XLN F;  2JT1 A;  3IH2 A;  4IF4 A;  4AVZ A;  5DDG A;  3RI4 A;  3VPD A;  1OYY A;  1P7J A;  3J7Y J;  4HYK A;  2COB A;  4QSH A;  2DT6 A;  2QBY A;  2HKO A;  3H35 A;  5ICG A;  4H0E A;  2DT5 A;  2E5N A;  3SFZ A;  3E1S A;  4A3I J;  4A3F G;  2FU4 A;  2JA5 J;  5K2M A;  2F4O B;  3GTM J;  3G3Z A;  1FSH A;  3DBL B;  2OZ6 A;  2W24 A;  1VAJ A;  1FLI A;  1ZD7 A;  5L1L A;  2M0M A;  4YEL A;  4HX8 A;  2ACJ A;  2JEI A;  1KQ0 A;  2XPV A;  3IRR A;  2WE6 A;  3VPR A;  1XSV A;  3U1D A;  2ZJT A;  2K5C A;  2WV0 A;  5K1Y A;  1F4K A;  3FM3 A;  4YG2 F;  1WJE A;  4BBS J;  1A04 A;  1VQ4 I;  1PDN C;  4CDG A;  1G9Z A;  2GA1 A;  1I50 J;  3BR6 A;  3HSE A;  5FKL A;  1QRY A;  5GON F;  3A1Y A;  2F4V H;  1GHC A;  3GZN B;  1WCM G;  3DLA A;  1A35 A;  2NOJ B;  1REP C;  1DFA A;  1G6N A;  3G6Y A;  4ECS A;  4NHJ A;  2QSG X;  3GIM A;  1P4W A;  1X2M A;  4ECZ A;  4BH9 A;  5DQI A;  3CCR I;  1FIA A;  3DP7 A;  3FM5 A;  4CCL A;  2KQR A;  2V6C A;  1PP8 F;  1G59 A;  5FKO A;  2IGO A;  2EWN A;  2VQL A;  4LOX A;  2R7R A;  5E63 A;  3QYF A;  4NQW B;  3Q9V A;  5DEQ A;  3OYH A;  2YCH A;  3C2B A;  3BQY A;  4ED6 A;  1S5L C;  4HDU A;  1WH5 A;  1XMQ H;  1OR7 C;  2Y9Z A;  2A07 F;  3IGD A;  1D8J A;  4A3M G;  2EFP A;  3HPH A;  5CVR A;  1HW2 A;  3Q8S B;  2GXG A;  1GGO A;  3HTS B;  4C30 A;  2MC4 A;  1DPR A;  2O61 A;  1BC7 C;  2ME6 A;  4A3J J;  2P7V B;  2Y30 A;  3OSN A;  2LY9 A;  3RV3 A;  4L0Z B;  5BPH A;  2EFQ A;  2OH2 A;  4W97 A;  1HW1 A;  5BPD A;  1V51 A;  2MD5 A;  2IN8 A;  4L18 B;  1BXR A;  5C8Y F;  4JI1 H;  4BQQ A;  4YIS A;  1YYV A;  4XM3 A;  2B0L A;  4G12 A;  2P5L C;  4FU0 A;  2WAQ E;  1Y56 A;  2VQD A;  3FHZ A;  3PW5 A;  3C3W A;  5E5S A;  4LB5 A;  3RIZ A;  2EPF A;  2HGC A;  2QVO A;  3BZ6 A;  3P5J A;  2BVM A;  4HF1 A;  3JZI A;  4AD9 A;  2HVQ A;  3MVP A;  2MG4 A;  1WI3 A;  3F3X A;  3BQ0 A;  1S29 A;  2NU6 B;  4O3P A;  4C5B A;  2X9D A;  1R49 A;  4C5A A;  1APL C;  4BY7 J;  4Q8E A;  3BDD A;  1D1B A;  2AXT C;  2IN9 A;  4FBT A;  1BL0 A;  3RPQ A;  2W6O A;  5EOY A;  1X3W B;  1SAU A;  3FHN A;  1LWT A;  1RYS A;  5IYD G;  3HOV J;  4XR6 A;  3DU6 A;  5IWA H;  2HR3 A;  3ZMZ A;  2V1D A;  3MXB A;  5LD2 C;  4DL3 A;  3Q2O A;  4J9L A;  2AU0 A;  2Y0S A;  1J7K A;  3S32 A;  4I4T F;  1T56 A;  3W2V A;  3GTQ A;  3OUU A;  1T36 A;  2NRA C;  2PMU A;  2OPT A;  4UNB A;  4KIT B;  4EGJ A;  5KFM A;  2P4W A;  1ZHQ A;  2O3F A;  3QU3 A;  1MMS A;  3E97 A;  4FHT A;  5DS9 A;  4EM1 A;  2HOS A;  3CC4 I;  3V8J A;  2D5V A;  1YW7 A;  5J6X A;  2ISZ A;  3ZCO A;  2YW2 A;  3OTO H;  4GC7 A;  4IWY A;  2VKH A;  1DPU A;  1HNZ H;  3JAM K;  1IOV A;  1WWX A;  2DOA A;  4YFN F;  4ED1 A;  3HUG B;  4B8X A;  3HDD A;  5HNH A;  3RTX A;  2CUZ A;  2Y9Y A;  4RM2 A;  4CCK A;  2I8C A;  4PDB A;  1Z91 A;  2DI3 A;  1V4Y A;  2FLP A;  3PIP F;  2HXI A;  5IP7 G;  2K4J A;  3BA8 A;  1FIP A;  3I71 A;  2YZM A;  1S8N A;  3HC7 A;  4E2T A;  2ASJ A;  2FLL A;  2UXB H;  1RC9 A;  2ZCW A;  3V7R A;  2XAS A;  4Y7N J;  5E1W A;  3M07 A;  4E4H A;  5KFD A;  3GII A;  5IT9 W;  1LE8 B;  3J7Z I;  2FSW A;  3R5H A;  5KFF A;  5ILV A;  3UQ8 A;  1WZ2 A;  5FLX K;  3FMQ A;  2ZDQ A;  2WY8 Q;  5GAD J;  1U3E M;  4BL0 B;  2EX5 A;  1IRF A;  3GTQ J;  1Z7U A;  4XRF A;  5HLI A;  4C3H J;  3RKQ A;  3GBG A;  3LAP A;  3H0G A;  2R8I A;  2UVV A;  1HNW H;  3J7A K;  1XMO H;  4UCO A;  2ZC2 A;  4ZYA A;  3RKX A;  4EFB A;  3MR2 A;  3OMY A;  4LGW A;  5LEK A;  4AQU A;  3FXR A;  4HX4 A;  1ZYR F;  4U88 A;  4ENN A;  1SEU A;  3S3M A;  1OCT C;  4RB0 A;  3P9K A;  2FE3 A;  4ZYE A;  1FJL A;  1EJ9 A;  2MLG A;  4DIQ A;  4U0Y A;  3DEU A;  3QPH A;  3I58 A;  3LSR A;  2X48 A;  3RJ0 A;  1VQP I;  5D1P A;  4O3O A;  1SFO A;  3IP4 B;  3MXB B;  1WH2 A;  4A0Y A;  5IOY A;  4U6P A;  5FRM A;  2NNY A;  2CUE A;  4IHX A;  2Z1D A;  3F8B A;  2H27 A;  2HYF A;  1XC5 A;  3HRS A;  4I7H A;  4XN0 A;  3BAA A;  4PSW A;  2VE8 A;  4X65 H;  2HHH H;  1B9N A;  5LRS A;  2HPM A;  2K9M A;  1ZGA A;  2L0K A;  4R8U B;  4G7H F;  4BE0 A;  3LA7 A;  1BI0 A;  1BR1 A;  2DLN A;  3KIO A;  1I5Z A;  2WAQ A;  3M1E A;  3KHH A;  1IC8 A;  3H92 A;  4PJL A;  2I3P A;  3I0T A;  3LFK A;  3QZ8 A;  2YRW A;  4A3B G;  1QVU A;  3I64 A;  5M5Y J;  1BN5 A;  1J09 A;  3PFY A;  4BY1 J;  1MBJ A;  3LAJ A;  2NU8 B;  3IUO A;  4RNN A;  2EIM H;  4RZQ A;  3I3L A;  2P0W A;  5LMN H;  1P8L A;  4J0M A;  4M9U A;  3FXQ A;  2OLS A;  1D0X A;  5JUM A;  2MH2 A;  5H80 A;  3LP8 A;  2ZO4 A;  2QQA A;  2B63 G;  2D1H A;  4C3I J;  1SFO J;  1G4D A;  1YRN A;  3JSN A;  3ONQ A;  3E7L A;  3AFH A;  2F4L A;  4O3Q A;  1E0E A;  4UVA A;  3U9T A;  3D5S C;  3K7A J;  2HWV A;  2I8D A;  1OIS A;  1MMD A;  4O6J A;  2C2D A;  5KVR A;  1WFX A;  3FZV A;  5D6F A;  1X9N A;  2H6C A;  3ZXS A;  1XCV A;  2VPR A;  4XRS G;  2FBH A;  4AYB A;  2DOD A;  2LNB A;  2DU9 A;  1JHH A;  1S7O A;  4DBQ A;  1YX3 A;  1EH7 A;  2CGP A;  4XON A;  4DR1 H;  1KGS A;  2D2W A;  5E20 A;  2EFO A;  5KFV A;  3M4O J;  3I53 A;  2E5Z A;  3LSP A;  3MIP A;  1Z6R A;  2FJZ A;  4J01 A;  3I4M G;  1ZRD A;  5KFK A;  3CLQ A;  2ATL A;  3X2Q H;  4GCV A;  1BJA A;  4GLX A;  4UY8 I;  1EF0 A;  2KPM A;  3S2D J;  2R7F A;  3KHR A;  4C3J J;  5FJ8 G;  5KFZ A;  5C3E G;  4D1Q A;  2BBY A;  4DR7 H;  1UMQ A;  1FNN A;  5KFQ A;  2MGQ A;  4L5I A;  1I3A A;  5KT4 A;  3OYB A;  5IP9 J;  4QW9 A;  5K08 A;  1EF4 A;  1YJN I;  2BOL A;  2MD0 A;  4G94 A;  1R7M A;  2FD5 A;  3FK6 A;  4N0B A;  5KT7 A;  3ELK A;  3HOZ J;  2CMP A;  3T8R A;  2YR2 A;  3GTG A;  1W7P D;  3DQV C;  4UN7 A;  4AAD A;  1U0J A;  1UHW A;  4HA8 A;  4WCG A;  5A78 A;  3WGH A;  4ECU A;  2VOO A;  2Y0S N;  1IBL H;  3Q8Q B;  2J5P A;  2L9S A;  3CP2 A;  5KFY A;  4S05 A;  1X1P A;  2VQH A;  2UXX A;  4HNU A;  1MJ9 A;  3F9K A;  3OR2 C;  5ICC A;  2EIJ H;  1K83 J;  3R4K A;  3F22 A;  1QZY A;  1ON2 A;  1N36 H;  1SMY F;  2VC1 A;  1BR4 A;  4CC5 A;  1FBQ A;  1Q1V A;  3W6K B;  5KKN B;  2L9N A;  1ZHS A;  4NXM H;  1RK6 A;  4EGQ A;  1JDB B;  1JGS A;  2WY7 Q;  1UST A;  3WU2 C;  1U8B A;  2DWC A;  4CCM A;  1Z0X A;  2XGD A;  3FXO A;  1JKO C;  1EZ1 A;  4A3L G;  3LSK A;  1ULY A;  3LSM A;  2NVY A;  3BPX A;  2V5A A;  4F3Q A;  4ED8 A;  1ERD A;  4HG2 A;  5LYJ F;  1G3T A;  1HKQ A;  3AG4 H;  3V4G A;  1MI8 A;  3WG7 H;  5A72 A;  1D0Y A;  1HW5 A;  2JPC A;  4ED3 A;  4M3B A;  2JEF A;  5J3L A;  3I4N J;  3JW4 A;  2ELK A;  4OIQ F;  2Z9O A;  2C6Y A;  2MSY A;  1I6X A;  1BJT A;  2DA7 A;  2M45 A;  4PGG A;  4EEF G;  1W7P B;  3ZQQ A;  3HYJ A;  2HNH A;  1QBJ A;  3LSG A;  3K4N A;  3HIF A;  3F0C A;  2PMZ E;  3F8N A;  2BY0 A;  4BUP A;  2P5V A;  4OAZ A;  1T9J A;  4KT6 A;  1HQC A;  1VQO I;  3RKY A;  2R93 G;  2NOG A;  2R5Z A;  2DQL A;  3MIS A;  5DD8 A;  3O2P E;  2KT0 A;  4LIT A;  1BI2 A;  2PN6 A;  5F6F A;  2O6G E;  4XLE A;  1E4E B;  4RGU A;  3BCB A;  1W36 C;  2DPJ A;  1B8I B;  1QZZ A;  2JJ7 A;  4A3E G;  3QPS A;  4Z6Y A;  1TWF J;  2NYX A;  5GAE J;  2RAE A;  5BMV F;  1X1B A;  4RZR A;  2OJE D;  1M1E B;  3F6O A;  2M8G X;  4C2M J;  3P9I A;  4JI8 H;  3H36 A;  2DA1 A;  3CCS I;  1R9T A;  4UN8 A;  2LBF A;  2R7U A;  1QHH D;  4NXN H;  1JVA A;  1LVK A;  4FE7 A;  3PN1 A;  1WKM A;  3ZMV A;  1B6S A;  5I0A A;  4MV8 A;  2AGP A;  3ERE D;  2M7A A;  3C7J A;  1S0N A;  2LRD A;  4P96 A;  1KQ8 A;  2R86 A;  3CTA A;  5DQG A;  5D6E A;  1YFH A;  2V7F A;  4G6Q A;  1ENH A;  3RKW A;  2Z33 A;  4IRK A;  3MCZ A;  2OUM A;  2WAQ N;  2XHK A;  3N44 B;  2IP4 A;  3ROU A;  1MH4 A;  3T5X A;  2DN0 A;  3CME I;  1A6Q A;  3HL2 A;  3VYR B;  3T5K A;  3RB4 A;  4HST A;  2OC6 A;  1QVT A;  3MKY B;  3M9O B;  2VQC A;  1BW6 A;  2DA6 A;  3HOX G;  1TT0 A;  2KIM A;  1KQ9 A;  4AAE A;  2JEG A;  3DXJ F;  1YTY A;  2L7F P;  3IKV A;  1P4X A;  4R79 A;  1HSJ A;  2K4B A;  4ON0 A;  2L8L A;  5KFT A;  1MGT A;  5F08 A;  1TWC A;  1R5H A;  2ZFU A;  4M9Z A;  4A3G G;  1Y39 A;  5KFA A;  2XGX A;  5TIS C;  2IGK A;  3Q3S A;  1N56 A;  4QWB A;  2TDX A;  4HZF A;  2V59 A;  5BOX A;  3HOW G;  2BGC A;  1Z9C A;  3Q5F A;  2DMN A;  4FCY A;  4A3K G;  3GME A;  2R5Z B;  1S7A A;  4IAJ A;  2XAQ A;  1FBS A;  4F92 B;  3OOU A;  1A36 A;  3Q1K A;  3RBE A;  2KKO A;  2KEQ A;  3OL4 A;  2CYY A;  1YIJ I;  2KMU A;  5EZY F;  3HYI A;  1FY7 A;  4RAZ A;  1JLL B;  1PJR A;  2FJ1 A;  3BG6 A;  4DZJ A;  4Z1Z A;  1K61 A;  2XAG A;  5E3N A;  2HYG D;  1V3F A;  2VBJ A;  1P2F A;  4Q48 A;  1KU2 A;  3DLL F;  1LEB A;  2KJC A;  3FIS A;  3K4C A;  1VFC A;  3GLK A;  2IBD A;  5KG4 A;  1P6R A;  4E2U A;  2GLO A;  5J4Y A;  2K27 A;  1S97 A;  3CDL A;  1E4F T;  4XSX F;  4I55 F;  3DBR B;  4OZ6 A;  1T33 A;  2CFO A;  2LBF B;  4M6X A;  3EPZ A;  3V7C A;  4CA0 A;  4IHS A;  3JRC A;  4IKF A;  4LF5 H;  2CV1 A;  2LD5 A;  4BQA A;  3BR0 A;  5KG2 A;  2IS4 A;  2DPI A;  2ELH A;  5IYB G;  1Z6T A;  2R7S A;  1OCO H;  2R7N A;  4PWQ A;  2EJR A;  2O8X A;  2IA0 A;  3JR9 A;  2A68 F;  3Q8R B;  1G3W A;  4GYG A;  4BHC A;  1M7J A;  2R8K A;  2E5L H;  3FMS A;  1M6V A;  5C44 J;  4KDP A;  3I54 A;  1U9N A;  1X3Z B;  2JK3 A;  3CDH A;  3K3P A;  3NZM A;  2ID6 A;  3IWF A;  1A6I A;  3JRG A;  1ULZ A;  1N34 H;  3RCO A;  5LGT A;  1YIT I;  4UNO A;  2F5V A;  5GTI C;  1BR2 A;  2ZJR F;  4I0B A;  1TT5 B;  2VT2 A;  4XLC A;  3A01 B;  2EV5 A;  1AOY A;  3N8D A;  2OZU A;  1IF1 A;  2BEO A;  3EET A;  3T5J A;  2V9V A;  1HDP A;  1XGO A;  2HZD A;  2FF4 A;  5D8K B;  1Z2N X;  5JVD F;  3H4B A;  4GDF A;  1MMN A;  1GO3 E;  3LOC A;  1MBH A;  1Y0N A;  4DZP A;  2FBI A;  1FYM A;  1QPI A;  4TQR A;  3TO9 A;  1S9F A;  2BE5 F;  1WSU A;  3Q0U A;  1X19 A;  2RNG A;  2QKL B;  1R1T A;  1V55 H;  1AUX A;  1WQ2 A;  2E2J J;  2JSP A;  5KG7 A;  4DUZ H;  1Z77 A;  4M71 A;  2G9W A;  4BEH A;  2PN1 A;  4JI5 H;  4UVC A;  4HQ6 A;  2QCO A;  2IEK A;  3K4L A;  2IS2 A;  4UT0 A;  4L5E A;  5BPI A;  4F52 A;  1VS0 A;  3PR4 A;  2HPI A;  3E0J B;  5KFX A;  2F5D A;  5JR3 A;  2C2R A;  3QWL A;  4LF6 H;  3TO7 A;  2VUM G;  5KFP A;  1ZG5 A;  1KC7 A;  3J80 K;  5M5X J;  3DKW A;  4UB8 C;  3ZOB A;  4L9V A;  3MKW B;  2VOP A;  4LFA H;  2E7W A;  5LXT F;  2UU9 H;  3I55 I;  5HDG A;  3LWB A;  4NC7 A;  2M3A A;  4IZZ A;  4O1R A;  3OV8 A;  4I09 A;  1DP7 P;  2CO5 A;  4EGZ A;  4ECR A;  4EVI A;  4F91 B;  3SJM A;  3JRA A;  5EG0 A;  3U9G A;  4P5O A;  4IRC A;  3WTV C;  3WO1 A;  3ZQ7 A;  2R4G A;  1CE8 A;  4LK1 F;  2WC2 A;  1D1C A;  3E6C C;  2NS0 A;  4V2G A;  5AKN A;  1DV1 A;  4O4I F;  2W8K A;  4LLL A;  1I3Q A;  3CCJ I;  4JV0 A;  3LWF A;  1H9T A;  1AM2 A;  5KFS A;  4A2B A;  3KZZ A;  3GIJ A;  2XGP A;  1SAN A;  4DV0 H;  3GTL A;  4UV9 A;  5C1O A;  3N6X A;  2R92 G;  2FXA A;  2VBL A;  3ZN0 A;  1OCC H;  3OSF A;  3DFG A;  3H3V H;  1KZH A;  5J1Y A;  1LKX A;  2BY3 A;  3PQJ A;  2FPP B;  3VWB A;  3Q8P B;  3HOY J;  1F9N A;  1SFE A;  5ILS A;  3N4M A;  2K7L A;  2CUF A;  2DBB A;  3M1C A;  2H1L A;  3M4I A;  2HOA A;  3ZRG A;  5CQG A;  1Y1W G;  2QKM B;  1FYK A;  2XCA A;  1A5J A;  2ZSH B;  4IRG A;  5L3B A;  2RDJ A;  1K6Y A;  4U0V A;  3MKZ A;  1J2X A;  4LSX A;  4YQW A;  3GFL A;  3QYE A;  4S0H B;  4J9P A;  2AB5 A;  4P9U A;  1IV6 A;  5HLH A;  3JTG A;  1FEX A;  2QEX I;  4E7L A;  3ABL H;  4L0Y B;  4O3N A;  3KZY A;  3MWM A;  3B6A A;  1QPM A;  1CF7 B;  2JQ7 A;  1TWH A;  2HJW A;  2E2I A;  4M6V A;  2LDU A;  2XRN A;  4HSR A;  4UHT A;  2DMP A;  4OIR F;  1AHD P;  1X58 A;  3NQO A;  3DTI A;  4D7M A;  4MTD A;  2XC9 A;  3F21 A;  1I27 A;  1Z3Y A;  2MW8 A;  3DWL E;  1L2Z A;  2ESH A;  4HNV A;  2R7V A;  3ML6 A;  3L2Q A;  1W1W E;  2JA7 G;  4GGG A;  2QQ9 A;  5EZH A;  5FLM G;  1U78 A;  2LKX A;  2PG4 A;  3TBI A;  3I56 I;  2DYS H;  3A03 A;  3M3Y J;  1J59 A;  3T0Y A;  1YS7 A;  4YFX F;  4BXU A;  5K5Q A;  4UCV A;  3MN2 A;  3VSK A;  2L7K A;  2NVX J;  1HXD A;  4IZO A;  2Y48 A;  3PO2 G;  1IG7 A;  1HKS A;  2M8E A;  1ZH5 A;  2JA6 J;  4UNC A;  5EG0 B;  3B73 A;  3R0J A;  2VL8 A;  4NUB A;  2KRH A;  4KN7 X;  3J80 W;  3GTJ A;  1GSA A;  3V6H A;  2WAF A;  1RRJ A;  1A0I A;  1MJB A;  3K5I A;  2V4R A;  2FNA A;  2QOJ Z;  4D0P A;  1S0O A;  3MZH A;  1I1S A;  3NWS A;  3L09 A;  3N05 A;  3K70 C;  1KBL A;  3T5L A;  1Z7L A;  2W9C A;  1P8K Z;  3BQ2 A;  4M72 A;  1VZ0 A;  2KP6 A;  3RGZ A;  3N40 P;  3OL3 A;  4LFB H;  1TWH J;  2HS5 A;  2ZXI A;  5EEH A;  2VS7 A;  1BW5 A;  4LH7 A;  5ED4 A;  4XBF A;  4MA0 A;  4CC6 A;  2M30 A;  5DG8 A;  2R7M A;  2W7N A;  3VEP A;  4J9R A;  2ZB9 A;  3BR2 A;  5B5E C;  1VQ7 I;  1MBG A;  2J5O A;  1GYF A;  3A02 A;  3FXM A;  2BY2 A;  1QGP A;  4UFZ A;  1B6A A;  2MH9 A;  1PK8 A;  2GQQ A;  3BPV A;  4QWA A;  1VKZ A;  1JE8 A;  1T3N A;  4FE4 A;  2GZW A;  2PMZ N;  3EH8 A;  4I50 F;  2W6M A;  2CQK A;  4DV3 H;  4I0A A;  5KG0 A;  5H2F C;  2CWE A;  4C5C A;  2VAS A;  2DOE A;  5CVV A;  5J8C A;  4BJ6 C;  4UUS A;  1WHU A;  2LYC A;  4K2E A;  1IN6 A;  2E1N A;  4MLO A;  5KHD A;  3GTJ J;  2VPL A;  3RFC A;  2ZDG A;  5KFC A;  2CW8 A;  3H9Q A;  2IP2 A;  4L9T A;  2H09 A;  4WXC A;  3W3C A;  4DW6 A;  2B9S A;  2W6N A;  2DFE A;  3ZQC A;  2V4J C;  4A3K J;  3OSG A;  3W6V A;  4QWQ A;  1QA6 A;  2NS7 A;  4EG0 A;  1XTA A;  2R7X A;  3RPU D;  1T94 A;  3MJF A;  2RQQ A;  3PW7 A;  3WHB A;  2QLZ A;  4YIR X;  2F6C A;  1ZG3 A;  1VTN C;  3ULQ B;  4Y3O A;  1W96 A;  4Q0Y A;  3F23 A;  1ODD A;  1TWG A;  4ZYG A;  2CRG A;  1UZC A;  1ZEL A;  4EM0 B;  4PCQ A;  3JSP A;  2TRT A;  1QZE A;  2EBI A;  4YEJ A;  3G6X A;  3CCE I;  1NHA A;  2IA2 A;  4LX3 A;  1HF0 A;  4DR3 H;  1K1Q A;  1U5T A;  1D5V A;  4JV1 A;  2W82 A;  3JSO A;  3JRW A;  2R87 A;  3WTS C;  1W5C C;  4IWX A;  4X0G A;  2VPQ A;  4O3S A;  2F5C A;  2VC0 A;  5LBQ A;  2W9C B;  5H20 A;  4HLY A;  1BM9 A;  2DQR A;  3E6M A;  3HM5 A;  3SZG A;  1V5G A;  3HHH A;  4CGZ A;  1OJL A;  5F1R A;  3F6V A;  4U7C A;  4BY7 G;  5FLV A;  2E19 A;  2R7O A;  3K5H A;  1Y1V G;  2VR1 A;  3ERM A;  1RR7 A;  3MZY A;  5LFA A;  3FKI A;  1S10 A;  3GLX A;  1XDN A;  5D8L B;  3FMA A;  1ETY A;  3KXY T;  3HOV G;  3MWD A;  1U9O A;  2IPQ X;  2M34 A;  4IXA A;  2VJ5 A;  2DCH X;  5F64 A;  4Q8F A;  5DV5 A;  1YX5 A;  2H1K A;  4A2A A;  4A0X A;  4HR7 A;  5LOV F;  1BBY A;  3KEY A;  2JN6 A;  1BOA A;  5DYM A;  2STT A;  3EPI A;  4OMZ A;  2RDP A;  4V2F A;  1DQ3 A;  5HS8 A;  1IZ1 A;  4LB6 B;  1ZRF A;  1AT0 A;  1VI0 A;  3CVZ A;  3E54 A;  3RSN A;  4LK0 F;  4BJT A;  4F4W A;  4A3D G;  1IXS B;  2JEJ A;  4P9F A;  5DM7 F;  4U7B A;  4UUS B;  3CZ6 A;  4I02 A;  1T9I A;  4DR4 H;  2XB0 X;  3DPU A;  2FK2 A;  3KP6 A;  3U2R A;  3CMY A;  2G7U A;  5J40 A;  1H0M A;  1XNR H;  4JI7 H;  5LRR A;  4PJN A;  1IDY A;  1MKM A;  3W2A A;  4ECV A;  3BZC A;  4QIW E;  3E5U A;  1Z1D A;  5E79 C;  3S14 J;  4ZI7 F;  3M7G A;  2P5K A;  1TLH B;  3FKJ A;  2L2O A;  5J2U F;  3GQC A;  2Z99 A;  1IUF A;  3LMM A;  3K9T A;  3OOL A;  2HKX A;  3I4P A;  5IPA A;  2DFF A;  3L2V A;  5E5O A;  2QBY B;  4FM9 A;  3ZQH A;  1FTT A;  2PI0 A;  5AON A;  4AQY H;  1OMI A;  3WE2 A;  4MV7 A;  3OOP A;  5TRD A;  4Y13 A;  1G9Y A;  1CQJ B;  1WCM A;  1X4O A;  3BLY A;  2XVC A;  1TQI A;  2KHM A;  3TMO A;  4DR5 H;  3FF5 A;  2JUC A;  5DLF A;  3L2R A;  3QFF A;  4A6E A;  5A77 A;  4HAM A;  2DO7 A;  3IV5 A;  3ZQI A;  3D5R C;  3PVX A;  1QNT A;  5IYC J;  2BXZ A;  2G0E A;  1IAW A;  5KT5 A;  5LGN A;  1DP3 A;  4WBN F;  2FML A;  1VQ6 I;  1D8K A;  5KFW A;  3DPL C;  3OYM A;  4TUY F;  2J6U A;  2P6S A;  2R7Q A;  2XD4 A;  2GPW A;  1O3R A;  2NU7 B;  4ZOL F;  2GPS A;  2IJL A;  4KA4 A;  5E8G A;  3MEX A;  2PBZ A;  2RGV A;  4NC6 A;  2IS1 A;  3BRO A;  5M3F J;  1F43 A;  3WOD F;  1EUD B;  2EFW A;  2M05 A;  3KET A;  4NBQ A;  3C0F B;  4N9I A;  3TQ1 A;  1KYW A;  3CF2 A;  1W36 D;  3F72 A;  2LRE A;  2XAH A;  4G6D A;  1JXL A;  1F36 A;  1L0O C;  4LF4 H;  2L54 A;  2ZM6 H;  5KAF C;  4ZDO A;  5DCM A;  5F04 A;  5HDN A;  3DF8 A;  4LOC A;  1TA8 A;  2VQF H;  1IW7 F;  2HOE A;  5DGB A;  2V9W A;  5FB2 A;  3OYF A;  2DYR H;  1D1A A;  2X6W A;  4HW0 A;  3C2H A;  1WCM J;  3H3V K;  1VF9 A;  3A0H C;  1VDE A;  1SD7 A;  4XLP F;  1B24 A;  2ETH A;  2F4M B;  2K9Q A;  3QP6 A;  2LF7 A;  4IO9 F;  1YE9 A;  3D1N I;  3T1B A;  3UKG A;  4LG0 A;  4BJ5 C;  2HDD A;  2CH0 A;  4UXN A;  3G6E I;  2HDW A;  2X6Y A;  1JIH A;  3IN5 A;  4JI2 H;  2DK8 A;  3SQN A;  3TP0 A;  1Z05 A;  3G4S I;  2P7C B;  2CU7 A;  3GWZ A;  5L1J A;  2OCE A;  4CO8 A;  4UCT A;  1N77 A;  4RB3 C;  4G7Z F;  3PUF A;  2D45 A;  4O4L F;  2XPU A;  2DMQ A;  4XLF A;  2DAO A;  2R7Z G;  4GKK H;  1UHS A;  1H89 C;  2YU3 A;  5E3O A;  2CQQ A;  4A3M J;  4DV5 H;  1VQN I;  2KZV A;  1VBG A;  4AIH A;  4PGH A;  4JUZ A;  3CCL I;  2PVP A;  3G1M A;  2BR0 A;  1I39 A;  1K4S A;  3ISP A;  5FFZ A;  5L3E A;  5EF6 A;  3F8F A;  4PFP A;  1RIO H;  2IXS A;  2HQ5 A;  2HDC A;  1G2H A;  1ZTR A;  1ON1 A;  3QP5 A;  2JRM A;  3WTZ A;  2XV4 S;  3I59 A;  4QLC U;  4KL5 A;  2FKL A;  1BIA A;  3GIQ A;  4TV9 F;  3CCQ I;  2EIL H;  2X6O A;  4U0W A;  2WTF A;  3RB3 A;  3E5Q A;  4KYW A;  3R5X A;  2ASL A;  1SVL A;  2XCL A;  2A5W A;  2ZJP F;  2BV6 A;  1EV7 A;  2GIZ A;  2BZT A;  3PR5 B;  4G8X A;  3R60 A;  2IMW P;  3GTO A;  3VDX A;  1ZN2 A;  3PJR A;  3S16 J;  1SCU B;  4UCS A;  2HYJ A;  5F0C A;  1MBE A;  1ETK A;  1RZ4 A;  2QEN A;  1MSE C;  3QOD A;  3VOD A;  4NLG A;  4ZYD A;  2XCP A;  3L7W A;  2A5Y B;  4BAC A;  4ENM A;  4QIW A;  4IHV A;  1FZP B;  2L9V A;  4UCR A;  1N75 A;  3RUP A;  4JBA A;  1MSF C;  4LMY A;  2M4G A;  4BHB A;  2ZME A;  4RDU A;  3BG7 A;  3S2W A;  4EM2 A;  1OFC X;  4AWX B;  1U6G A;  3BQ1 A;  4II2 A;  1HNX H;  3OOR A;  4F55 A;  3REO A;  9ANT A;  5IYD J;  4E6K G;  2UVU A;  2BVL A;  3PW4 A;  1DDN A;  5FD5 A;  2BW3 A;  1MMG A;  4LG0 B;  2YL2 A;  2OF7 A;  2K9L A;  2LCJ A;  3H0G J;  3HGY A;  4ED0 A;  4FS1 A;  4Y52 J;  1R00 A;  3HHG A;  1WJ5 A;  5E3L A;  2LH9 A;  3GFM A;  4ETS A;  4GC6 A;  4MV6 A;  3AG1 H;  3JAM W;  2BQR A;  2LMD A;  2L5Q A;  4B48 A;  2LF8 A;  3H5R A;  2J6S A;  1T2K A;  4RBO A;  2QM3 A;  3ZQL A;  4J9M A;  4QPO A;  3O3K A;  5DQH A;  1QHG A;  2WAE A;  3J80 Z;  1S03 G;  1C0W A;  2O9L A;  4R8H A;  4K0K H;  4CCO A;  4FS2 A;  5JHF A;  3RTR A;  1UFM A;  1ETQ A;  2K86 A;  1VND A;  2PX9 A;  5IP7 J;  5CB4 F;  4BXX G;  5LHG A;  1XMX A;  1YOV B;  2V9P A;  2AGQ A;  4IR9 A;  2GBY A;  5FLX W;  2AO9 A;  3LQQ A;  4IOA F;  2P8T A;  2JRT A;  2A61 A;  4UB6 C;  3OYA A;  4M7E A;  1W93 A;  3OYJ A;  4RNO A;  5BQT A;  3H4D A;  4OU0 A;  3PZP A;  3CC2 I;  3G8C A;  2XE0 A;  3K1P A;  4MHG A;  4XL9 A;  5KCM A;  2DTR A;  4AID A;  2VKE A;  4Z1X A;  3CQZ A;  5FO5 A;  4BAY A;  1J5Y A;  1IN4 A;  1SYX B;  4RAY A;  1YS6 A;  4N4N B;  4D6O A;  1E3H A;  2HVR A;  5C4X G;  2B63 A;  1USS A;  4ZHQ F;  3ETH A;  3RB0 A;  3C2G A;  2W25 A;  5K5R A;  3L2C A;  3ZR8 X;  1NG6 A;  2XUB A;  2ALZ A;  1OWT A;  2YS6 A;  2XRO A;  4CZC A;  4YR2 A;  3HGG A;  2E35 A;  3UNG C;  4MQ9 F;  1U0D A;  3RIR A;  3GVA A;  2WDT A;  3MFK A;  5FKK A;  1YHQ I;  4XRS A;  2UXN A;  1H88 C;  3OYD A;  5FFX A;  3K4M A;  4XID A;  1WSC A;  4PFO A;  4UUT A;  4RB1 A;  2L7Z A;  1DGR M;  1YRN B;  1IXR C;  3LNQ A;  2QGU A;  2JVG A;  1K7A A;  5E67 A;  2X0S A;  1RYR A;  4CYD A;  1X1D A;  4Y8V B;  1ZKG A;  2XGC A;  1UHM A;  1AWC A;  4A3B J;  2YYA A;  2XAF A;  3UVF A;  2HXO A;  3CMA I;  2WBM A;  2HQN A;  2VIX A;  5JHU A;  4EYI B;  4OMY A;  2XF6 A;  2BQ3 A;  1TNS A;  4CUG A;  4EJT A;  1UM2 A;  1X2N A;  3CQZ J;  5L1K A;  3EUH A;  4IPA A;  1BJZ A;  1T98 A;  2DPD A;  4A3C G;  5HOD A;  5A2Q K;  4RAF A;  4DL2 A;  4RGR A;  2I10 A;  4HPQ A;  2WWY A;  3FBI B;  2DPU A;  3LML A;  4NB5 A;  1S68 A;  2O7O A;  1TQP A;  4F4Z A;  4A93 G;  4XIC A;  4FET A;  1P92 A;  1SFX A;  2EFN A;  1AF5 A;  4NDL A;  1EYZ A;  3VPC A;  2RF4 A;  3KHL A;  2EIN H;  2A3S A;  3PL8 A;  4BE1 A;  1XGS A;  3GTG J;  1Z67 A;  2Y31 A;  1KU3 A;  4EJW A;  3LA3 A;  3JRH A;  2KRF A;  4LFC H;  4RLF A;  2DJN A;  4AU7 A;  3U21 A;  2IS6 A;  2XE0 B;  2MCT A;  2E71 A;  1LFU P;  3EQL F;  2E2H A;  4S04 A;  4UUV A;  4EQQ A;  3HZJ A;  2VBY A;  4HV6 A;  3VYS B;  4WX9 A;  2FBK A;  2DFH A;  3BOQ A;  2HVS A;  4JI6 H;  2BHY A;  2FLN A;  2VBZ A;  3WU1 B;  3SDG A;  4DNC A;  3LSH A;  3GID A;  3H20 A;  5HBR B;  4OX9 H;  1YI2 I;  2XRL A;  3N97 A;  4B09 A;  3R7P A;  1MZB A;  1GXP A;  1S7E A;  3HTU A;  3AG2 H;  3PQK A;  1R71 A;  2R84 A;  3FD2 A;  2UUA H;  1AA7 A;  4WXD A;  3I4M J;  2V79 A;  4YII A;  2C28 A;  1R58 A;  1K4T A;  1IN5 A;  5IY5 H;  1RK5 A;  2NVY J;  1EUC B;  4FBU A;  1IRZ A;  4QIW N;  3B6C A;  4ZTF A;  2LWY A;  2DZD A;  4AAB A;  2JVH A;  5C3E J;  4CHU A;  1XDU A;  1LQ1 A;  1ETX A;  1N3F A;  5CKT A;  1T0F A;  1B4A A;  1MOW A;  3VYT B;  5KFG A;  4IHW A;  3MWE A;  4P1W A;  3K70 D;  4DR6 H;  4JV2 A;  5K5O A;  2QSH X;  1HLV A;  4DL5 A;  1DGW Y;  2E7X A;  5DCF A;  1BIB A;  1UCR A;  2FRH A;  4BHP A;  1S9H A;  3M8F A;  3L2W A;  4FTH A;  2O5R A;  2KDZ A;  4NC8 A;  5GTH C;  2H8R A;  5BR8 H;  5KT3 A;  2IA6 A;  3RZD J;  3NWT A;  3L4K A;  2XKO A;  1TC3 C;  1FTZ A;  3ZMD A;  2R93 A;  1SD5 A;  1K6O A;  4IEJ A;  5C44 G;  4AM3 A;  2FPG B;  1AUV A;  1XCB A;  3QQY A;  1OKR A;  2UVW A;  4RU9 A;  3WGI A;  4F93 B;  5HDK A;  2VB6 A;  4WF2 A;  4B1R A;  1Y8R B;  2XDV A;  5ILU A;  4J00 A;  3OHB A;  3J7A Y;  1U0C A;  1XNQ H;  2VI6 A;  4YAJ B;  1IGN A;  5HV6 A;  2CW7 A;  4J9O A;  3I9V 2;  1MNM C;  2GM4 A;  3C1D A;  4A3L J;  2W70 A;  4RM3 A;  2L3D A;  2R5Y A;  1V54 H;  2X1E A;  5A2Q W;  1R9T J;  2I3Q A;  2H6B A;  4U7D A;  2ZNY A;  1FMV A;  2BY1 A;  1EKE A;  2UUZ A;  2LK2 A;  2UUC H;  3WGG A;  3HOU G;  4OAY A;  2ZNZ A;  3DTE A;  2DDA A;  2ICW G;  5IYZ F;  3M8J A;  4BKX A;  1N32 H;  3BJA A;  2KSW A;  1LDD A;  2A69 F;  1OCP A;  3HRU A;  4HQM A;  3C0W A;  3FDS A;  1A9X A;  3PIO F;  2MAB A;  5EZG A;  2LC2 A;  3ABU A;  3CJQ B;  1MH3 A;  3SDB A;  2A6T A;  4ENJ A;  5I47 A;  3QPT A;  2XSD C;  1JKR C;  1ZET A;  2PEX A;  3OR1 C;  1BP7 A;  3MFH A;  1WPK A;  2YU9 A;  4ABZ A;  4E7J A;  1MW7 A;  1FX7 A;  3HSF A;  2R93 J;  1S0M A;  2V26 A;  4MV3 A;  3J81 K;  1O7F A;  5KFI A;  3H0D A;  2AQE A;  5E1Z B;  5J47 A;  1TWC J;  4XX0 B;  3AKZ A;  4Z20 A;  4A3E J;  3N43 B;  2FP4 B;  1O3Q A;  2JTV A;  1FMW A;  1UNN C;  1UG0 A;  3MAJ A;  1W4M A;  1POG A;  3R0A A;  5E8I A;  3RZO J;  5KG5 A;  2PMZ A;  2M5W A;  3TDU C;  4GYI A;  3C0X A;  2E1M C;  1MMA A;  4XKB A;  1V5F A;  1LWS A;  3E5X A;  2OU2 A;  4YBZ B;  1LDK B;  5EGO A;  1IXC A;  5JLX A;  5LLQ A;  3OSP A;  5J1U A;  1ZAR A;  4XYL B;  1O7L A;  1FP1 D;  4WWC A;  3V6K A;  2N8G A;  2OCC H;  3D5L A;  5JH7 F;  4AIJ A;  5LHH A;  4MAM A;  2CQX A;  1TTY A;  2H94 A;  2QQB A;  3K10 A;  2FX0 A;  4ZZL A;  2R5Y B;  3IAM 2;  2QF7 A;  1NH3 A;  2V58 A;  4F4X A;  4O5V A;  1ZR4 A;  4MV4 A;  1R6R A;  2YZN A;  4BQO A;  1FT9 A;  4IJA A;  1E17 A;  4OWR B;  4UN9 G;  3EPG A;  3BR1 A;  2M87 A;  3A0B C;  1X4P A;  2DDB A;  5AKM A;  1BOB A;  1AN7 A;  2COM A;  3EUK L;  4YJ2 F;  4A3G J;  5KFO A;  4EGY A;  1QQI A;  4Y17 A;  3GV8 B;  3GLL A;  1XPX A;  2IN0 A;  2X1D A;  2VBJ B;  1XB4 A;  5FPO A;  4AUX A;  2F48 A;  3VOE A;  2P0A A;  3HOW J;  1FYL A;  4KIG A;  3E6B A;  2Q2E A;  3RQ4 A;  2NU9 B;  2GAU A;  1LNW A;  4EJO A;  5LGU A;  1XGN A;  4I01 A;  3RDI A;  3RV4 A;  2HEO A;  3BJO A;  2JWT A;  5E17 F;  3BAB A;  2C2E A;  1SVM A;  2IBK A;  3WE3 A;  2ASD A;  5DG7 A;  2CQN A;  2E60 A;  1G3Y A;  2CJJ A;  4DYC A;  1VQM I;  4HNT A;  4X6A J;  2ZXH A;  3CCU I;  2RC4 A;  1JJ6 C;  2YRX A;  3WTX C;  3KHG A;  2OWO A;  3JAM Z;  2L01 A;  3TED A;  1SAX A;  2DXI A;  1N3E A;  4XNF A;  2J9G A;  4YHH H;  1AKH A;  3PO3 G;  2R0Q C;  2ZFW A;  1J0R A;  2YX4 A;  2VBO A;  5E3M A;  4TV7 A;  3ZP5 A;  2OTJ I;  5HS7 A;  4GO1 A;  5KG3 A;  4L9J A;  4JI4 H;  5L3C A;  2F4I A;  1EA3 A;  3OYK A;  2WV1 A;  4M73 A;  1ZAO A;  1T6S A;  3BP8 A;  2CZG A;  3DEW A;  4OIN F;  3WTU C;  2VOB A;  2DK5 A;  5L3G A;  4YAK B;  3GTP A;  1RUN A;  5IYB J;  5EGO B;  2HOT A;  2UVR A;  4PJ0 C;  4EBD A;  4CIC A;  4KFC A;  2UXC H;  4EV0 A;  4RA2 A;  3BG9 A;  2RN7 A;  4Y15 A;  5F0F A;  5FLX Z;  3GEZ A;  1B59 A;  4OIO F;  1UB9 A;  2EV0 A;  5KAI C;  4DGW B;  2VUM A;  3U9S A;  4BDZ A;  4JX5 A;  1VQL I;  3KYD B;  2HU9 A;  2IRF G;  3IKT A;  1TAE A;  2W9A A;  4LF9 H;  1FOY A;  1FOW A;  3HBL A;  3G73 A;  1K78 A;  5KT2 A;  3QRF F;  3HB9 A;  4R1H A;  1DUX C;  3S8P A;  1O57 A;  2VKD A;  4BEH B;  1P7I A;  2VT3 A;  2AQ4 A;  2FUG 2;  5CAE B;  2QYZ A;  3DV8 A;  3COA C;  5LA6 F;  5DD4 A;  5GP9 A;  2KZG A;  3ZMT A;  3WTT C;  2XF5 A;  3R61 A;  1ZLJ A;  3IAS 2;  1DU0 A;  1Z21 A;  2NVU B;  3S2H J;  1ETO A;  1I1G A;  2LOO A;  2RDI A;  1MDM A;  1DQU A;  1I3Q J;  3BWG A;  4XOP A;  4XLH A;  3FXJ A;  2W6P A;  3GTK A;  1IN8 A;  2Q2E B;  4HX7 A;  3ZQG A;  1JKP C;  2C35 B;  3H9J A;  4JP0 A;  1GUU A;  4KIB A;  4CSW A;  3GIL A;  4HF0 A;  3QOE A;  5KG6 A;  2VXZ A;  3GTL J;  4J9Q A;  4MTE A;  2JUG A;  3FK7 A;  3Q0V A;  1UAA A;  1NK3 P;  1V9P A;  1VBH A;  1TWA A;  2R92 A;  3GTP J;  4A12 A;  3S1Q J;  2FMA A;  2Y69 H;  4DV6 H;  5TJJ A;  3IFJ A;  2D1V A;  2HFH A;  4JI0 H;  1RES A;  2FOK A;  2UXD H;  1WJA A;  1NG7 A;  1SMT A;  3IWZ A;  4A3I G;  2C22 A;  1B1B A;  4G6T B;  2JA5 G;  2XB5 A;  4BBR J;  1R36 A;  1AKH B;  1Y1W A;  5D1O A;  3FDY A;  2VUM J;  1FP2 A;  2VS8 A;  1N48 A;  3RB6 A;  4XKV A;  2K85 A;  4N9H A;  3WHC A;  1KJ9 A;  2W48 A;  1TW2 A;  4B44 A;  2VQG A;  1M5X A;  2PBI A;  2XC7 A;  2VBL B;  4BBS G;  2IAI A;  2RKH A;  2E2I J;  1JUM A;  1CQI B;  1N78 A;  3KAL A;  3BZK A;  1KJI A;  3WTW C;  2NUA B;  3VB2 A;  1GDT A;  2LKP A;  3GIK A;  4LQ0 A;  1GPP A;  2VPS A;  2PLY A;  2JA7 A;  5FGM A;  3EUA A;  4QW8 A;  1ZLK A;  4ECT A;  2UUB H;  3TIN A;  1KJQ A;  2GXA A;  2Z5U A;  4I98 B;  2SCU B;  3FXU A;  3MD2 A;  4ZQI A;  1K78 B;  1WRJ A;  2PJR A;  3G71 I;  2L4A A;  3GYH X;  4KIS A;  3PW2 A;  2RRE A;  4HV5 A;  2EZI A;  2V9K A;  4PZJ A;  1ETW A;  4G9Y A;  1HBX G;  1OQY A;  2VUG A;  1Y1W J;  4C2T A;  1IRG A;  2ZXW H;  1WVR A;  1UJ8 A;  1C30 A;  1HR0 H;  1R5G A;  3IH4 A;  1MDM B;  4DV2 H;  1T08 B;  3Q0W A;  2A05 A;  4YRV A;  3FBN B;  4LH6 A;  1A31 A;  4A3J G;  3SI8 A;  3KP4 A;  3LSI A;  2NNN A;  2STW A;  4YR3 A;  3ABM H;  4BQN A;  1R22 A;  4OIP F;  1DGS A;  4NQW A;  2ECC A;  4TV8 F;  1I50 A;  3ZMU A;  4JV5 H;  2GOX B;  4ECW A;  2CV0 A;  4H4K C;  2X0L A;  4ECX A;  1R5I D;  3U1K A;  3CO7 C;  1WGX A;  3S93 A;  3RBD A;  3K4B A;  1P9Q C;  5KFR A;  1OCR H;  5FLM J;  1J75 A;  3I12 A;  2MFZ A;  1F1Z A;  3ASO H;  4ENK A;  4O2A F;  3M9A A;  5D5W B;  2NVQ J;  3MR5 A;  2WAD A;  4B4C A;  2X6X A;  5GAH J;  1TBX A;  3FX3 A;  4M3D A;  4ZTJ A;  1JI8 A;  1KON A;  5M3M J;  3MQ0 A;  1H9G A;  2WB1 E;  5JQW A;  4A0Z A;  4L1K A;  2H8W A;  4QJF A;  2HGS A;  2M9H A;  4HDV A;  5ERI A;  4WXH A;  3PO2 J;  5IT3 A;  4X62 H;  6PAX A;  4G7O F;  2O8K A;  4ITV A;  4NNJ A;  1CS0 A;  4P55 A;  1T95 A;  2KFD A;  4E4T A;  3RYP A;  3BR5 A;  1FOK A;  5H6Q A;  2JMZ A;  2JNQ A;  1S6L A;  3BJ6 A;  5AIQ A;  3O8G A;  4KT5 C;  3ZMS A;  1NK2 P;  5FRO A;  4E7H A;  3V8K A;  2AGO A;  2Y0M A;  3N42 B;  3K2Z A;  3K4J A;  4KUM A;  5LEJ A;  3CP8 A;  2F5F A;  3TKY A;  3V42 A;  2I87 A;  2HTS A;  2DT7 B;  5CVU A;  2PJR B;  5A2Q Z;  2KL4 A;  3HG9 A;  5GPC A;  1O3S A;  1F5T A;  1ZRE A;  1TWG J;  1FSE A;  4EMS A;  1RJP A;  5F9N A;  1YG2 A;  4LF7 H;  4GXO A;  1XGM A;  1JDE A;  4LF8 H;  2RGR A;  1I7L A;  4KIC A;  4M74 A;  1BI3 A;  3OIQ A;  5AK9 A;  3FXL A;  2XSJ C;  3PUB A;  3IL2 A;  4RUA A;  4ECY A;  3B02 A;  2M2E A;  2LQM A;  1N33 H;  1CGP A;  1RI7 A;  3LQR A;  3TW7 A;  3CO6 C;  5D4S A;  1M0W A;  2R7D A;  3KLO A;  3OS0 A;  5D4R A;  5DUI A;  3K0L A;  2JA8 J;  2CSO A;  1RNL A;  3HEF A;  2W57 A;  2JA2 A;  2V4Q A;  4O3R A;  1C3O A;  3VPB A;  2VE9 A;  3H5A A;  1WJB A;  4BS9 A;  5CYV A;  5DTD A;  1PYV A;  2GWR A;  4ESF A;  1ZQ3 P;  1TNT A;  2E1C A;  3OYI A;  2CV2 A;  5K7F A;  3ETJ A;  1Y1V A;  3FKI J;  3CMM A;  1YO5 C;  3EDP A;  1U5T B;  3K1N A;  4E70 A;  2YS7 A;  1HA8 A;  1W5T A;  3PSF A;  4PK4 A;  3KP5 A;  4IVN A;  2P6T A;  3L4J A;  1JUS A;  4R7R A;  5IT9 K;  4M9S A;  3HUG A;  4D9J A;  1IV8 A;  2EZH A;  2RQP A;  4IL6 C;  3OHA A;  2M1B A;  1GXQ A;  2Z16 A;  1YW8 A;  4ZDP A;  4II3 A;  4IR1 A;  3OIP A;  2EV6 A;  3SXY A;  3D0S A;  4DYR A;  1ZGW A;  2LP0 A;  4A3F J;  3S3O A;  4J9S A;  2Q2U A;  4KZS A;  4JOM A;  3I5U A;  1R4M B;  1MJA A;  1JKQ C;  2EZK A;  3HRM A;  1JT6 A;  4ESJ A;  3S1R J;  4JYK A;  4FQG A;  1LE8 A;  3JCU C;  3GXO A;  2IGM A;  4MV9 A;  4YR0 A;  3M9N B;  3KP7 A;  4XKC A;  2JPB A;  1O3T A;  1X3U A;  1T8I A;  1LFB A;  1LPQ A;  4FT8 A;  3HRT A;  3VMM A;  3H3U A;  1Y1V J;  2QWW A;  3GO5 A;  4XRM A;  5L1I A;  2VBW A;  4YY3 H;  1R23 A;  4LLN A;  5ICF A;  4PDK A;  3SEQ A;  3GCM A;  2FMY A;  2FOW A;  5CVI A;  1RET A;  2DW4 A;  3V4S A;  3GV7 B;  4I2O A;  2VBX A;  1PUF A;  4M6Y A;  1PP7 U;  1PVE A;  2WB1 A;  4BY1 G;  3H0G G;  5L9X A;  3RGX A;  2DCE A;  4EEY A;  2IMZ A;  3O8H A;  4MEX F;  4A3D J;  5D5U B;  4C2U A;  5IP6 A;  1HOM A;  5DGA A;  1HST A;  1U2W A;  2KIF A;  4ZYH A;  4AYB E;  1V4R A;  1AU7 A;  2EA2 A;  1IUY A;  3TW6 A;  4R8U A;  3SFI A;  3H3Z A;  3IRQ A;  2VKV A;  3GW2 A;  5IOZ A;  4RS8 A;  2CQ7 A;  1B6R A;  3GV5 B;  1R1U A;  2L4M A;  5GPA A;  2R7L A;  2XPW A;  5KFL A;  3PSI A;  3J81 Z;  3LSJ A;  3O6B B;  3JTH A;  3LA2 A;  4L9N A;  5CQE A;  4A6D A;  1PX2 A;  2W71 A;  2DMT A;  4MFD A;  3WTY C;  3QZ7 A;  1RJR A;  3MX9 A;  3M9M B;  2OTL I;  1KA8 A;  3L00 A;  2R7W A;  1U8R A;  3KCC A;  2VN2 A;  1I7N A;  1T39 A;  4ME6 A;  5DUK A;  4O3M A;  1UC9 A;  4FAS D;  5HVQ C;  1JKJ B;  1ZK8 A;  3T8T A;  3TL4 X;  1WJD A;  1ONV A;  2ZBK A;  3GZ5 A;  4ECQ A;  4EFE A;  2OQG A;  2PMH A;  4U87 A;  2HQR A;  4X1E A;  5M5W J;  5BMZ A;  4JX4 A;  5D5V B;  1S72 I;  1JX4 A;  1IN7 A;  5F27 A;  3ECH A;  3SZP A;  4BGD A;  2O7M A;  5DCM B;  5C1P A;  4IRD A;  2I5U A;  3SE7 A;  4D6N A;  1IRX A;  3K6G A;  4I99 C;  2Z2S B;  2R7Z A;  2LSO A;  3KAK A;  4XYM B;  2BXY A;  3OY9 A;  3GFJ A;  1FVI A;  3ORR A;  3M8E A;  1B33 N;  3PM1 A;  2DFI A;  2EIK H;  3H9G A;  1Y6I A;  4RGX A;  4ESB A;  2Q2T A;  5IP9 G;  4ZZD A;  5B66 C;  3TGN A;  3JRD A;  2F5E A;  2R85 A;  3TOB A;  1GV5 A;  3BTC A;  2KIU A;  3RAX A;  1XMK A;  1KJJ A;  1OPC A;  1ETV A;  4EJU A;  1SFK A;  2QZ8 A;  1I94 H;  5T14 A;  3HOZ G;  3S15 J;  4GIG A;  1PUF B;  1X1C A;  1DU6 A;  2CQY A;  1JTY A;  4YB8 B;  2FQ4 A;  1HCR A;  1GV2 A;  5JLW A;  1O4X A;  5EDN A;  2LY2 A;  4LJZ F;  3GTO J;  2KRC A;  1GT0 C;  1X1A A;  2ZSI B;  3SEZ A;  5EYR A;  4B3R H;  2ELJ A;  2YX7 A;  3CJT B;  2X85 A;  4Q4Z F;  4B3M H;  2K9N A;  2B7E A;  4J19 A;  3BTJ A;  4JX6 A;  3MR6 A;  4EBE A;  2MLK A;  4Q43 A;  4KN4 X;  5J1R A;  1RR8 C;  3I59 B;  3NAR A;  2GLT A;  2GXB A;  4IQ4 A;  4MQV A;  2EB7 A;  3VYU B;  4BU2 A;  5E18 F;  2O0Y A;  2R7Z J;  2X4H A;  2ZDH A;  3MR3 A;  3KYL A;  3G2B A;  1K1S A;  4A2U A;  4QPQ A;  5EDW A;  4CH7 A;  3JRE A;  4XOT A;  3I4N G;  4YHX A;  5KFJ A;  3DKX A;  5KFH A;  2JZY A;  2VBN A;  1DV2 A;  3S3N A;  2LVS A;  3IG0 A;  4HQE A;  4IHJ F;  1LJ9 A;  4YP3 A;  4IQJ A;  4DYQ A;  1EH6 A;  1ZGJ A;  4PSX A;  4RMN A;  1FOX A;  4UN7 G;  2ZME B;  1HC8 A;  1YIO A;  4LSA A;  4BDY A;  3BT9 A;  5CA1 F;  2E1M B;  2CKZ B;  3LL7 A;  1JJ8 C;  4DBR A;  1KEE A;  2DA2 A;  1U5T C;  4WD3 A;  1Y14 B;  3HOS A;  3V4Z A;  2ME0 A;  4QFQ A;  1UEL B;  2Y2Z A;  2BW3 B;  2GOM A;  1K83 A;  4XQF A;  1BC8 C;  3FXK A;  1XDS A;  5GAG J;  4UCU A;  2KIS A;  5EEG A;  3KP2 A;  1JUP A;  1KJ8 A;  4TQS A;  1W7P A;  1ZHF A;  3BTI A;  4PJM A;  3AAF A;  1UG2 A;  4MIM A;  5HLG A;  1ITY A;  4QWC A;  3OS1 A;  1W0U A;  5D5X B;  3MZ8 A;  2W84 A;  5KX5 F;  1PUE E;  2E36 A;  2CUJ A;  3H1C A;  2CFX A;  2HI3 A;  5FKM A;  5A0M A;  3OYG A;  4B3X A;  2LFB A;  2VLA A;  3CJR B;  2VXD A;  1E4E A;  3PW0 A;  4DQ2 A;  1B8I A;  2I80 A;  2OD5 A;  1MND A;  4KHP H;  2DTZ A;  4UVB A;  2TCT A;  2IW5 A;  3QOP A;  2R8H A;  2BHZ A;  1ORK A;  1NTC A;  3MMY B;  4RAG A;  2CG4 A;  4ASN A;  4D7N A;  2UV1 A;  4EEQ A;  2NXN B;  2LG4 A;  4ED2 A;  3EYI A;  1GVD A;  1FPQ A;  2CS3 A;  3KEO A;  3PNY A;  5B1A H;  5HOO A;  4YIT A;  2WB1 N;  5LP6 F;  3HJE A;  2B63 J;  4RUC A;  3S17 J;  4M3F A;  2R3S A;  1VQ8 I;  2FQ3 A;  2R7T A;  3KAJ A;  3NGD A;  1LVA A;  4I76 A;  4N4O B;  2VBN B;  2AXL A;  3KP3 A;  1W0T A;  1GSO A;  2Z3Y A;  1GVJ A;  2W6Z A;  1TWF A;  1OYW A;  2VJJ A;  2YUS A;  1BNC A;  1L3L A;  4C2M A;  4BYY A;  3MKL A;  5K7Z A;  5LMU H;  4J9K A;  1YW9 A;  5JVL A;  1D3Y A;  2WA0 A;  4D5F A;  1J9I A;  1JHF A;  2E1O A;  4UN8 G;  4B3A A;  3KPH A;  4BXX J;  5HLT A;  3QAH A;  2VJ4 A;  3BC8 A;  5HS9 A;  3WU0 A;  4D5C A;  3MFI A;  4XMY A;  3J7A O;  1B9M A;  4JQF A;  2DA5 A;  3L2P A;  3BJY A;  2V1X A;  3JRB A;  1YLF A;  3GF2 A;  1GSH A;  4JK1 X;  3FIW A;  3KX2 A;  5KFB A;  4IX7 A;  2NVT J;  4F7Z A;  2W8L A;  4XLA A;  3DPT A;  3QQA A;  4ZJZ A;  2KIQ A;  2W85 A;  2QQ8 A;  4XSZ F;  3SYT A;  1JGG A;  4GRI A;  5FJ8 J;  2C00 A;  4APM A;  3WG9 A;  2E34 A;  1R7J A;  4PJJ A;  4RNM A;  3F8C A;  2Q1Z B;  4A69 C;  3W6J B;  1RUO A;  3AL0 B;  5A0M B;  4Z2Y A;  1HDD C;  2YS9 A;  2VQE H;  1WJF A;  4AAF A;  3AYH B;  2DA3 A;  4L5J A;  4UNA A;  4E7I A;  3QYB A;  3QU6 A;  2DIK A;  3C18 A;  1SC7 A;  3HKZ E;  1FKA H;  3KYC B;  3ECO A;  5BPF A;  2FB9 A;  1FBU A;  2FA5 A;  3HSR A;  3DU5 A;  5KT6 A;  1SFU A;  5CLS A;  4IHT A;  2E2H J;  4O1S A;  1B04 A;  4V19 K;  2QUF A;  2X51 A;  2OAZ A;  4KJZ A;  3ZQF A;  3CUQ A;  5KK1 A;  4KMF A;  3CJN A;  1JXS A;  3ABT A;  2Y75 A;  2R8J A;  4XK4 A;  2DLL A;  1JT0 A;  1FWZ A;  1STZ A;  3CC7 I;  3K3V A;  4F50 A;  3T1H H;  2VOD A;  5KNL A;  1M0T A;  3BQZ A;  3BCA A;  1IBK H;  2MYS A;  5KG1 A;  3T1Y H;  1XSD A;  3IH3 A;  4LFU A;  2YZG A;  1VQK I;  2LY1 A;  3CD6 I;  1G8X A;  4HRI A;  3BA9 A;  4ZDL A;  5JI6 A;  3L1P A;  4JYA H;  1UC8 A;  3KEQ A;  4A3C J;  3TIG A;  3EYY A;  5DM6 F;  1GLV A;  2XGQ A;  3ESW B;  2V6E A;  2VA3 A;  3AG3 H;  4A93 J;  1MD0 A;  1HKT A;  4IRH A;  1V5E A;  1WJC A;  2OA4 A;  4W1U A;  3V8L A;  2RV8 A;  3VSL A;  3A01 A;  1LDJ A;  4CXF A;  4XZ3 B;  3A4C A;  4MEY F;  3L9F A;  2LLK A;  3QPL A;  5EJC A;  4DL7 A;  4DOZ A;  1IJW C;  2KLO A;  3OYL A;  2EH3 A;  4YJ3 F;  5LHI A;  5DLG A;  3OYN A;  5FD6 A;  4YFK F;  4RB2 C;  4DV4 H;  1OLT A;  1SVO A;  5L3F A;  4B47 A;  5LL6 b;  5JFR A;  3PNT A;  4DV7 H;  1VQ5 I;  4ZH4 F;  2M4K A;  2L7M P;  3MXA A;  2FLD A;  4QWE A;  2ZKZ A;  4AYB N;  2W1O A;  4B3T H;  3UFX B;  1B72 A;  2FNP A;  3P9C A;  1SD6 A;  1MBK A;  2ZME C;  2ESN A;  4Q5S F;  3ABK H;  1BA5 A;  1CQT A;  2W7O A;  1H8A C;  3K4K A;  1JTX A;  4DJA A;  2R6F A;  4ED7 A;  4E7K A;  5EWG A;  3CUQ B;  1TL8 A;  2XAU A;  4HBL A;  2XAJ A;  3G1O A;  5B3S H;  3JRF A;  2W9B A;  3S1N J;  1E3P A;  4M9X A;  4MNU A;  1LFP A;  3T5H A;  2PFB A;  4LD5 A;  2ISY A;  3W2W A;  2O03 A;  1XX5 A;  4AC0 A;  3OUZ A;  2ADU A;  3HOY G;  5JVT A;  1N25 A;  3OYE A;  1OR7 A;  3K2A A;  1OYI A;  5TGT A;  3LFU A;  5IT9 Z;  3V7S A;  2YU9 J;  4DV1 H;  2M0C A;  4KNY A;  3TOA A;  5EWF A;  1BI1 A;  1T38 A;  3PNV A;  2J6T A;  2A6E F;  3E3V A;  1TP4 A;  1YJW I;  3IHU A;  2MA3 A;  2OQR A;  4CCJ A;  3GIP A;  4UV8 A;  2W00 A;  4XKW A;  5CJ9 A;  3KFW X;  3HOX J;  5JVG F;  1KU9 A;  2EK5 A;  2YSR A;  5J8F A;  3N41 B;  2XIG A;  3TQT A;  3RQI A;  1G3S A;  1S3J A;  2XF7 A;  3ZGK A;  4ZC3 A;  2IA1 A;  2K3F A;  2RNJ A;  3HKZ A;  4G3I A;  5H6R A;  1IOW A;  2P81 A;  4GFB A;  1TQM A;  4FX0 A;  2L02 A;  3LST A;  3TII A;  1SD4 A;  4X64 H;  2Q0O A;  4BWS C;  4MGR A;  1XD7 A;  1R1V A;  4FX4 A;  4DLK A;  5FRN A;  3HOU J;  4DL6 A;  3JRX A;  1I6H J;  5AKF A;  3KTM A;  1CF7 A;  3TQN A;  2ZJQ F;  2HQA A;  1ZRC A;  2ZXJ A;  3WO0 A;  2OV7 A;  2NS8 A;  3BY6 A;  3WNZ A;  4F4Y A;  4QWD A;  3CES A;  1I6U A;  5C4J J;  2JA6 G;  3OYC A;  1B72 B;  2GIV A;  4AIK A;  4BBR G;  5ICE A;  1GLN A;  4PUS A;  3UR3 C;  2RVC A;  3Q9S A;  3J81 W;  4DL4 A;  1ZQ7 A;  4HOB A;  3ORQ A;  3GX4 X;  5CVJ A;  1ZG1 A;  1D0Z A;  2LR8 A;  4YIF A;  5EEA A;  3GUD A;  2KJB A;  1VQ9 I;  1FC3 A;  2R7K A;  2AHQ A;  2NAZ A;  1XN7 A;  4EAT A;  1MNE A;  2W9B B;  4UN9 A;  2R8G A;  3DEE A;  1Z2O X;  4HLX A;  3KZI C;  1RKT A;  3A2K A;  5KFU A;  5CA0 F;  5AIP A;  2W4S A;  3CUO A;  1KU7 A;  4GKJ H;  1QO0 D;  1LEA A;  2WYO A;  4XOR A;  4JI3 H;  3NEU A;  4KMU X;  3JRI A;  1ZR2 A;  5A74 A;  2QSF X;  4HF2 A;  4E7S A;  2AS5 F;  3BTL A;  5C5J A;  4AQX A;  1E4G T;  1IO2 A;  1XMA A;  1WR2 A;  2V1N A;  4Y33 A;  3RF2 A;  4C9Y A;  2W6Q A;  2UZK A;  3R5F A;  5FPR A;  2FK1 A;  3AL0 C;  3GFI A;  4MO7 A;  1TZL A;  2BYV E;  4O4H F;  4AVP A;  3S1M J;  3SHF A;  3DTK A;  2NVX A;  1IBM H;  3L2U A;  2ZJ2 A;  4MA5 A;  2FEZ A;  3E6D A;  2M7B A;  4XN3 A;  1IDZ A;  3G6V A;  2KDO A;  3TO6 A;  4M3E A;  5F9L A;  4E7Z A;  2ID3 A;  2JA6 A;  3HOT A;  1YQA A;  1LB2 A;  3SZT A; 
#chains in the Genus database with same CATH homology
 1QHG A;  2WAE A;  4AAE A;  4R79 A;  3OYI A;  2CV2 A;  3EUH C;  4B3S H;  2L8L A;  3KO2 A;  4K0K H;  3CMM A;  4CCO A;  4HEA 2;  1Z3X A;  2ZFU A;  1HA8 A;  4X66 H;  5JHF A;  3RTR A;  3PSF A;  4PK4 A;  5A0W A;  3L4J A;  2IGK A;  3OS2 A;  4R7R A;  3HXL A;  3DKY A;  2IGN A;  4D9J A;  5FLX W;  2Z16 A;  4Y4R A;  4IAJ A;  4F92 B;  4ZDP A;  4II3 A;  3OOU A;  3OYA A;  2VBO B;  3JSL A;  3OIP A;  2Q2U A;  4M7E A;  2KEQ A;  3OL4 A;  3S3O A;  2KMU A;  3OYJ A;  3HYI A;  4JOM A;  4RAZ A;  2XE0 A;  1PJR A;  4XL9 A;  3DF7 A;  3BG6 A;  2VJI A;  5KCM A;  4Z1Z A;  4AAG A;  4Z1X A;  2VBJ A;  4B43 A;  4EFJ A;  1SYX B;  3K4C A;  4RAY A;  4N4N B;  4E2U A;  4D6O A;  1ZDE A;  2HVR A;  2IGM A;  1O75 A;  4MV9 A;  1E4F T;  4XKC A;  4DR2 H;  4OZ6 A;  3C2G A;  5HNF A;  3HPG A;  2CFO A;  2K3P A;  2LBF B;  3ZR8 X;  3EPZ A;  4CA0 A;  1NG6 A;  4BE2 A;  4IKF A;  4LF5 H;  2CV1 A;  1SEI A;  4DUY H;  3OWT A;  2IS4 A;  4CZC A;  1T0F C;  2R7S A;  3UNG C;  1U0D A;  4YY3 H;  2DJI A;  3SEQ A;  1FJG H;  4RLQ A;  2WDT A;  1J5E H;  1BGW A;  4CCN A;  3OYD A;  5CPR B;  3K4M A;  4ANJ A;  2E5L H;  4PFO A;  2WB1 A;  4BXF A;  4RB1 A;  1DGR M;  5E67 A;  2AQF A;  2JVG A;  3NZM A;  3RGX A;  2DCE A;  2IMZ A;  1X1D A;  4C2U A;  1N34 H;  3RCO A;  4KL6 A;  3UVF A;  2F5V A;  1Z2P X;  1BR2 A;  2WBM A;  2VIX A;  2XF6 A;  4XLC A;  4CUG A;  1UM2 A;  1Z2N X;  2HZD A;  4HPQ A;  3FBI B;  4LG3 A;  3LML A;  1MMN A;  1S68 A;  3PSI A;  4LIV A;  1QU3 A;  5CQE A;  4FET A;  2UWM A;  1AF5 A;  5D1O B;  3PL8 A;  2X1C A;  4BE1 A;  1X19 A;  2RNG A;  2QKL B;  3MX9 A;  2R7W A;  4DUZ H;  2JSP A;  4LIU A;  4BEH A;  3H5N A;  4JI5 H;  4LFC H;  4RLF A;  4AU7 A;  3U21 A;  2IS6 A;  2XE0 B;  2MCT A;  3K4L A;  2IS2 A;  4UT0 A;  4AVZ A;  4FAS D;  5HVQ C;  4F52 A;  1VS0 A;  3VYS B;  3TL4 X;  2HVS A;  1WJD A;  4JI6 H;  2HPI A;  3E0J B;  4EFE A;  2DT6 A;  3H35 A;  3LSH A;  4U87 A;  3H20 A;  2E5N A;  4LF6 H;  4OX9 H;  1FKA H;  3E1S A;  3R7P A;  2O7M A;  1MZB A;  4BGD A;  4D6N A;  1IRX A;  3MKW B;  3K6G A;  3FD2 A;  2Z2S B;  2UUA H;  4LFA H;  1ZD7 A;  2UU9 H;  3KAK A;  1AA7 A;  2M0M A;  4YEL A;  4NC7 A;  2M3A A;  4IZZ A;  3OY9 A;  4O1R A;  1FVI A;  1IBK H;  2WE6 A;  2ZJT A;  2K5C A;  4F91 B;  3H9G A;  4ZTF A;  1Y6I A;  2LWY A;  2Q2T A;  1WJE A;  4AAB A;  2JVH A;  4P5O A;  1N3F A;  2R4G A;  5CKT A;  1G9Z A;  1MOW A;  3VYT B;  1D1C A;  5AKN A;  1I94 H;  1SFK A;  4P1W A;  3A1Y A;  3K70 D;  2F4V H;  4DR6 H;  4GIG A;  1X1C A;  3DLA A;  1AM2 A;  2NOJ B;  4A2B A;  1DGW Y;  1DFA A;  4DV0 H;  2LY2 A;  1S9H A;  3L2W A;  3N6X A;  2VBL A;  2O5R A;  4NC8 A;  5BR8 H;  2KRC A;  1X1A A;  2ZSI B;  3NWT A;  3SEZ A;  1LKX A;  3L4K A;  4B3R H;  2ELJ A;  3VWB A;  4CCL A;  2KQR A;  2X85 A;  1G59 A;  4B3M H;  3M1C A;  3M4I A;  2IGO A;  3ZRG A;  5CQG A;  2QKM B;  2VQL A;  2R7R A;  5E63 A;  3QYF A;  4LOX A;  2ZSH B;  4NQW B;  2YCH A;  3OYH A;  1K6Y A;  3MKZ A;  3QQY A;  4LSX A;  1XMQ H;  1OR7 C;  4IQ4 A;  3QYE A;  4F93 B;  3IGD A;  2VB6 A;  4J00 A;  2XDV A;  3HPH A;  3VYU B;  2AB5 A;  4BU2 A;  3J7A Y;  1U0C A;  1XNQ H;  4E7L A;  4C30 A;  3KYL A;  2MC4 A;  3MWM A;  2CW7 A;  3G2B A;  3I9V 2;  4HSR A;  4RM3 A;  4QPQ A;  4CH7 A;  2X1E A;  4XOT A;  2I3Q A;  3DTI A;  5A2Q W;  4MTD A;  4YHX A;  1FMV A;  1Z3Y A;  3DKX A;  3DWL E;  1L2Z A;  2VBN A;  2R7V A;  2UUZ A;  3S3N A;  3IG0 A;  3L2Q A;  2UUC H;  4IQJ A;  4OAY A;  3DTE A;  2IN8 A;  4JI1 H;  1N32 H;  3M8J A;  4BQQ A;  4PSX A;  4RMN A;  3TBI A;  2KSW A;  4YIS A;  4UN7 G;  4XM3 A;  3C0W A;  2MAB A;  1Y56 A;  4BDY A;  2LC2 A;  4LSA A;  3CJQ B;  2E1M B;  3VSK A;  3LL7 A;  5E5S A;  3SDB A;  2L7K A;  2A6T A;  4DBR A;  4UCV A;  3RIZ A;  1BP7 A;  3OR1 C;  3HOS A;  2BVM A;  4E7J A;  1MW7 A;  2HVQ A;  4UNC A;  1UEL B;  2BW3 B;  2GOM A;  4NUB A;  2V26 A;  2VL8 A;  4XQF A;  2KRH A;  4UCU A;  3J80 W;  3H0D A;  2AQE A;  2WAF A;  1D1B A;  2IN9 A;  4PJM A;  1A0I A;  2QOJ Z;  5EOY A;  1SAU A;  3FHN A;  3OS1 A;  1LWT A;  3NWS A;  3N05 A;  3AKZ A;  3K70 C;  4Z20 A;  3N43 B;  1Z7L A;  4XR6 A;  1P8K Z;  3DU6 A;  1VZ0 A;  2KP6 A;  3RGZ A;  3N40 P;  1FMW A;  3OL3 A;  5IWA H;  1UG0 A;  2VS7 A;  2CUJ A;  2ZXI A;  4LH7 A;  4LFB H;  3MXB A;  4CC6 A;  2PMZ A;  5LD2 C;  5A0M A;  3OYG A;  2Y0S A;  4B3X A;  3S32 A;  2W7N A;  2E1M C;  3CJR B;  2VLA A;  2VXD A;  3W2V A;  3C0X A;  4UNB A;  1MMA A;  4KIT B;  1GYF A;  4XKB A;  1MND A;  4KHP H;  1ZHQ A;  1V5F A;  1LWS A;  1LDK B;  3MMY B;  4EEQ A;  2UV1 A;  3EH8 A;  2LG4 A;  3ZCO A;  3OTO H;  5HOO A;  4DV3 H;  2CS3 A;  3PNY A;  3D5L A;  2VKH A;  4YIT A;  1HNZ H;  2VAS A;  2DOA A;  3K10 A;  3HUG B;  3IAM 2;  4BJ6 C;  5HNH A;  3RTX A;  2R7T A;  1R6R A;  2LYC A;  3KAJ A;  4N4O B;  4BQO A;  2CUZ A;  4MLO A;  4RM2 A;  4CCK A;  5KHD A;  2VPL A;  2VBN B;  4PDB A;  2CW8 A;  3H9Q A;  4OWR B;  3W3C A;  4UFZ A;  3BA8 A;  4UN9 G;  2V4J C;  3HC7 A;  4E2T A;  2UXB H;  2VJJ A;  1X4P A;  3RPU D;  2R7X A;  1BOB A;  5AKM A;  2RQQ A;  3EUK L;  1AN7 A;  2F6C A;  5LMU H;  4E4H A;  2WA0 A;  4Y3O A;  2IN0 A;  2X1D A;  2VBJ B;  4Q0Y A;  5IT9 W;  4UN8 G;  3UQ8 A;  5FPO A;  5HLT A;  1ZEL A;  2VJ4 A;  3BC8 A;  2WY8 Q;  4XMY A;  4YEJ A;  4BL0 B;  2EX5 A;  3RQ4 A;  4JQF A;  1HNW H;  3L2P A;  3J7A K;  3GBG A;  4DR3 H;  3BAB A;  2W82 A;  1XMO H;  4JI7 H;  4UCO A;  4ZYA A;  4EFB A;  3KX2 A;  3OMY A;  4IX7 A;  2E60 A;  4X0G A;  4AQU A;  4HNT A;  2ZXH A;  3DPT A;  4XLA A;  4ZJZ A;  3S3M A;  4RB0 A;  3SYT A;  2FE3 A;  4GRI A;  4APM A;  2OWO A;  2DXI A;  4DIQ A;  1N3E A;  4YHH H;  4PJJ A;  4XNF A;  3RJ0 A;  5D1P A;  2Q1Z B;  3SZG A;  3IP4 B;  3MXB B;  1V5G A;  2VBO A;  1WH2 A;  3AL0 B;  5FRM A;  5A0M B;  2R7O A;  2VQE H;  4JI4 H;  5LFA A;  1WJF A;  2Z1D A;  4AAF A;  2F4I A;  1EA3 A;  3OYK A;  4UNA A;  4E7I A;  3QYB A;  1XDN A;  3FMA A;  4XN0 A;  3BAA A;  3KXY T;  4I7H A;  4PSW A;  2HHH H;  4X65 H;  2VJ5 A;  2DCH X;  2VOB A;  2HPM A;  1YX5 A;  3DU5 A;  2K9M A;  4A2A A;  3KEY A;  4O1S A;  2UXC H;  1B04 A;  4BE0 A;  1BR1 A;  2X51 A;  2WAQ A;  1DQ3 A;  4KJZ A;  3CVZ A;  1AT0 A;  3E54 A;  2I3P A;  4PJL A;  3RSN A;  4DGW B;  4BJT A;  4BDZ A;  2HU9 A;  1TAE A;  4LF9 H;  4U7B A;  3K3V A;  1T9I A;  3CZ6 A;  4DR4 H;  3T1H H;  1J09 A;  3DPU A;  3PFY A;  3IUO A;  5KNL A;  1M0T A;  1XNR H;  4RZQ A;  3BCA A;  4PJN A;  2MYS A;  3I3L A;  2P0W A;  5LMN H;  1P8L A;  3W2A A;  3S8P A;  4J0M A;  3T1Y H;  2VKD A;  1D0X A;  4BEH B;  2LY1 A;  2FUG 2;  1G8X A;  4HRI A;  3BA9 A;  3FKJ A;  4ZDL A;  2L2O A;  4JYA H;  3EYY A;  3LMM A;  3OOL A;  2XF5 A;  3L2V A;  3IAS 2;  5E5O A;  1Z21 A;  3JSN A;  4FM9 A;  3ONQ A;  2LOO A;  2V6E A;  4AQY H;  1DQU A;  3AFH A;  4XOP A;  4MV7 A;  4XLH A;  1E0E A;  1G9Y A;  2Q2E B;  1X4O A;  3D5S C;  3BLY A;  1V5E A;  3H9J A;  4CSW A;  2KHM A;  1WJC A;  3TMO A;  2I8D A;  4DR5 H;  1MMD A;  3QOE A;  1HNX H;  2VXZ A;  3VSL A;  4MTE A;  2JUG A;  1WFX A;  3L2R A;  1UAA A;  1V9P A;  5A77 A;  3A4C A;  1X9N A;  4DV6 H;  3ZXS A;  3D5R C;  3IFJ A;  4AYB A;  4DBQ A;  4DOZ A;  4JI0 H;  2KLO A;  3OYL A;  2UXD H;  1YX3 A;  1WJA A;  1DP3 A;  1NG7 A;  4XON A;  4G6T B;  4DR1 H;  3OYN A;  5FD6 A;  3DPL C;  4RB2 C;  4DV4 H;  1OLT A;  3OYM A;  5D1O A;  3FDY A;  4B47 A;  2E5Z A;  2R7Q A;  2VS8 A;  3MIP A;  5LL6 b;  3PNT A;  4J01 A;  4DV7 H;  2M4K A;  2RGV A;  4XKV A;  2IS1 A;  4GLX A;  1EF0 A;  3MXA A;  2FLD A;  4B44 A;  2KPM A;  2W1O A;  2VQG A;  1M5X A;  2XC7 A;  2VBL B;  4B3T H;  4D1Q A;  4DR7 H;  1N78 A;  3C0F B;  3KAL A;  3K4K A;  3CF2 A;  1W36 D;  4DJA A;  2LRE A;  3OYB A;  4LF4 H;  2ZM6 H;  4E7K A;  4ZDO A;  5K08 A;  1GPP A;  4LQ0 A;  1TA8 A;  2VPS A;  2VQF H;  1R7M A;  2BOL A;  2MD0 A;  2XAU A;  3OYF A;  2X6W A;  1D1A A;  3C2H A;  2CMP A;  3EUA A;  1LFP A;  2UUB H;  1VDE A;  3DQV C;  1B24 A;  4UN7 A;  4AAD A;  1U0J A;  3W2W A;  5A78 A;  2O03 A;  3MD2 A;  1YE9 A;  2PJR A;  4BJ5 C;  3OYE A;  1IBL H;  2CH0 A;  2HDW A;  2X6Y A;  2L9S A;  3CP2 A;  3LFU A;  5TGT A;  4KIS A;  4JI2 H;  4DV1 H;  2VQH A;  4HNU A;  3F9K A;  2RRE A;  3OR2 C;  1N36 H;  3PNV A;  2V9K A;  4CCJ A;  2VUG A;  1BR4 A;  4UCT A;  4XKW A;  2W00 A;  1N77 A;  4C2T A;  4CC5 A;  4RB3 C;  1HR0 H;  2L9N A;  1ZHS A;  4NXM H;  4GKK H;  4XLF A;  4DV2 H;  4YRV A;  2WY7 Q;  3FBN B;  3N41 B;  2XIG A;  4CCM A;  4LH6 A;  4DV5 H;  2KZV A;  3LSK A;  2XF7 A;  3ZGK A;  3LSM A;  3LSI A;  4ZC3 A;  3HKZ A;  4F3Q A;  1ERD A;  4HG2 A;  1MI8 A;  4PFP A;  5A72 A;  2IXS A;  4BQN A;  1D0Y A;  1DGS A;  4JV5 H;  2GOX B;  4KL5 A;  2CV0 A;  4X64 H;  4H4K C;  4BWS C;  3S93 A;  3K4B A;  1BJT A;  5FRN A;  2A5W A;  1P9Q C;  3ZQQ A;  5AKF A;  3HYJ A;  2HNH A;  2MFZ A;  3LSG A;  3K4N A;  2HQA A;  3F8N A;  2OV7 A;  2WAD A;  3VDX A;  4BUP A;  4OAZ A;  3PJR A;  1T9J A;  2X6X A;  4ZTJ A;  1JI8 A;  3CES A;  4UCS A;  4KT6 A;  1KON A;  1I6U A;  3QOD A;  3OYC A;  3MIS A;  2HGS A;  4BAC A;  1GLN A;  4LIT A;  4PUS A;  3UR3 C;  4UCR A;  1N75 A;  3J81 W;  4X62 H;  4ITV A;  4NNJ A;  4LMY A;  1D0Z A;  1T95 A;  2M4G A;  4XLE A;  1W36 C;  3BCB A;  2JMZ A;  2JNQ A;  3BG7 A;  4EAT A;  1MNE A;  4II2 A;  5FRO A;  4E7H A;  4UN9 A;  3DEE A;  1Z2O X;  1X1B A;  3K4J A;  3N42 B;  3OOR A;  4F55 A;  3A2K A;  4JI8 H;  2W4S A;  3CP8 A;  4GKJ H;  4E6K G;  3V42 A;  2BVL A;  4XOR A;  2WYO A;  2DT7 B;  5FD5 A;  2PJR B;  2BW3 A;  1MMG A;  2KL4 A;  3HG9 A;  4JI3 H;  4UN8 A;  2LBF A;  2R7U A;  1QHH D;  5A74 A;  4NXN H;  1JVA A;  1LVK A;  4E7S A;  4LF7 H;  3PN1 A;  2K9L A;  4LF8 H;  2RGR A;  3OIQ A;  5I0A A;  5AK9 A;  4AQX A;  4BS9 A;  1E4G T;  2M7A A;  2V1N A;  2XSJ C;  3PUB A;  2LRD A;  4Y33 A;  4C9Y A;  2LCJ A;  3RF2 A;  5FPR A;  3AL0 C;  2V7F A;  2LQM A;  1TZL A;  1M0W A;  1N33 H;  1WJ5 A;  2OUM A;  2LH9 A;  3N44 B;  3DTK A;  4ETS A;  3OS0 A;  1IBM H;  3L2U A;  2M7B A;  4XN3 A;  3HL2 A;  3JAM W;  2KDO A;  3VYR B;  2L5Q A;  4B48 A;  4E7Z A;  3H5R A;  2OC6 A;  4HST A;  3HOT A;  2JA2 A;  3MKY B;  2W57 A;  2VQC A;  3H5A A;  1WJB A;  4QPO A;  1TT0 A;  1S03 G;  1PYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...