2CW7A

Crystal structure of intein homing endonuclease ii
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
537
structure length
537
Chain Sequence
b'SILPEEWLPVLEEGEVHFVRIGELIDRMMEENAGKVKREGETEVLEVSGLEVPSFNRRTNKAELKRVKALIRHDYSGKVYTIRLKSGRRIKITSGHSLFSVRNGELVEVTGDELKPGDLVAVPRRLELPERNHVLNLVELLLGTPEEETLDIVMTIPVKGKKNFFKGMLRTLRWIFGEEKRPRTARRYLRHLEDLGYVRLKKIGYEVLDWDSLKNYRRLYEALVENVRYNGNKREYLVEFNSIRDAVGIMPLKELKEWKIGTLNGFRMRKLIEVDESLAKLLGYYVSEGYARKQRNPKNGWSYSVKLYNEDPEVLDDMERLASRFFGKVRRGRNYVEIPKKIGYLLFENMCGVLAENKRIPEFVFTSPKGVRLAFLEGYFIGDGDVHPNKRLRLSTKSELLANQLVLLLNSVGVSAVKLGHDSGVYRVYINEELPFVKLDKKKNAYYSHVIPKEVLSEVFGKVFQKNVSPQTFRKMVEDGRLDPEKAQRLSWLIEGDVVLDRVESVDVEDYDGYVYDLSVEDNENFLVGFGLVYAHN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endonuclease PI-PkoII
publication title Crystal structure of intein homing endonuclease II encoded in DNA polymerase gene from hyperthermophilic archaeon Thermococcus kodakaraensis strain KOD1
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 160
structure length 537
sequence length 537
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2005-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14528 LAGLIDADG_3 LAGLIDADG-like domain
A PF14890 Intein_splicing Intein splicing domain
A PF18714 PI-TkoII_IV DNA polymerase II intein Domain IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1010 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2cw7A02
2.170.16.10 Mainly Beta Beta Complex Endonuclease - Pi-scei; Chain A, domain 1 Hedgehog/Intein (Hint) domain 2cw7A01
3.10.28.10 Alpha Beta Roll Endonuclease I-creI Homing endonucleases 2cw7A03
3.30.1490.210 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2cw7A04
4O1RA 4D6NA 2IN9A 1LWSA 1AM2A 2VBLB 1N3FA 1R7MA 4D6OA 1P8KZ 2IMZA 4YHXA 4KL6A 1UM2A 3MXBB 3OORA 2VBLA 1LWTA 2VBJA 4E2UA 1VDEA 4O1SA 3MX9A 3IFJA 3OOLA 1GPPA 4AQXA 5A77A 4UN9A 3C0XA 5AKNA 2L8LA 4LOXA 5AKMA 3QQYA 3MXBA 3HYJA 2CW8A 2I3PA 2VBJB 3KO2A 2VS7A 3EH8A 2VBOB 1DFAA 2LWYA 3E54A 4EFJA 1N3EA 4UN8G 1U0CA 4AAGA 2EX5A 2IN8A 1B24A 5E5OA 4UN7A 3MXAA 4UT0A 4UNBA 1M5XA 4UNAA 1AF5A 2LQMA 1AT0A 2VBOA 1ZDEA 4Z1ZA 2DCHX 2VS8A 3C0WA 2XE0B 2VBNA 5A74A 1G9ZA 2CW7A 1EF0A 4UN7G 2KEQA 4YISA 1T9JA 5I0AA 5A0MB 1ZD7A 4E2TA 4AQUA 2IN0A 3IGDA 3FD2A 4UNCA 5A0WA 1T9IA 4AADA 3HYIA 4UN9G 3UVFA 2LCJA 3MISA 2VBNB 2XE0A 2JNQA 1U0DA 1JVAA 5A0MA 5AKFA 5A72A 5E63A 4AAFA 4GIGA 5A78A 4KL5A 4LQ0A 4OZ6A 2QOJZ 3MIPA 4Z1XA 5E5SA 5E67A 1DQ3A 2I3QA 4Z20A 1BP7A 4YITA 4AABA 3NZMA 5AK9A 1G9YA 2O7MA 2FLDA 2JMZA 5K08A 3R7PA 2AB5A 4AAEA 4UN8A 1MOWA 1MI8A
chains in the Genus database with same CATH superfamily
4WXCA 3L1PA 1D0YA 2WY8Q 5IT9K 2BVMA 2V1NA 2C2EA 2DODA 3ABLH 4NC8A 5L3CA 4UXNA 5M3FJ 1QPMA 4EJWA 2PMZE 2IMZA 4KITB 4D5FA 3FKJA 3BA9A 2GQQA 4XKBA 2OJED 3DBLB 4DL6A 4CXFA 3IRQA 3G73A 1X9NA 4ED6A 3FM3A 3E1SA 1T94A 5L3BA 3OORA 4IR9A 2W57A 4HF2A 2OU2A 1IN4A 4D5CA 2QSHX 4UUVA 3OR1C 3DU6A 4HV6A 1HCRA 5KFBA 1BM9A 1BW5A 3G3ZA 5HV6A 4V19K 5KFWA 1E17A 2LLKA 2JUCA 2QBYB 1U6GA 4LD5A 3KYLA 4A3MG 2L4MA 3K6GA 3R5FA 4OIRF 5AKNA 1S0MA 2R5ZB 4J9NA 5KG6A 2QKLB 4XRMA 3T5LA 4YG2F 1DPUA 2CUZA 1B6AA 2CW8A 1S9HA 4XIDA 4RA2A 1TWFA 2V7FA 1YO5C 2ZBKA 3HOVG 3LSIA 1BI3A 2BVLA 4GYGA 1MDMA 1FP2A 1X1AA 2EFQA 2RF4A 3KYDB 1WHUA 2K02A 2BEOA 4GKKH 3OIQA 2LRDA 2LTPA 1H88C 1ON1A 1VQ5I 1SCUB 1C0WA 1FNNA 3MXAA 3DPUA 1IBMH 2OBPA 3A01B 3JAMZ 5KFYA 4DR3H 4TV9F 3PW4A 3PQKA 2X85A 4JP0A 4L9JA 4Q43A 1TWCJ 3UQ8A 2X1DA 4N4NB 4EM0B 1JIHA 4U0YA 1R36A 2L9RA 3IH3A 4Z1ZA 2NU6B 2WAFA 5KFSA 3P5JA 1MSFC 1B8IA 3COAC 2E34A 5I0AA 4CGZA 3S17J 5A0MB 2JA7A 4KT6A 4AQUA 2PFBA 2AQFA 1XGMA 3FD2A 5KT7A 2PLYA 4UVCA 1MH4A 2HTJA 5EG0B 4AADA 5GTHC 2XF7A 2VKDA 4A3KJ 5BPDA 5BPIA 2YR2A 3RYPA 5EDNA 3S32A 1XTAA 3EETA 2VONA 4P9FA 3IH2A 4GRIA 3WU1B 2CQNA 2DPUA 4ZI7F 4EJUA 4G6DA 1BIBA 3B02A 4A3IG 2DW4A 3OSGA 1UELB 1YJNI 2R7MA 5GAGJ 3ML6A 5HLTA 2WB1N 5A78A 3LMLA 4Q8FA 4DZPA 4LQ0A 2UUCH 4U0WA 3EQLF 3RQIA 5K2MA 2CQQA 3LFKA 3K3PA 3HKZA 2W7OA 1KJ8A 4XM3A 4B8XA 1CQJB 2COMA 2JMWA 2KISA 4HX7A 3HOWG 2DQLA 3WNZA 1AA7A 2R7FA 4MFDA 4J9LA 3CC7I 3MKYB 5E5SA 4MNUA 3KLOA 2R4GA 2Y9YA 2WE6A 1WH7A 2VKVA 2BBYA 4M6VA 3N4MA 5EOYA 3MD2A 5C8YF 3D5RC 1NK2P 5CPRB 3GTOJ 2LP0A 4DJAA 1VAJA 2DDAA 1YOVB 2O7OA 2W82A 1FP1D 3D0SA 4DBQA 2MFZA 4XICA 5DS9A 2OZUA 2ZXJA 5F0FA 4B4CA 5KG0A 2HHHH 2JA7G 4FE4A 1MI8A 2HXIA 1IN7A 1XDUA 1SFEA 4CYCB 3MWMA 2DFEA 2H09A 2HZTA 2F6CA 3M9AA 2X4HA 3OUUA 3SFIA 5D5VB 1I6XA 1IN5A 1IRXA 4XLFA 3I59A 3RPUA 2YRXA 2QSGX 5E3MA 5D5WB 5TRDA 2FU4A 4TQRA 2GOMA 5E1ZB 4CDGA 5CQGA 4MAMA 4IXAA 1HW1A 4FQGA 5E20A 4G12A 5H6QA 4L1KA 1GUUA 5EEGA 4X64H 3E5XA 1ZAOA 3K0LA 4ON0A 5B1BH 5FLXW 3TQTA 1XMOH 1L2ZA 3T8RA 2EILH 2TRTA 3PIPF 4ZC3A 1O75A 3I59B 4RM3A 1XS9A 3PO3J 2PN1A 4PGGA 5KAFC 4XSXF 1JGSA 3JRCA 1EV7A 4A3CJ 2FF4A 1MJ9A 3A2KA 4UB6C 2L7KA 3L09A 3M7GA 4RNNA 4GC6A 4CCKA 3CCEI 1V55H 1I6HJ 3WTTC 3J80Z 4XLPF 3HYJA 2RAEA 1TL8A 1Y8QB 4I02A 3GTJA 2RQQA 4Q8EA 2VPQA 2D1HA 1B59A 3CCVI 4A3DJ 5ICFA 2D2WA 1UZCA 3REOA 4MV6A 1I7LA 5EJCA 5F27A 3H35A 3I12A 3HOXG 2V4RA 1S97A 2DDBA 2DOFA 1SANA 2YS9A 4DYQA 5IP9J 1CGPA 3GTQA 4AAGA 2EX5A 4IHJF 2W9CB 4RB0A 1FX7A 2ICWG 5D1OB 3LWFA 2HJWA 1XCVA 4Y52J 2CO5A 5KG3A 4LF9H 4DR1H 1P7IA 2A05A 3MR3A 1TWGA 2XPUA 3TGNA 1ETKA 2QQAA 1AKHB 1HKQA 5TISC 4HRIA 3N40P 4DL7A 3VYTB 2EK5A 2L7MP 1JTYA 2W8KA 4DUYH 2I5UA 2FPIB 2CW7A 1K6OA 4Z2YA 2KEQA 5CLSA 1RJPA 1Q1HA 1XMQH 2VQHA 2P5KA 4G94A 2E5LH 2J6UA 2CQ7A 2X6OA 5E1XA 1R1TA 4DGWB 3RGXA 1FT9A 5DM7F 2O3FA 3OYMA 4TUYF 1UJ8A 4C2MA 1J9IA 4BDYA 2LVSA 2UVUA 5GTIC 3CC2I 3R6SA 5IYBJ 1ZYRF 1R1UA 3V4ZA 4A3JJ 4RBOA 2WB1A 1R23A 1EA3A 2GXGA 4ECQA 4OIOF 3PL8A 3CZ6A 3ETHA 1P4AA 3CVZA 2KZVA 5KCMA 1QVTA 3G6XA 1R4NB 1PUFB 1OFCX 2AXLA 4IOCF 4A0XA 4I0BA 4LF7H 1JXLA 4DV7H 3M1CA 3S14J 1X4PA 4P1WA 1WH2A 2V9VA 3L4KA 4XMYA 3MR5A 1S03G 1XN7A 4MV8A 3I4MG 3JSNA 1WCMG 2DAOA 1B4AA 2CGPA 4EEFG 4GDFA 3OUZA 1DDNA 4BJTA 4I0AA 4II2A 2L01A 4RGUA 4AC0A 2LKPA 1FMWA 3WTVC 4O3MA 2AGPA 1P9QC 2GM4A 1JE8A 3T5JA 4MA0A 1G9YA 2F4OB 2MD0A 4IL6C 3ZMUA 4BEHA 1X2MA 4FBTA 1IN8A 2FPGB 1YS6A 4EEQA 2E1NA 1Z3YA 4J00A 3HJEA 1ZELA 1J0RA 4P96A 4G7ZF 2FXAA 3IHUA 4II3A 2ZMEA 4E7HA 4E4TA 4HX4A 1LFUP 5EEAA 4ASNA 3BPVA 3MKWB 3FISA 1VBHA 3H0GA 1LE8B 3PIOF 2HOSA 4BXXG 3HRSA 2RDIA 1IXSB 3J81W 4O5VA 1ONVA 2A3SA 1LQ1A 1WJEA 1BI0A 2VBXA 3RF2A 3JRHA 2F4MB 4ANJA 1FLIA 4B3MH 1WJBA 1K79A 5FD5A 1HKSA 4UCOA 2AGQA 3QAHA 3GCMA 1XGOA 1W36C 5F0CA 4A0ZA 2JA5J 1OCPA 1K83J 4MV9A 2D1VA 3BR6A 3JW4A 4XOTA 1H89C 3CQZJ 3VPBA 3M9OB 4GYIA 5KFCA 2GIZA 2EBIA 2V26A 3Q9VA 3WTWC 3JSOA 5D6EA 3IL2A 5FKOA 5LL6b 4IPAA 4ED3A 3HC7A 3MZHA 5DGAA 1IW7F 3OHAA 3V6KA 3F6VA 2C35B 2VPLA 2ASJA 1TQIA 2XV4S 3DP7A 2HYGD 3PNVA 5KNLA 2O9LA 2IGOA 4NDLA 5K7FA 2VQDA 3WU0A 3IV5A 3J7AK 2TCTA 4HV5A 4IHXA 2PVPA 2ECBA 1R9TJ 2R7ZJ 1RK6A 2BQ3A 2PBZA 5LMNH 1IRFA 4BE2A 2HKOA 2KP6A 3H0GG 4JV1A 1T95A 1I50J 3HTSB 4UNBA 2Z1DA 1QNTA 2LQMA 2ASLA 3TW7A 4JI5H 4BQNA 2JSPA 3IKVA 1JKQC 5BMZA 1KJQA 4EGYA 3WGHA 3W3CA 2QCOA 1G2HA 2XE0B 4X62H 4JX5A 2I8CA 1G9ZA 2E35A 3KEOA 2ZNYA 2ZXIA 2L9NA 3U9SA 3PSIA 1LNWA 5F0HA 4E2TA 1FSEA 3RKQA 1I1GA 2O5RA 2DT5A 3PNYA 1T9IA 3I56I 2OA4A 2OLSA 4RGSA 4F52A 1G3YA 2K3PA 3GV5B 2IS1A 4DYCA 4M9SA 1A6QA 2DA2A 4RB2C 3OSNA 1WH5A 1RKTA 4NBQA 2R7DA 4GC7A 3RB0A 3A02A 2XGXA 4FT8A 2WA0A 1RUNA 4LFUA 3S2HJ 1JVAA 5L1LA 4YR3A 2VOBA 3MKZA 4KISA 2VT3A 3ZQHA 2XGEA 4E7JA 4UCUA 5KFTA 3GUDA 1SMYF 4QWCA 2CQYA 3DPLC 3JRAA 2P6SA 1HR0H 5DG9A 3ASNH 5J6XA 3A0HC 1VTNC 4F4XA 1XDSA 2IEKA 1B33N 1U78A 2R7KA 2VJ5A 5DGBA 2O6GE 3H4DA 3GTKJ 3G1MA 4A3GJ 2RQPA 2I3QA 2L3DA 5BOXA 1X3UA 4Z20A 2JVHA 2ZDGA 4XL9A 9ANTA 2QQ8A 3IKTA 3I4NG 5C1PA 3RV4A 3WO1A 1IJWC 3PFYA 3ZMVA 1WJ5A 3RB3A 2M1BA 1BJZA 1W93A 5IY5H 3HOYG 1OQYA 3F8NA 2HZDA 3O2PE 3T5HA 1J5EH 1G3TA 2V1XA 3JREA 2YU9J 3KEYA 3PR4A 3BDDA 2XAHA 3PJRA 1Y0NA 2NYXA 2CYYA 4MGRA 1J75A 2MABA 2H1KA 4KNYA 1O4XA 3OYBA 4ZQIA 2MBFA 3K70C 3VSLA 2VPSA 4F7ZA 4AYBE 1ZG5A 2NNYA 3PO2G 1T39A 5J3LA 3QYBA 1Z9CA 1JKOC 2E19A 4PCQA 2VBLA 2X1EA 4B09A 1FOWA 1YJWI 2KHMA 4RLFA 3ZQ7A 3MR2A 3OOLA 3HDDA 3F9KA 1UHSA 5LEKA 3JTGA 3I58A 4UN9A 4MA5A 1BIAA 3AG3H 4OINF 4EQQA 3CP8A 2OTJI 4CICA 4XN0A 3GZ6A 2L8LA 2JJ7A 3QWLA 3NGDA 4NLGA 3KZIC 2IT0A 1WZ2A 2EFNA 1U3EM 2FNPA 4DL2A 4PFPA 1ZRDA 1WSCA 1POGA 5K5RA 1AUXA 1TWCA 1HSJA 3QZ8A 3TBIA 2FNAA 4WK8F 2XAGA 5CAEB 3WODF 3E6CC 5AONA 2RC4A 3CD6I 1PX2A 5JLXA 4ZJZA 1X1CA 2JWTA 2ETHA 2B0LA 5LMUH 1TBXA 2J5PA 3BG3A 2QYOA 3HL2A 2P8TA 4L9NA 5JFRA 4IZOA 4OX9H 2A6EF 4LOCA 3DEUA 5DUKA 3I4PA 5KK1A 5KFUA 4YHHH 1LFBA 4LF5H 4LFAH 1O7FA 3ZQCA 4L5EA 3MWDA 3W2WA 2ASDA 2EINH 4FU0A 4BGDA 1DP7P 1IUYA 3HBLA 1UG0A 2XF6A 1YRNA 2HGSA 4D7NA 4A12A 1VBGA 5CVVA 1S5LC 5DUIA 5L3DA 4LSXA 2MLKA 5IYCJ 3GYHX 1N33H 1OCOH 2Y48A 3BG5A 3BZKA 4C30A 3MEXA 1MW7A 1BBYA 2I8DA 1KJJA 5BQTA 4UN9G 2BHYA 3PW5A 2LCJA 3A4CA 2UZKA 2UXDH 4PJJA 4A69C 1JKRC 2R82A 3RIZA 4EBCA 3PUFA 1PDNC 4R7RA 5IOYA 1LKXA 2CUJA 2YX7A 1EUCB 1VF9A 4ESBA 3Q9SA 3EYYA 2F4VH 4BHBA 5LGTA 3M07A 4A3FG 3FIWA 3ULQB 2FSWA 5FD6A 4GIGA 4NHJA 3GTOA 4QIWN 1VQKI 2W6MA 2XUBA 2BXYA 2J5OA 2DFIA 4DV2H 3KTMA 1SAXA 1GGOA 1T0FC 2JN6A 2WAQN 2M7BA 3WU2C 4Y8VB 1BC8C 1W36D 2B7EA 2E5NA 5E67A 1FBUA 3H5NA 5DCMA 4ENMA 5EZHA 2EZLA 4HYKA 5FLVA 1GXQA 2KQRA 3DKWA 3FXKA 2RKHA 5EGOB 1GSHA 4BBRJ 1DV2A 4A3KG 4JI4H 2LF7A 5M3MJ 1B6RA 3J81K 3GIDA 1ZARA 2DBBA 3ELKA 2AGOA 4IAJA 5KG2A 2LK2A 4ED8A 1WQ2A 1E3OC 3CESA 3DV8A 4X65H 1MOWA 4QIWE 2VT2A 2VKHA 2I10A 2VPRA 1PYVA 5FGMA 2X6YA 1IDZA 2WAQE 2HQ5A 2KFDA 4ZYAA 5KT5A 4YHXA 4F4WA 3PVXA 4G6TB 2C22A 4QWQA 3CCJI 5KT4A 1SMTA 2XAFA 1E4EA 3M9MB 1IZ1A 3CCYA 4X0GA 2CS3A 1H9TA 5HDKA 4B44A 4TQSA 2ZCWA 1RI7A 4BY1J 2BZTA 1K61A 1RC9A 4RS8A 1BI1A 2XGDA 1TLHB 2X1CA 1A6IA 5ERIA 3CCQI 4CCMA 2A5YB 2VC0A 2HDWA 3M4OJ 1S0OA 4Y3OA 1UHMA 4MQVA 1NG6A 4HBLA 4PJMA 2HYJA 2MH9A 2PEXA 2DMUA 2RNJA 5FFZA 4UHTA 2EV0A 3R0JA 5J40A 1LDKB 1QVUA 3L9FA 2OWOA 3ZQIA 4EFBA 2M87A 5HS7A 1YX3A 3CDHA 3KHLA 5B1AH 2HOEA 3T0YA 1BOAA 1XGNA 2DYSH 2JEIA 1SD4A 1B72B 4DLKA 3DF7A 2UXBH 3DF8A 2ZFUA 1A04A 1LUJB 3V6JA 3CF2A 4U7DA 4RAGA 3LL7A 3PO3G 2W84A 2MC3A 1VQ7I 2M45A 3FMQA 1XSDA 3GV7B 3IRRA 5FJ8J 3S16J 2VBOA 1Y39A 3Q1KA 1U5TB 3O6BB 3KE2A 4GCVA 1I7NA 2PMHA 1B9NA 1FIPA 3GLLA 2FMLA 4G3IA 1RRJA 5DEQA 2W71A 3LSMA 3ZQLA 3BPXA 5EZYF 4UN7G 4BU2A 1CF7A 2EZIA 2C2DA 4DIQA 4HQMA 1UB9A 3C0FB 4A3DG 1YFHA 3IC7A 5FPRA 1B1BA 3MZYA 5E18F 4LIVA 4P5OA 4A3EG 2HQRA 1FSHA 3A1YA 1IC8A 2VIXA 5IP9G 5DLFA 3OYLA 5EDWA 1XSXA 1USTA 2EJRA 4AIKA 4FX4A 1Y1WJ 2UUAH 4KMFA 3GBGA 2AHQA 1OJLA 1HBXG 1CF7B 5KHDA 3PW7A 5C4XJ 3QOPA 2IRFG 1HNWH 3Q8QB 3HOSA 1CQTA 3GMEA 6PAXA 2QZ8A 3RJPA 4QIWA 2XVCA 2E71A 1MBJA 3K70D 2WAQA 4U87A 2HFHA 1HLVA 4A93J 4C2TA 3DTEA 4J0MA 1TW2A 2Y0SN 5K7HA 4DV1H 1U5TC 2NAZA 2RDPA 1R5ID 4DV0H 1I5ZA 2F5VA 1JHHA 3HGGA 4HLYA 1S7AA 5J1YA 3TINA 5L9XA 2NNNA 3ORRA 3MJFA 4BE1A 4CH7A 5F9NA 1S29A 2IS2A 3AG1H 2AQ4A 3H9JA 4YIRX 3G6EI 1CQIB 2DTRA 4XNFA 3JSPA 4DYRA 4PJNA 4A3JG 2AB5A 1K1QA 4JYAH 1QPIA 3HOYJ 1OCZH 2WY7Q 2V4QA 4K0KH 4D6NA 3CO6C 2MSYA 2X9DA 4G6QA 4XRSA 1AM2A 2R92J 3HRTA 3DXJF 3OYAA 2JA5A 1T56A 1K83A 1O3RA 5E8IA 5I47A 4IHVA 2JQ7A 3CQZA 2Y0SE 3WGGA 2NU9B 1JT6A 3FWEA 1ZLKA 1A5JA 2JK3A 2LH9A 2W9BA 3IP4B 4TV7A 2Z33A 4PUSA 4DV4H 4FX0A 3BTLA 1TA8A 1ITYA 4EGQA 3HOZJ 3H4BA 1UMQA 4YAKB 3EUHA 5ILSA 4LFBH 3ESWB 1YW8A 4FETA 4C3HJ 1AHDP 2Q2UA 4EATA 1ZR4A 3MFKA 3HOTA 3G71I 1TP4A 2Z2SB 3TO9A 4KT5C 4J01A 3CLOA 3KAKA 2Y30A 5JVTA 2VE9A 1EYZA 3MR6A 4LLLA 3FZVA 1ETWA 5FROA 3L2UA 2K40A 1ODDA 1T08B 2FK1A 4LG3A 4A2AA 1D5YA 3GLXA 4V2GA 3FMAA 2CRGA 2ZO4A 1RR8C 1R9TA 1KYZA 2R7ZA 2ZDQA 3HEFA 4LLNA 4OOIA 3U21A 2R86A 1M6VA 1I50A 5HOOA 3LA2A 2LG4A 3BTIA 1LDDA 5CVIA 3R60A 1V3FA 4ZYGA 3I0TA 4KIFA 3GO5A 1F43A 4NC7A 2JPBA 2E2IJ 3JSLA 3CDLA 3DKXA 3HSFA 2QBYA 4BBSJ 1DIKA 5LOVF 4UV9A 1MJBA 3TOBA 2E7XA 4ZYHA 2IN8A 2BE5F 2R5ZA 4BNCA 1PK8A 4XRSG 4LSAA 2UXNA 1KEEA 3WE2A 2JA5G 1JJ6C 3E0JB 3FKIJ 2VJJA 1ZLJA 2RNGA 1X58A 2CUEA 5DD8A 4V2FA 4E4HA 3I54A 5KFFA 3P9CA 3LSKA 2DYRH 4PDBA 4F92B 1K4SA 4HG2A 2V79A 2D45A 3I64A 5F08A 2W6PA 2QGUA 3QU6A 3A01A 2R7SA 1HKTA 1SC7A 1SD6A 2BV6A 2E2HJ 1EH6A 3CC4I 2XC7A 4DW6A 1VKZA 1BW6A 2ADUA 4IF4A 3EUHC 1YS7A 4IX7A 3LSTA 3GQCA 1BJAA 1GXPA 1IF1A 2YX4A 5FLMJ 2EWNA 2HNHA 2R7ZG 2C2RA 3E3VA 3QPSA 3QYFA 4RM2A 1YE9A 2F5CA 2ZM6H 3D5SC 4ITVA 1N34H 2PG4A 4PSWA 1BR4A 4M3EA 4L9TA 3GTKA 2CUFA 3MAJA 4Y17A 2KT0A 4A3BJ 5A0MA 2KLOA 2HPIA 5EEHA 2NVYJ 2A6HF 3ISPA 4AAFA 1WPKA 2DZDA 2JEFA 2CMPA 5EG0A 4F4ZA 3DKYA 3QODA 4IRCA 2EPFA 4EFEA 1KGSA 5J2UF 4IRKA 1U8RA 2HS5A 3QPTA 3H1CA 3UFXB 4EG0A 4K2EA 3H3ZA 5KAIC 3E97A 4I01A 2R7UA 1FMVA 1ZRFA 4C5CA 2VB6A 2YU9A 4Y15A 2FOWA 2QUFA 5JI6A 3RI4A 1OR7C 2V4JC 4JBAA 1R00A 1S7OA 1KC7A 2R7QA 3BR3A 3H92A 3BP8A 4APMA 4JK1X 2FRHA 2O7MA 2E7WA 3BT9A 2MGQA 4MLOA 4FTHA 3G8CA 2EV6A 4YFNF 3H36A 2IGKA 2IBKA 3NRVA 3IAM2 4A5MA 4P9UA 4BAYA 4QTRA 3S3NA 4O1RA 1MIJA 2NVXA 1K6YA 1Z2PX 3CCUI 4G9YA 1JXSA 2PMZA 2UV1A 2XKOA 3KZZA 4LLGF 4OAYA 5IT9Z 2EA2A 3CUQB 2NVQJ 2ZJTA 3VFZA 4LF4H 1TNTA 1KU3A 3ZQQA 4ZYEA 1GDTA 4F93B 1OCRH 3TMOA 2DPIA 1P4WA 3MN2A 4A3GG 1XDNA 4A2BA 2HVQA 2UXXA 2R5YB 1IUFA 3EDPA 2R3SA 3V4GA 4CYCA 3TEDA 1EJ9A 4I4TF 2FJZA 4HDUA 4GXOA 4IKFA 4LIUA 1S72I 1LEBA 1ZETA 3EUKL 2CV1A 2QSFX 3WO0A 4O3PA 1Y8RB 3EPZA 4HQ6A 2VLAA 1PUEE 3R5XA 1TAEA 3FXOA 2R7NA 4Y33A 2BR0A 2W85A 3R61A 4L0ZB 1LEAA 1ETVA 2VASA 4KMUX 4DR4H 3BJAA 2MYSA 1ON2A 1QHGA 2ELKA 2R7TA 4BACA 1HSTA 1MD0A 3FDYA 4ESFA 4BQAA 1TZLA 5KFQA 2C6YA 2LOOA 2VQEH 4AWXB 3CUQC 2Y0MA 2AS5F 4YBZB 1X1BA 2VI6A 3K5HA 5GONF 4JV0A 5IP7J 2B9SA 4RNMA 1V51A 1AF5A 2RDJA 3S8PA 2R8HA 2FBIA 1JDBB 2EQRA 1VI0A 3I9V2 2IJLA 1WWXA 3JRIA 3BZCA 2DTZA 2IP2A 3K4LA 4AM3A 5BPHA 3BLYA 2W9CA 5AIQA 5D1OA 5BR8H 1L0OC 1OYWA 1WJAA 2W7PA 4RZQA 1Z21A 2NOGA 4RUCA 4ZZLA 1MSEC 2UVRA 3C3WA 4A3EJ 1M7JA 4FS2A 4ECWA 3QYEA 1AKHA 2J9GA 4YP3A 2PBIA 3LSHA 1IOVA 2YCHA 3QU3A 3F72A 4DQ2A 4DOZA 3GFIA 1X2NA 2M4KA 4AQYH 3SJMA 1S10A 5J8CA 2GAUA 2X6XA 5A2QW 3K9TA 2HOTA 4EGZA 1WCMA 1E4GT 3M9NB 2RV8A 4AD9A 3M8FA 5DG8A 2XGQA 1FVIA 2CQKA 4EJTA 4NXNH 5HNHA 2DJNA 1FYMA 4Q47A 1OWTA 4JI7H 2BHZA 5L1IA 2UVWA 4IHTA 3SZPA 2D5VA 3GFMA 1U8BA 1MJAA 2VOOA 5IYCG 1YQAA 4I50F 3HPGA 2FQ4A 4IWYA 1G6NA 3FHNA 5FPOA 2C28A 1PUFA 3DWLE 3J7AY 4BXFA 3GTLJ 2W4SA 1ZQ3P 1TTYA 1XC5A 3HHGA 2W24A 1IN6A 1N75A 5FB2A 4ECSA 4UN8A 4DV5H 3FXMA 2H8WA 4M6XA 5GP9A 3MWEA 2DMPA 3K1MA 4LG0B 3QPHA 1GO3E 4BQQA 3K4CA 4NUBA 5KG7A 4BQOA 4C5BA 2XIGA 4IVNA 1LVKA 4HZFA 2PQ8A 3H3VH 3L4JA 1AUVA 2YSRA 2A61A 1OYYA 1TWAJ 2E60A 1D5VA 2Q8KA 1QRYA 4WCGA 1QHHD 5KG1A 4BBRG 2XKPA 1I94H 3WGIA 3OL4A 2IPQX 1LE8A 2P7VB 2LMDA 4A3LJ 3DEWA 2OZ6A 4HNTA 2VQCA 1G3SA 5JUMA 2K27A 2KSWA 3M4IA 3GXOA 3FBNB 1HNXH 1YW9A 1V9PA 1PP7U 4GKJH 4EBDA 5CA1F 5AKMA 2OV7A 1SFOJ 4LGWA 1R5GA 3CMYA 4M9XA 1QA6A 1S3JA 1S7EA 2FA5A 3DEEA 4JX6A 5DYMA 3IAS2 5E1WA 5ED4A 3N41B 4AVPA 2XAQA 1IG7A 3K4KA 1SFUA 4EJOA 2R87A 3ZMSA 2K9MA 5DM6F 4AIHA 4ETSA 2GA2A 1WR2A 1WI3A 4UN8G 2KIMA 4YAJB 3WTUC 4KHPH 2GIVA 4CCJA 3Q8SB 2KZGA 4UUSB 4ESJA 4EBEA 4LB5A 1S9FA 2LREA 5AIPA 1BL0A 1IXRC 2JA8J 1M5XA 3T5XA 4BY1G 4EMSA 4LF6H 2QQBA 1D8JA 1UC8A 2HQNA 3NWSA 4R79A 2ZXHA 1F1ZA 3BJYA 4XRFA 2CU7A 2KL4A 2YPRA 5F04A 3S93A 2Y9ZA 4ABZA 1Y1WA 4ED0A 3TDZC 1KA8A 4YISA 2AU0A 2MG4A 1T9JA 4UUTA 4KYWA 2OCCH 1XPXA 5F64A 3D1NI 5KG5A 4ZTFA 4F3QA 5M5YJ 3OYFA 3H5AA 1UC9A 4F91B 3UVFA 2E2JJ 3T1YH 1WSUA 1MNMC 1A35A 3RAQA 4E7SA 1XMKA 2N8GA 4E7LA 5D1PA 4Q44A 2XE0A 4QWEA 3GIPA 3H3UA 5E79C 4ZDLA 1K1SA 1GSAA 3TDUC 5HDNA 4O6JA 5EZGA 4X6AJ 1V4YA 4O2BF 4BWSC 2DK5A 2H6CA 3OOPA 5FJ8G 3RTRA 3A0BC 2IGMA 3LOCA 4DZJA 5CJ9A 4HAMA 1UCRA 2EB7A 3K7AJ 3LQRA 4LF8H 3AAFA 2DPDA 5KFJA 1IO2A 4R8UA 1D8KA 2GXAA 2W6NA 1WKMA 1IOWA 3BJ6A 1KZHA 2CV2A 4AU7A 1T6SA 3V7SA 1DQ3A 1MMNA 2RGRA 1TW3A 2DU9A 2WTEA 3HUGB 4UV8A 5DD4A 1YTYA 4OMZA 3FMSA 3NZMA 3N43B 1Y1WG 3K2AA 3GTGJ 1MMSA 2V5AA 2W6ZA 2YS6A 4R8UB 5L3EA 2JMZA 5C4XG 2V9KA 1NG7A 3JRDA 2F48A 2MD5A 3PSFA 5J8FA 1RUOA 5IYDJ 4YY3H 4PSXA 1XNQH 4MV1A 3LFUA 2XHKA 2EFOA 1FOKA 3ETJA 4PK4A 1G3WA 4D7MA 2VQGA 4PZJA 1MMAA 4A93G 4HF0A 2PMUA 1RNLA 1TWHA 3NWTA 3W6JB 2FK3A 5E8GA 3OS2A 3OYCA 1JGGA 4YIFA 1DUXC 4PJ0C 1M1EB 2VXDA 4AYBN 3MXBB 1EUDB 4EYHB 4FM9A 5KFIA 4ECYA 5FKLA 2HPMA 3EUAA 1W0TA 1HW2A 3RDIA 3OOUA 2VOPA 1AOYA 1LWTA 3BG7A 3GILA 3HTUA 5HS9A 1UAAA 2JA6J 5KFAA 2STWA 3OIOA 4BDZA 3ONQA 2VBYA 4MIMA 3DTIA 1N56A 2ATLA 2CZGA 4X66H 5FLXK 2FLPA 4BXUA 2R92G 2HGCA 2XAJA 2Y75A 4MEYF 3D5LA 4NQWB 4UVBA 2MA3A 3BR1A 1XCBA 3WHBA 3FKIA 4WBNF 4BYYA 2MCTA 1F5TA 2VS7A 2ALZA 2YRWA 3BROA 4EFJA 4ZTJA 2R0QC 1N3EA 4RB1A 2H6BA 3HOZG 3RJ0A 1IAWA 1ETXA 3JRWA 1W5CC 3JAMW 4Y4RA 2CV0A 1SEIA 1IRGA 2Q2EA 3K69A 1ORKA 1EHIA 1SVLA 3OS1A 2E2HA 3FK7A 3HRUA 2BGCA 3E5QA 4M3GA 5CQEA 1E0EA 1OYIA 3ZGKA 1IDYA 3BR5A 2P7CB 4GFBA 2DOEA 3MQ0A 4N0BA 2EV5A 3DFGA 4A3CG 4Y7NJ 1G4DA 5TJJA 2YZGA 1I3AA 2Q2EB 2WV0A 5CVRA 1R58A 1F36A 3Q0WA 4XLHA 2DQRA 4O4LF 1KU7A 1VQLI 1X3ZB 3IUOA 1J59A 1HA8A 2NVYA 1T0FA 5KFZA 3ZP5A 5LXTF 4BBSG 1FJLA 2L0KA 1Z1DA 3DBHB 3IWZA 4FHTA 3BABA 1FIAA 3V7CA 4F55A 4TV8F 4YJ2F 3KP5A 4JV2A 3HSEA 2ZNZA 5DG7A 2WC2A 3FXQA 3CLQA 5HLIA 3FKIG 4HNVA 3EYIA 1HW5A 3GFLA 5A72A 3KFWX 1HOMA 2M3AA 4O3OA 4I98B 5GAHJ 3O8GA 4XLCA 2LKXA 2FMAA 1X1DA 5CVJA 1J2XA 2P5VA 1QBJA 2NS0A 2QOJZ 4UNOA 2R7XA 3MIPA 3UR3C 3QZ7A 3CF5F 1W5SA 3V6HA 3S3OA 1WVRA 3CJTB 4Y13A 3EPGA 4ECXA 3VYUB 1LDJA 1USSA 1KU9A 3OWTA 3HIFA 4XZ3B 5KFHA 3GTMJ 5IT9W 3H5RA 4QW8A 2Z5UA 4CSWA 1QGPA 4RLQA 3RIRA 2NOJB 1B04A 1P8LA 4DBRA 5D6FA 5FLMG 3FM5A 3F8CA 4ECRA 4JI8H 2LBFB 3LSPA 1RJQA 2R93J 1SFKA 3HSRA 3HM5A 2ZSIB 2CFXA 2KIFA 2O03A 5HDGA 3T8TA 5DQHA 3ERMA 4A3BG 5L1KA 2VA2A 2IXSA 1LWSA 4A0YA 5EGOA 4F50A 4QSHA 5GAEJ 2VBWA 2HVRA 2FBKA 3C2BA 1E4FT 2VN2A 4UCSA 4KICA 2DA3A 2JTVA 3GZNB 2R85A 5EYRA 2V58A 4QWAA 2FJ1A 1SEUA 1HNZH 2XCLA 3RCOA 3ECHA 1DQUA 2GLTA 4AYBA 2V6EA 2DA4A 2DN0A 2R8JA 1IBLH 4ED1A 1S6LA 2OF7A 3HPHA 2DLNA 3S1QJ 3SQNA 1GV5A 1A31A 1A36A 3PNTA 2ME6A 2KJBA 1TNSA 2ID6A 3LSGA 1I39A 5J4VA 3NEUA 4HR7A 4O1SA 1ULZA 5K5QA 1EZ1A 1ERDA 2MC4A 4PFOA 1C3OA 1XD7A 4DR5H 3ZN0A 2JA2A 1U9OA 4I7HA 5L3FA 1YW7A 5E17F 5KKNB 3BC8A 4KUMA 2I3PA 2BOLA 4RB3C 3V42A 3BTCA 3PQJA 4NNJA 5HODA 5IT3A 5K5OA 4H4KC 4IHYA 5D8LB 4LITA 3E54A 3J80W 2R8IA 3KIOA 1ZTRA 2ZB9A 2XC9A 4MQ9F 1GHCA 1XG1A 2K3FA 2LF8A 4UN7A 1Q1VA 2I87A 2WBMA 4HOBA 4M9UA 3JCUC 5LD2C 4FCYA 2OD5A 2HI3A 2IW5A 3P9IA 3FXLA 4DV6H 2FD5A 3AG2H 1I3QJ 2XGPA 3W2VA 1H8AC 1WJFA 1OLTA 1B72A 4NXMH 1BC7C 3OIPA 4CZZA 2E1MB 1XX5A 2ZC2A 4ECTA 2IN0A 2QLZA 5LP6F 2PJRB 3M8EA 3HYIA 1U5TA 5B66C 3GW2A 3J7ZI 2YW2A 1AU7A 3MKLA 3FDSA 5C3EJ 3G2BA 5CVUA 2M5WA 3KP2A 2Q0OA 3ASOH 3QFFA 4XORA 2BW3B 2F2EA 1G8XA 2M2EA 3LA7A 1S8NA 4CCLA 5IP7G 1MNEA 3KX2A 5AKFA 4LH7A 3O3KA 3P7NA 4IEJA 3Q8PB 1I27A 4XN3A 3ZN1A 1T2KA 5DDGA 4D9JA 4AIJA 4IRHA 4EYIB 1JUMA 2G7HA 2K9SA 3V7RA 5HVQC 3CCSI 3GTLA 1WJCA 4R8HA 3TQNA 1MKMA 3K3VA 2XSJC 3E6MA 5DV5A 1QU3A 1FC3A 5FRNA 5F9LA 2FB9A 5DQIA 2VBZA 1X1PA 3B73A 2A5WA 4Z6YA 4A2UA 3KP3A 3FX3A 4LJZF 3ERED 4HF1A 2XF5A 1XMAA 2ZJPF 2Z3YA 2E1MC 3AG4H 4WXHA 4S04A 4XKVA 5K1YA 4ECZA 4B47A 1ZGWA 3KP4A 3BCBA 3BZ6A 5KFLA 4UCTA 2DMNA 3B6AA 2ZXWH 4J9RA 3J81Z 2H8RA 1TWAA 1FEXA 3CDIA 3F8MA 4BKXA 4NB5A 1P92A 2VUMJ 5KG4A 2W1OA 4W97A 4MV7A 3OMYA 2VC1A 3JTHA 2EFPA 5T14A 1WI9A 4CZCA 3G1LA 1P8KZ 5KVRA 1Z3XA 5LHHA 2NS7A 3P9KA 3WG9A 1V4RA 3R5HA 4O3RA 1T98A 5KFKA 2FK2A 1ACIA 2O8XA 4UB8C 2QWWA 3KYCB 1ETQA 2L7ZA 4JOMA 1F4KA 1SFOA 1ZR2A 2M7AA 2NUAB 2R7WA 1P7JA 3OTOH 2V9WA 3OYIA 4B3RH 2QEXI 1N77A 2DT6A 4O3SA 5A77A 5LGNA 4PDKA 2FKLA 4PJLA 5J1RA 3QQYA 4O3NA 2RREA 4XKWA 3RGZA 1D3YA 4M72A 5KFRA 1Z7UA 3H40A 3BG6A 3KO2A 4HNUA 1F9NA 4S0HB 5F1RA 1YG2A 2UVVA 2IGNA 1FKAH 2O0YA 1AWCA 2HOAA 3VB2A 5D5XB 1C30A 1RR7A 3KLNA 1BJTA 3R23A 3K1NA 3BQ2A 1O7LA 1W7PB 1U0CA 3JAMK 2AO9A 2VE8A 3SEQA 3WHCA 1ZGJA 5ILUA 4JQFA 4EJVA 2NVUB 1ZRCA 1NK3P 3U2RA 3HB9A 5HNFA 3M1EA 5H6RA 3WTSC 1SD7A 4KA4A 1RJRA 1N36H 2GWRA 2KMUA 4A3LG 4IZZA 3VEPA 2VODA 5KFGA 3K4JA 3V8KA 3X2QH 2EZKA 5LEJA 2R7RA 1PP8F 1VQ8I 1WJDA 3KPHA 4U0VA 5KFOA 1W5TA 4J9PA 2ECCA 3OYJA 2VS8A 3G6VA 3VYSB 5A74A 4M3DA 1REPC 2VUGA 4OMYA 4FS1A 4ME6A 2XCAA 2LKSA 2A68F 2ACJA 2GOXB 5E3OA 2GPSA 1O3SA 1GT0C 1HDPA 5JQWA 2KRHA 2K4BA 1ZK8A 2ZSHB 4UNCA 3JRXA 4UFZA 1EH7A 3SFZA 2VKEA 1TT0A 3VPCA 2ZFWA 1RK5A 3RB6A 2JZYA 1TQMA 2OAZA 2V1DA 3ABUA 1TC3C 3LAPA 2IP4A 1OR7A 2V6CA 1YX5A 3ZXSA 2CJJA 4U6PA 2JA8G 5LA6F 3H3VK 3O8HA 1KBLA 2OH2A 2DO7A 1GV2A 4M73A 1VQOI 2NU8B 2IVMA 1EH8A 2DA5A 2R7LA 3DLAA 3GEZA 5LYJF 3GTGA 3F6OA 3SDBA 1RYSA 4GO1A 3HKZE 1D0ZA 1KQ9A 3MMYB 1MBGA 4Z1XA 3RKYA 2ZJ2A 5BPFA 4O4HF 3NQOA 3E7LA 3R0AA 3R4KA 4ZOLF 5JVLA 3CCMI 1SAUA 4ZDOA 1Y1VJ 4YITA 4CO8A 1FTZA 1BXRA 5DLGA 3K10A 5FKNA 2DA6A 2X48A 3NARA 4R1HA 5AK9A 1YI2I 4CUGA 4IR1A 3PZPA 1RETA 1VFCA 2LR8A 4AAEA 4DUZH 2M8EA 3TP0A 2X0SA 1JDEA 2NS8A 2LSOA 4E6KG 2B63J 2QKMB 1IXCA 1R7MA 2EZHA 2HYFA 1KYWA 2Y0SA 4B3XA 2ELHA 3E6BA 3F8FA 2OC6A 3HGYA 2GBYA 3ZMZA 1DGSA 1WFXA 2DFHA 2UUBH 4E7ZA 2JA6A 1TQPA 5KFPA 3VPDA 3C18A 3KHHA 1R4MB 2VR1A 2XGCA 1J09A 3DLLF 1MZBA 2P0WA 4IQ4A 1I6UA 2DMTA 1W4MA 3C7JA 2VXZA 2VBJA 5D4RA 2QF7A 4XR6A 4E2UA 5EWGA 1SYXB 2VQFH 3CUQA 3CCLI 4M71A 2FLNA 2KPMA 1MDMB 4HEA2 1KJ9A 3J80K 1OMIA 5IYDG 2DA7A 3VODA 4EM2A 4LOXA 2WV1A 4WX9A 2FP4B 4J9KA 2R5YA 1JJ8C 4NC6A 1VQPI 3U9TA 3H9GA 1A9XA 3RBDA 2KRFA 2JUGA 2HVSA 2VBJB 5EWEA 2FPPB 3DCFA 1M0WA 2MH2A 2ZKZA 4U88A 5FKKA 2BY2A 3L2QA 5CB4F 4GLXA 4HLXA 1BR2A 4QPQA 4C3JJ 2LWYA 2E36A 2EIKH 2LYCA 2DA1A 1YHQI 1BA5A 3RUPA 1B24A 3BQZA 1B8IB 1KJIA 5HBRB 2WYOA 2W9AA 3Q0VA 1SFXA 5KT2A 2CKZB 2FEZA 4YIIA 4C2UA 3FK6A 2F5EA 2O61A 2JA6G 1MBEA 3GF2A 1ZN2A 4A3FJ 4LK1F 5LLQA 2YL2A 1GYFA 1XGSA 2JEGA 3G6YA 4DL5A 3PW0A 5IP6A 4ZYDA 3BG9A 4GGGA 3PFIA 3KCCA 3VYRB 2EH3A 5BS6A 1FYKA 5CA0F 5DCFA 1BN5A 3KP7A 3L00A 5GPAA 3KAJA 2P81A 1ZREA 3S15J 3Q2OA 1P2FA 3KALA 2RVCA 3H9QA 1UNNC 4LFCH 1NHAA 1V5GA 3CCRI 4FISA 3K4BA 5KT6A 1LB2A 3PN1A 1MBHA 3OS0A 4HQEA 1O3TA 3BWGA 2R7VA 1JTXA 4DR2H 4HYEA 4HPQA 4L9VA 4ED7A 4P55A 2WB1E 1FYLA 3BR2A 5KFDA 3HXLA 3GTMA 3N97A 5IOZA 3PW2A 3K2ZA 1HC8A 3WE3A 1BOBA 1R6RA 2R93A 3TIGA 2LDUA 3CP2A 1MBFA 1HF0A 5H20A 2YZNA 4CC6A 1Z2NX 2LY1A 3C1DA 2KDOA 2WADA 5LGUA 5J4YA 1GVDA 1HDDC 5KT3A 3E6DA 5CYVA 3J7YJ 3CMEI 3S1MJ 3S3MA 3V8JA 3V8LA 3LAJA 5D8DA 1XNRH 4BHPA 1QZEA 2G9WA 1JKJB 5DTDA 4B3SH 5KFVA 2LC2A 3ZQGA 4ZDPA 2CFOA 3RPQA 3QPLA 5HLHA 5C44J 1VQ4I 2NVTJ 3CMMA 4XYLB 1Z2OX 3QQAA 5B3SH 2EIJH 1Y6IA 2FQ3A 4BJ5C 3TO6A 4YELA 2KIQA 4FASD 4ZH4F 3RV3A 4BL0B 4LMYA 1OISA 1Y0UA 4E70A 1YLFA 3L7WA 5TGTA 2P6TA 1J5YA 3LQQA 4RGRA 1GVJA 4N9IA 4MEXF 3HOUG 4LG0A 1BR1A 2IS6A 5IYZF 2FX0A 5ICCA 1VDEA 3FF5A 1FZPB 3LP8A 3MX9A 4KN7X 4BHCA 3PR5B 4BY7G 2R93G 1GPPA 2XASA 2DOAA 3CMAI 3Q8RB 1D1BA 1VQNI 4BH9A 2W25A 3N6XA 4XLEA 3OV8A 1H0MA 4QW9A 4N4OB 4UCVA 4EM1A 3KXYT 2W6OA 3SI8A 4YFXF 2KDZA 1QZZA 2F4IA 2DIKA 4AIDA 3AKZA 3N8DA 1DGRM 5KFXA 1DFAA 2L5QA 2NXNB 3WTXC 1I3QA 1MMGA 1T38A 3GTPJ 1W7PD 3TO7A 1V5EA 4JUZA 1S0NA 2DT7B 1LVAA 4ECUA 2J6SA 4C5AA 3SYTA 2Y69H 3ZMTA 3ZPLA 1SVOA 2DCEA 3L2CA 1VQ6I 3H20A 2XPVA 3GV8B 3I53A 2DI3A 4Q4ZF 4RUAA 1FOYA 2X6WA 3E5UA 2EA4A 2DCHX 3C0WA 4KIGA 2VBNA 1YITI 4UUSA 5H80A 2EIMH 3I3LA 4A6EA 2EFWA 3H0DA 1STZA 2OCEA 3UNGC 1Z05A 2FMYA 4CCNA 3E5NA 4N9HA 3G1OA 1WRJA 4M3FA 4I99C 1APLC 1DPRA 5B5EC 2HDCA 4LK0F 2VBNB 3LSJA 2R6FA 2P0AA 3OSFA 3BCAA 1PVEA 2G7UA 2JVGA 4RU9A 1O57A 4PGHA 3HZJA 2QYZA 2ZDHA 2DJIA 3B6CA 3AYHB 2ISZA 4OWRB 2W00A 1HQCA 5GADJ 1MGTA 1XSVA 4JYKA 2IA0A 1FOXA 4XYMB 4OZ6A 2FOKA 1ZKGA 2CH0A 1LJ9A 1MH3A 3ZRGA 1KQ0A 4BEHB 1K7AA 2STTA 2FBHA 3PUBA 2VUMA 3N44B 2ZMEB 1X3WB 4ENJA 4KFCA 1BP7A 5J2TF 4AVZA 5ILVA 4IOAF 3MFHA 4AABA 2W7NA 2BY0A 5C3EG 1QZYA 2K9NA 2F5FA 2FLDA 1U0JA 2M8GX 3C2GA 4A3MJ 2R7OA 3KP6A 3M8JA 4UY8I 1FJGH 4B48A 2LD5A 4ZHQF 2E1OA 3I71A 4ECVA 3VOEA 1DGWY 3ROUA 4XX0B 1SVMA 1V5FA 3HUGA 1N3FA 1MBKA 1R22A 2M0MA 2O8KA 3OHBA 3W2AA 3TL4X 3DPTA 3OL3A 4X1EA 1SD5A 3HOVJ 3I55I 2M4GA 3CUOA 4RAZA 4EEYA 1UM2A 2R8GA 5FKMA 2E1CA 4L5JA 3CJNA 4JI3H 1JKPC 3K4MA 2K9LA 2H27A 2R92A 1FBSA 1Z91A 1R5HA 3HHHA 3SHFA 1CS0A 1D1CA 4ENNA 4MV3A 3U1DA 2ZMEC 2V59A 2FLLA 4KDPA 2CG4A 4E7IA 4QJFA 2DLLA 1GLNA 3K1PA 3C0XA 4MHGA 2VUMG 2LNBA 1BNCA 4FE7A 4JX4A 1OCTC 2YS7A 5EF6A 2KRCA 2LY2A 3RSNA 5JHUA 3MXBA 5L3GA 2FE3A 1E3PA 1JLLB 2PX9A 1R1VA 3FMRA 4RNOA 3RBEA 2H1LA 4U7BA 2JRTA 1ZGAA 5JVDF 1K4TA 3BQ1A 1AN7A 2ESHA 4HX8A 3TQ1A 1ETOA 5LFAA 4MV4A 3KZYA 2JEJA 1EKEA 2LY9A 4C3IJ 3BOQA 2VL8A 4AUXA 3JRBA 1A0IA 5E5OA 2UUZA 4NQWA 1TWFJ 3TP3A 1IRZA 3JR9A 4UNAA 4RZRA 3T1HH 2GPWA 4A3IJ 2RN7A 4C9YA 4XOPA 4Q5SF 5E3LA 2E2IA 2QM3A 3OYKA 3QOEA 3W6KB 2A69F 3GVAA 3CO7C 4U7CA 3GIIA 3NAUA 2DWCA 3MFIA 3L2RA 2AXTC 3DU5A 3HOWJ 3MVPA 2W6QA 5L1JA 1YYVA 1K78A 1MMDA 2F5DA 2L9VA 3LA3A 3Q5FA 5LRSA 4Q45A 3IGDA 3ZMDA 4IRGA 1IGNA 2ESNA 5A0WA 1CE8A 4MTEA 1XMXA 1X4OA 2KJCA 1O3QA 1QQIA 2YUSA 2LFBA 3MCZA 1LPQA 4L0YB 2XD4A 2R8KA 2YU3A 3GIJA 1VQMI 1K78B 1VZ0A 2A07F 1U0DA 4LX3A 2JA7J 4M9ZA 2ZJRF 2GZWA 2K7LA 3LSRA 4PWQA 3QRFF 3TW6A 3V4SA 2BQUA 1Y1VA 2Z99A 1YJ9I 4KIBA 3HG9A 4KL5A 4HSRA 4IWXA 1Z67A 2J6TA 2VA3A 1HXDA 2L2OA 4D0PA 5M5XJ 4YR0A 2MLGA 2DK8A 2H94A 2WWYA 3I5UA 1YIJI 5A2QK 3VSKA 2BQRA 2B63A 1GLVA 2K4JA 1W0UA 4O2AF 4YR2A 3Q3SA 1OCCH 3BJOA 4M74A 2NVXJ 4QWBA 4M7EA 3SZTA 3ORQA 2XROA 1ULYA 2IBDA 2BY3A 4A6DA 3LMMA 4QFQA 4M3BA 4B1RA 2XB5A 3RPUD 5LBQA 5K08A 2L54A 3KEQA 1Z0XA 2DXIA 4UCRA 1D1AA 3A03A 2BXZA 4JI1H 1J7KA 4WF2A 2VBLB 4J9MA 4LH6A 3BA8A 3MZ8A 4EVIA 2XSDC 4D6OA 2HQAA 4BJ6C 2IA6A 1ZG1A 1DU6A 4H0EA 2LBFA 5IPAA 3HOXJ 3GX4X 5HLGA 2TDXA 2IA1A 1T36A 3L2PA 2M9HA 3FBIB 1T8IA 5KFMA 2HXOA 4L5IA 3UKGA 2W48A 4DNCA 3OYEA 3HOUJ 1Y1VG 3Q0UA 3QP5A 3IN5A 2UU9H 5F1JA 3RAXA 2IAIA 1Z6TA 4BY7J 3RYRA 2QVOA 3RKWA 3ZCOA 5H2FC 4EV0A 4XK4A 1VQ9I 3GIMA 2XB0X 3FHZA 3IWFA 5J47A 2HEOA 4YB8B 4DL3A 2B63G 4XONA 1R71A 5FO5A 1Y56A 1G59A 2HU9A 3OR2C 1UHWA 4MFEA 2IS4A 4UVAA 1W1WE 5CKTA 5FLXZ 4D1QA 5LRRA 1D0XA 3EH8A 3OYNA 3TIIA 1KONA 3WTZA 3G4SI 3RZOJ 1JX4A 3AFHA 3CTAA 2BYVE 3WG7H 1YRNB 3RKXA 5HS8A 4IO9F 1BGWA 3IG0A 4YJ3F 1WGXA 4UT0A 1RYRA 2DPJA 3GTJJ 1BI2A 2DFFA 3ZQFA 3KHGA 4RMNA 5BNGA 2ME0A 4G8XA 2K85A 2L4AA 4XBFA 4ENKA 1QO0D 2ELJA 4HDVA 2XRNA 3F3XA 3FXUA 1H9GA 1NH3A 3DTKA 3LNQA 4RDUA 3VPRA 4J19A 1ZDEA 1B6SA 3GTQJ 1V54H 4CA0A 2A6TA 4J9SA 4E7KA 2JRMA 1I1SA 2M05A 3GIKA 4I55F 1S68A 1T33A 4J9OA 2Z9OA 3EPIA 4RAYA 3K4NA 3SE7A 3I4MJ 1Y14B 1TWGJ 1WCMJ 2OQGA 5J1UA 2XAUA 3RZDJ 4KZSA 3AL0B 4F4YA 3L2VA 5A2QZ 3JZIA 4YEJA 3WTYC 4IRIA 3F0CA 2K86A 2HDDA 4XKCA 2M30A 1VS0A 1GSOA 2IMWP 3TOAA 2JNQA 2DMQA 4ED2A 2Y2ZA 1OPCA 2X0LA 2WAEA 3ABKH 5DCMB 5LHIA 5JHFA 5KFEA 1FY7A 4M6YA 5JVGF 2OUMA 5E63A 3DQVC 3GFJA 1DV1A 1IV8A 2QA4I 2PJRA 1M0TA 2OQRA 4C2MJ 1JT0A 3FXJA 5GPCA 2I80A 2SCUB 2YYAA 3VMMA 1IBKH 4DR6H 2HKXA 4BXXJ 4QWDA 5D8KB 1NTCA 3RFCA 1X19A 4IJAA 3SXYA 1B9MA 1U9NA 2BW3A 4A5NA 4QPOA 4I6ZA 5KFNA 2ID3A 3LWBA 1N78A 1TT5B 4XSZF 2X51A 5ICEA 4DL4A 1N32H 1LFPA 5M5WJ 2VJIA 2CW0F 4JI2H 2L9SA 3GZ5A 3KHRA 4DR7H 4RGXA 3F8BA 2P5LC 2UXCH 1MNDA 1E2XA 1R7JA 4FBUA 3F21A 3BTJA 5JH7F 2CSOA 4OAZA 3U1KA 2E5ZA 4W1UA 1P4XA 1JHFA 2FUG2 5C4JJ 3AL0C 3OYDA 1RIOH 3S2DJ 3OYGA 1E4EB 3BR0A 2GLOA 1DU0A 5C1OA 2QK4A 2Q1ZB 3M3YJ 2NRAC 2PI0A 2IN9A 3ECOA 2K5CA 1ETYA 4EGJA 3JRGA 5F6FA 3QP6A 2VJ4A 1R49A 4O3QA 4HSTA 1JUSA 2NU7B 3SEZA 2M0CA 4WXDA 3F23A 4KL6A 4KJZA 1RESA 2JT1A 4JV5H 3OSPA 4L18B 1N25A 5FRMA 1T3NA 2L7FP 2MW8A 1Z6RA 2ISYA 3H0GJ 4YFKF 1FTTA 2Z16A 1VNDA 1YIOA 3CJQB 2HTSA 3IFJA 1P6RA 3OYHA 3F22A 4AQXA 3N05A 2HR3A 1ZH5A 3J7AO 5DQGA 1ZHFA 4IHWA 1ZQ7A 3GTPA 1JUPA 4HA8A 1N48A 5C44G 4BS9A 1U2WA 3HRMA 3GLKA 4CC5A 1L3LA 4Q0YA 2KKOA 3ZR8X 2OTLI 3ABMH 3VWBA 4XLNF 3GWZA 2Y31A 2XDVA 2VBOB 5D4SA 3K5IA 5KX5F 1Z7LA 2OPTA 4S05A 4G7HF 3U9GA 3T5KA 4IQJA 2V9PA 3RB4A 3FXRA 2GA1A 2CQXA 4YQWA 2XRLA 3OY9A 1PJRA 1RPWA 4HW0A 3DBRB 5JLWA 4I76A 1RKWA 3ABTA 4MTDA 3W6VA 2UWMA 2C00A 3GIQA 5IWAH 4B3TH 2HWVA 1AT0A 5JR3A 4I09A 4J9QA 2K9QA 1ZG3A 4CHUA 2W8LA 3ZOBA 2WDTA 3SZGA 2RGVA 1W7PA 1IV6A 1JI8A 2Q2TA 1FPQA 4I2OA 3SDGA 1EF0A 1UG2A 4BUPA 1FWZA 3S2WA 5FFXA 1ZD7A 3S1NJ 4G7OF 1KQ8A 4XQFA 3CJRB 4B43A 4CYDA 4JI6H 2G0EA 2AQEA 2CWEA 1ZHQA 2QQ9A 5ICGA 3MISA 4IHSA 4OU0A 2WTFA 5LHGA 3IH4A 4OIQF 3I4NJ 5IYBG 2BY1A 4XLAA 4O4IF 1FBQA 4B3AA 4MO7A 4LB6B 2JPCA 2PN6A 1Z77A 1RZ4A 4Q48A 3VDXA 4QLCU 4IRDA 5EWFA 1E3HA 3BAAA 2VQLA 1KU2A 4OIPF 3S1RJ 4CCOA 2IA2A 4RAFA 1ENHA 3KETA 2W70A 3BQYA 3T1BA 4WWCA 3BQ0A 3C2HA 2PMZN 3HKZN 4KN4X 1ZHSA 2PJPA 1W96A 2JSCA 2L02A 1XB4A 5D5UB 3JRFA 3L2WA 3PO2J 3N42B 2XCPA 2QENA 3RQ4A 1UFMA 5K7ZA 2YZMA 2XPWA 4YRVA 2P4WA 2R84A 2ZJQF 3RTXA 3PM1A 2M34A 4BE0A 2F4LA 2COBA 4DV3H 1OKRA 5E3NA 2GXBA 2V1UA 2W9BB 3R7PA 4WD3A 1TWHJ 3TKYA 4ZZDA 1EF4A 5C5JA 2KIUA 3BY6A 4JI0H 5BMVF 1DP3A
chains in the Genus database with same CATH topology
4PSXA 4ZDPA 2CFOA 1D0YA 2WY8Q 2BVMA 2V1NA 2VKHA 3CMMA 3LFUA 4NC8A 1PYVA 1Z2OX 2X6YA 4PK4A 2VQGA 2IMZA 1Y6IA 4ZYAA 4KITB 4YHXA 1MMAA 3FKJA 3BA9A 4BJ5C 4G6TB 4XKBA 4YELA 3NWTA 4FASD 4BL0B 4LMYA 3OS2A 5TGTA 3OYCA 4X0GA 1X9NA 2CS3A 3E1SA 2VXDA 3MXBB 3OORA 4FM9A 2W57A 4B44A 2HPMA 3EUAA 1LWTA 1BR1A 2IS6A 3OOUA 3BG7A 3OR1C 3DU6A 1VDEA 3MX9A 1UAAA 1GPPA 2X1CA 3KYLA 3K6GA 2DOAA 4CCMA 3ONQA 1D1BA 4BDZA 5AKNA 2HDWA 3DTIA 2QKLB 4Y3OA 3N6XA 4XLEA 4X66H 1NG6A 2CUZA 4N4OB 2CW8A 4NQWB 1S9HA 3D5LA 4PJMA 4UCVA 2V7FA 2MCTA 1LDKB 3LSIA 2VS7A 2F4IA 2OWOA 4EFBA 3AKZA 2BVLA 1DGRM 1X1AA 4GKKH 1DFAA 1YX3A 2L5QA 4ZTJA 4EFJA 1N3EA 3OIQA 4RB1A 2LRDA 1MMGA 3RJ0A 4Y4RA 3MXAA 3DPUA 2CV0A 1SEIA 1V5EA 2ZFUA 3DF7A 4DR3H 1IBMH 3CF2A 2DT7B 2UXBH 3OS1A 2X85A 3LL7A 3SYTA 5CQEA 1E0EA 3UQ8A 2X1DA 4N4NB 2DCEA 3ZGKA 2VBOA 3H20A 2X6WA 4Z1ZA 2WAFA 2DCHX 3C0WA 2VBNA 3LSMA 4UN7G 2Q2EB 4BU2A 3I3LA 5I0AA 4DIQA 3H0DA 5A0MB 4XLHA 4KT6A 4AQUA 3C0FB 3UNGC 3IUOA 1HA8A 5FPRA 2AQFA 4LIVA 4P5OA 3FD2A 4CCNA 3A1YA 4AADA 2VIXA 2XF7A 2VKDA 3OYLA 3BABA 2UUAH 4F55A 2VBNB 3S32A 3GBGA 3BCAA 4GRIA 2JVGA 5KHDA 1HNWH 3HOSA 2DJIA 5A72A 2M3AA 2W00A 4OWRB 1UELB 4XLCA 5HLTA 5A78A 1X1DA 3LMLA 4LQ0A 3K70D 2UUCH 2WAQA 4U87A 3HKZA 4OZ6A 4XM3A 2QOJZ 2R7XA 2CH0A 3MIPA 3UR3C 3ZRGA 4BEHB 4C2TA 3DTEA 1AA7A 4J0MA 3S3OA 4DV1H 3MKYB 5E5SA 3PUBA 3N44B 3VYUB 2R4GA 4DV0H 2F5VA 2WE6A 3OWTA 1BP7A 5IT9W 4BE1A 4AVZA 3H5RA 5EOYA 3MD2A 4CH7A 4CSWA 4RLQA 2W7NA 2IS2A 4AABA 2NOJB 3D5RC 3H9JA 5CPRB 4DBRA 1B04A 1P8LA 4XNFA 4DJAA 4JI8H 2LBFB 2FLDA 1U0JA 2W82A 1SFKA 2MFZA 4PJNA 3C2GA 4DBQA 2R7OA 2AB5A 3M8JA 2HHHH 2ZSIB 1FJGH 4B48A 2O03A 4JYAH 2WY7Q 1MI8A 4K0KH 4D6NA 1DGWY 2IXSA 1LWSA 3MWMA 1V5FA 1AM2A 1N3FA 2F6CA 2M0MA 3OYAA 2HVRA 1E4FT 4UCSA 3W2AA 3TL4X 3DPTA 1IRXA 3OL3A 4XLFA 1HNZH 2M4GA 2LH9A 3RCOA 1DQUA 3IP4B 4AYBA 2V6EA 2GOMA 1UM2A 4RAZA 5CQGA 4PUSA 4DV4H 1IBLH 1TA8A 3HPHA 4JI3H 3K4MA 2K9LA 4X64H 4LFBH 4FETA 1XMOH 5FLXW 2Q2UA 3PNTA 4EATA 3HOTA 1L2ZA 2Z2SB 3LSGA 1O75A 1D1CA 4ZC3A 4J01A 3KAKA 4RM3A 4O1SA 3A2KA 5FROA 2MC4A 4PFOA 3L2UA 2L7KA 4E7IA 1ERDA 4LG3A 4A2AA 1GLNA 4CCKA 4DR5H 3C0XA 2JA2A 3FMAA 4I7HA 2KRCA 2LY2A 3RSNA 3MXBA 3BC8A 3HYJA 2FE3A 3U21A 2I3PA 2BOLA 4RB3C 5HOOA 2LG4A 2RQQA 4B3SH 3V42A 4U7BA 4NNJA 4NC7A 4H4KC 1AN7A 3JSLA 3H35A 3DKXA 4LITA 5LFAA 3E54A 3J80W 2VL8A 4AAGA 2EX5A 2IN8A 4RB0A 5D1OB 1A0IA 5E5OA 2UUZA 4UN7A 4LSAA 4LF9H 4DR1H 2WBMA 4JI0H 3E0JB 4UNAA 5LD2C 3T1HH 2VJJA 2RNGA 4C9YA 4XOPA 4DV6H 4E4HA 3OYKA 3QOEA 4HRIA 3N40P 3VYTB 3LSKA 4PDBA 4F92B 3W2VA 4HG2A 4DUYH 1WJFA 1OLTA 2CW7A 3L2RA 3DU5A 2KEQA 4NXMH 3OIPA 2E1MB 2R7SA 1XMQH 1MMDA 2VQHA 2E5LH 2XC7A 2IN0A 3IGDA 3EUHC 4IX7A 4DGWB 3RGXA 2PJRB 5A0WA 4MTEA 3HYIA 1X4OA 3OYMA 4CC6A 4BDYA 3G2BA 2HNHA 4RM2A 3QYFA 2ZM6H 1YE9A 1N34H 3D5SC 4ITVA 4XORA 4PSWA 2BW3B 1U0DA 1G8XA 1BR4A 1VZ0A 4CCLA 1MNEA 2WB1A 3KX2A 5A0MA 1EA3A 5AKFA 4LH7A 2KLOA 2HPIA 3PL8A 3CZ6A 4XN3A 4AAFA 3CVZA 2KZVA 5KCMA 4D9JA 2CMPA 3HG9A 4KL5A 3DKYA 3QODA 4HSRA 4EFEA 4LF7H 5HVQC 4DV7H 2L2OA 3M1CA 1WJCA 1X4PA 4P1WA 1WH2A 3L4KA 4XMYA 2R7UA 3K3VA 2XSJC 1QU3A 1S03G 5FRNA 1FMVA 3VSKA 3JSNA 2VB6A 2A5WA 4BJTA 1OR7C 2V4JC 2XF5A 4II2A 4M7EA 1FMWA 2E1MC 1P9QC 2R7QA 4XKVA 4B47A 4APMA 3LMMA 1G9YA 2O7MA 2MD0A 3BCBA 4BEHA 3RPUD 5K08A 4UCTA 4MLOA 4EEQA 1Z3YA 2DXIA 2IGKA 4J00A 1ZELA 4UCRA 3IAM2 1D1AA 4II3A 3S3NA 4O1RA 2W1OA 4E7HA 4JI1H 1K6YA 1Z2PX 4MV7A 2VBLB 3OMYA 3MKWB 4LH6A 3BA8A 4D6OA 2PMZA 2UV1A 4OAYA 2ZJTA 4CZCA 1P8KZ 1Z3XA 2HQAA 4BJ6C 3J81W 4LF4H 2LBFA 3ZQQA 1WJEA 4F93B 3TMOA 3RF2A 4ANJA 1XDNA 4A2BA 1WJBA 2HVQA 3FBIB 5FD5A 4UCOA 3L2PA 4B3MH 4JOMA 3OYEA 1W36C 2M7AA 4OX9H 4IKFA 4LIUA 4MV9A 4XOTA 2UU9H 2R7WA 3EUKL 1XNQH 2CV1A 2V26A 3OTOH 3OYIA 3ZCOA 1N77A 4B3RH 2DT6A 3EPZA 5A77A 2VLAA 1TAEA 5LL6b 3HC7A 4Y33A 4PJLA 4XONA 3QQYA 1Y56A 2RREA 4XKWA 2VPLA 2VASA 1G59A 2HU9A 3OR2C 3RGZA 4DR4H 3PNVA 3BG6A 2IS4A 5KNLA 3KO2A 2MYSA 4HNUA 2IGOA 1QHGA 5CKTA 4D1QA 4BACA 2IGNA 2R7TA 1FKAH 3FDYA 1D0XA 3EH8A 3J7AK 3OYNA 1BJTA 1KONA 1TZLA 1U0CA 2LOOA 2VQEH 3SEQA 3AFHA 1X1BA 1BGWA 5LMNH 4JQFA 3IG0A 4BE2A 2KP6A 4UT0A 1T95A 5HNFA 1N36H 4UNBA 2KMUA 1AF5A 2Z1DA 4IZZA 4RMNA 2LQMA 3S8PA 3K4JA 4JI5H 4BQNA 2JSPA 2ELJA 3I9V2 2R7RA 1WJDA 3DTKA 1ZDEA 3K4LA 3W3CA 3OYJA 2VS8A 4CA0A 2A6TA 3VYSB 3BLYA 4E7KA 2XE0B 5A74A 4X62H 1G9ZA 5D1OA 5BR8H 1WJAA 2VUGA 2ZXIA 1S68A 2L9NA 3PSIA 4RZQA 1Z21A 2GOXB 3K4NA 4E2TA 4RAYA 2KRHA 2O5RA 2XAUA 2ZSHB 4UNCA 3PNYA 3AL0B 1T9IA 3QYEA 3L2VA 4UFZA 4YEJA 1TT0A 4F52A 2K3PA 3LSHA 2YCHA 4XKCA 2IS1A 1VS0A 3ZXSA 4DOZA 1YX5A 2JNQA 4RB2C 2M4KA 1JVAA 2WAEA 4AQYH 2WA0A 2X6XA 5A2QW 5JHFA 5E63A 2VOBA 3MKZA 2OUMA 4KISA 1E4GT 4E7JA 4UCUA 3DQVC 2PJRA 1M0TA 4DR6H 3DPLC 3DLAA 1FVIA 1IBKH 1HR0H 3SDBA 4NXNH 5HNHA 1D0ZA 3MMYB 1X19A 4Z1XA 2BW3A 2VJ5A 4QPOA 4JI7H 1N78A 2X51A 2I3QA 1N32H 1LFPA 4Z20A 2JVHA 3HPGA 1SAUA 2VJIA 4XL9A 2L9SA 4ZDOA 4JI2H 4DR7H 2UXCH 3FHNA 5FPOA 4YITA 1MNDA 3DWLE 3K10A 3J7AY 4BXFA 5AK9A 2W4SA 4CUGA 4OAZA 3PFYA 1WJ5A 2E5ZA 2FUG2 3AL0C 3KXYT 4AAEA 1N75A 3OYDA 4DUZH 3OYGA 4UN8A 4DV5H 3F8NA 2HZDA 1J5EH 2Q1ZB 4E6KG 2IN9A 3KEYA 2K5CA 2QKMB 3PJRA 1R7MA 4BQQA 3K4CA 4NUBA 2Y0SA 4B3XA 2MABA 4BQOA 1DGSA 2XIGA 2OC6A 2VJ4A 3OYBA 1WFXA 2UUBH 1LVKA 4HSTA 4E7ZA 3SEZA 3K70C 3VSLA 4KL6A 2VPSA 3L4JA 2E60A 4KJZA 1J09A 4JV5H 1MZBA 2P0WA 4IQ4A 1I6UA 3QYBA 1QHHD 5FRMA 1I94H 2VXZA 2VBLA 2X1EA 3OL4A 2VBJA 2Z16A 4XR6A 4E2UA 1SYXB 2KHMA 2VQFH 3CJQB 4HNTA 2VQCA 4RLFA 3IFJA 2KPMA 3OYHA 3OOLA 4HEA2 3F9KA 3N05A 4AQXA 2KSWA 3M4IA 3FBNB 4UN9A 1HNXH 1V9PA 3JAMW 4GKJH 3CP8A 2L8LA 4LOXA 4XN0A 5AKMA 2OV7A 4BS9A 3H9GA 2JUGA 2HVSA 2VBJB 3DEEA 3N41B 4Q0YA 4CC5A 3IAS2 4PFPA 3ZR8X 3K4KA 1M0WA 3VWBA 2K9MA 3TBIA 3L2QA 2XDVA 2VBOB 4ETSA 1Z7LA 4GLXA 2LWYA 1BR2A 4QPQA 4UN8G 2LYCA 4IQJA 4ZJZA 1X1CA 4KHPH 4CCJA 1B24A 5LMUH 2LREA 2WYOA 3OY9A 1PJRA 3HL2A 1M5XA 2UWMA 5IWAH 4YHHH 4C2UA 4MTDA 4LF5H 4B3TH 4LF6H 3NWSA 4LFAH 4R79A 1AT0A 2ZXHA 2KL4A 1GYFA 3S93A 3SZGA 2WDTA 2RGVA 3W2WA 1JI8A 2Q2TA 4BGDA 1UG0A 2XF6A 2HGSA 1EF0A 4BUPA 3VYRB 4YISA 1T9JA 3KAJA 1ZD7A 4LSXA 4XQFA 1N33H 3CJRB 4B43A 4F3QA 4ZTFA 3KALA 4C30A 3H9QA 4JI6H 4LFCH 1MW7A 2I8DA 3OYFA 3H5AA 2AQEA 1V5GA 4F91B 4UN9G 2LCJA 3UVFA 3MISA 1ZHQA 3A4CA 3T1YH 3K4BA 4E7SA 4E7LA 4PJJA 5D1PA 3PN1A 2UXDH 3OS0A 2XE0A 2R7VA 4DR2H 3RIZA 4XLAA 4R7RA 4HPQA 4ZDLA 1LKXA 2CUJA 3EYYA 4BWSC 2F4VH 3HXLA 3VDXA 3RTRA 4GIGA 5FD6A 3BAAA 2VQLA 2IGMA 4CCOA 1BOBA 4DV2H 4LF8H 1R6RA 1T0FC 2M7BA 3C2HA 3CP2A 1W36D 2CV2A 2E5NA 5E67A 1ZHSA 1Z2NX 4AU7A 3L2WA 2LY1A 3H5NA 1DQ3A 1MMNA 3N42B 2KDOA 2RGRA 2WADA 3RQ4A 2KQRA 3HUGB 4YRVA 3NZMA 3N43B 4JI4H 3RTXA 4BE0A 4DV3H 4IAJA 2JMZA 3S3MA 3R7PA 2V9KA 1XNRH 1NG7A 4X65H 3CESA 3PSFA 1MOWA 4YY3H 1DP3A 2LC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O1R A;  4D6N A;  2IN9 A;  1LWS A;  1AM2 A;  2VBL B;  1N3F A;  1R7M A;  4D6O A;  1P8K Z;  2IMZ A;  4YHX A;  4KL6 A;  1UM2 A;  3MXB B;  3OOR A;  2VBL A;  1LWT A;  2VBJ A;  4E2U A;  1VDE A;  4O1S A;  3MX9 A;  3IFJ A;  3OOL A;  1GPP A;  4AQX A;  5A77 A;  4UN9 A;  3C0X A;  5AKN A;  2L8L A;  4LOX A;  5AKM A;  3QQY A;  3MXB A;  3HYJ A;  2CW8 A;  2I3P A;  2VBJ B;  3KO2 A;  2VS7 A;  3EH8 A;  2VBO B;  1DFA A;  2LWY A;  3E54 A;  4EFJ A;  1N3E A;  4UN8 G;  1U0C A;  4AAG A;  2EX5 A;  2IN8 A;  1B24 A;  5E5O A;  4UN7 A;  3MXA A;  4UT0 A;  4UNB A;  1M5X A;  4UNA A;  1AF5 A;  2LQM A;  1AT0 A;  2VBO A;  1ZDE A;  4Z1Z A;  2DCH X;  2VS8 A;  3C0W A;  2XE0 B;  2VBN A;  5A74 A;  1G9Z A;  2CW7 A;  1EF0 A;  4UN7 G;  2KEQ A;  4YIS A;  1T9J A;  5I0A A;  5A0M B;  1ZD7 A;  4E2T A;  4AQU A;  2IN0 A;  3IGD A;  3FD2 A;  4UNC A;  5A0W A;  1T9I A;  4AAD A;  3HYI A;  4UN9 G;  3UVF A;  2LCJ A;  3MIS A;  2VBN B;  2XE0 A;  2JNQ A;  1U0D A;  1JVA A;  5A0M A;  5AKF A;  5A72 A;  5E63 A;  4AAF A;  4GIG A;  5A78 A;  4KL5 A;  4LQ0 A;  4OZ6 A;  2QOJ Z;  3MIP A;  4Z1X A;  5E5S A;  5E67 A;  1DQ3 A;  2I3Q A;  4Z20 A;  1BP7 A;  4YIT A;  4AAB A;  3NZM A;  5AK9 A;  1G9Y A;  2O7M A;  2FLD A;  2JMZ A;  5K08 A;  3R7P A;  2AB5 A;  4AAE A;  4UN8 A;  1MOW A;  1MI8 A; 
#chains in the Genus database with same CATH topology
 4WXC A;  3L1P A;  1D0Y A;  2WY8 Q;  5IT9 K;  2BVM A;  2V1N A;  2C2E A;  2DOD A;  3ABL H;  4NC8 A;  5L3C A;  4UXN A;  5M3F J;  1QPM A;  4EJW A;  2PMZ E;  2IMZ A;  4KIT B;  4D5F A;  3FKJ A;  3BA9 A;  2GQQ A;  4XKB A;  2OJE D;  3DBL B;  4DL6 A;  4CXF A;  3IRQ A;  3G73 A;  1X9N A;  4ED6 A;  3FM3 A;  3E1S A;  1T94 A;  5L3B A;  3OOR A;  4IR9 A;  2W57 A;  4HF2 A;  2OU2 A;  1IN4 A;  4D5C A;  2QSH X;  4UUV A;  3OR1 C;  3DU6 A;  4HV6 A;  1HCR A;  5KFB A;  1BM9 A;  1BW5 A;  3G3Z A;  5HV6 A;  4V19 K;  5KFW A;  1E17 A;  2LLK A;  2JUC A;  2QBY B;  1U6G A;  4LD5 A;  3KYL A;  4A3M G;  2L4M A;  3K6G A;  3R5F A;  4OIR F;  5AKN A;  1S0M A;  2R5Z B;  4J9N A;  5KG6 A;  2QKL B;  4XRM A;  3T5L A;  4YG2 F;  1DPU A;  2CUZ A;  1B6A A;  2CW8 A;  1S9H A;  4XID A;  4RA2 A;  1TWF A;  2V7F A;  1YO5 C;  2ZBK A;  3HOV G;  3LSI A;  1BI3 A;  2BVL A;  4GYG A;  1MDM A;  1FP2 A;  1X1A A;  2EFQ A;  2RF4 A;  3KYD B;  1WHU A;  2K02 A;  2BEO A;  4GKK H;  3OIQ A;  2LRD A;  2LTP A;  1H88 C;  1ON1 A;  1VQ5 I;  1SCU B;  1C0W A;  1FNN A;  3MXA A;  3DPU A;  1IBM H;  2OBP A;  3A01 B;  3JAM Z;  5KFY A;  4DR3 H;  4TV9 F;  3PW4 A;  3PQK A;  2X85 A;  4JP0 A;  4L9J A;  4Q43 A;  1TWC J;  3UQ8 A;  2X1D A;  4N4N B;  4EM0 B;  1JIH A;  4U0Y A;  1R36 A;  2L9R A;  3IH3 A;  4Z1Z A;  2NU6 B;  2WAF A;  5KFS A;  3P5J A;  1MSF C;  1B8I A;  3COA C;  2E34 A;  5I0A A;  4CGZ A;  3S17 J;  5A0M B;  2JA7 A;  4KT6 A;  4AQU A;  2PFB A;  2AQF A;  1XGM A;  3FD2 A;  5KT7 A;  2PLY A;  4UVC A;  1MH4 A;  2HTJ A;  5EG0 B;  4AAD A;  5GTH C;  2XF7 A;  2VKD A;  4A3K J;  5BPD A;  5BPI A;  2YR2 A;  3RYP A;  5EDN A;  3S32 A;  1XTA A;  3EET A;  2VON A;  4P9F A;  3IH2 A;  4GRI A;  3WU1 B;  2CQN A;  2DPU A;  4ZI7 F;  4EJU A;  4G6D A;  1BIB A;  3B02 A;  4A3I G;  2DW4 A;  3OSG A;  1UEL B;  1YJN I;  2R7M A;  5GAG J;  3ML6 A;  5HLT A;  2WB1 N;  5A78 A;  3LML A;  4Q8F A;  4DZP A;  4LQ0 A;  2UUC H;  4U0W A;  3EQL F;  3RQI A;  5K2M A;  2CQQ A;  3LFK A;  3K3P A;  3HKZ A;  2W7O A;  1KJ8 A;  4XM3 A;  4B8X A;  1CQJ B;  2COM A;  2JMW A;  2KIS A;  4HX7 A;  3HOW G;  2DQL A;  3WNZ A;  1AA7 A;  2R7F A;  4MFD A;  4J9L A;  3CC7 I;  3MKY B;  5E5S A;  4MNU A;  3KLO A;  2R4G A;  2Y9Y A;  2WE6 A;  1WH7 A;  2VKV A;  2BBY A;  4M6V A;  3N4M A;  5EOY A;  3MD2 A;  5C8Y F;  3D5R C;  1NK2 P;  5CPR B;  3GTO J;  2LP0 A;  4DJA A;  1VAJ A;  2DDA A;  1YOV B;  2O7O A;  2W82 A;  1FP1 D;  3D0S A;  4DBQ A;  2MFZ A;  4XIC A;  5DS9 A;  2OZU A;  2ZXJ A;  5F0F A;  4B4C A;  5KG0 A;  2HHH H;  2JA7 G;  4FE4 A;  1MI8 A;  2HXI A;  1IN7 A;  1XDU A;  1SFE A;  4CYC B;  3MWM A;  2DFE A;  2H09 A;  2HZT A;  2F6C A;  3M9A A;  2X4H A;  3OUU A;  3SFI A;  5D5V B;  1I6X A;  1IN5 A;  1IRX A;  4XLF A;  3I59 A;  3RPU A;  2YRX A;  2QSG X;  5E3M A;  5D5W B;  5TRD A;  2FU4 A;  4TQR A;  2GOM A;  5E1Z B;  4CDG A;  5CQG A;  4MAM A;  4IXA A;  1HW1 A;  4FQG A;  5E20 A;  4G12 A;  5H6Q A;  4L1K A;  1GUU A;  5EEG A;  4X64 H;  3E5X A;  1ZAO A;  3K0L A;  4ON0 A;  5B1B H;  5FLX W;  3TQT A;  1XMO H;  1L2Z A;  3T8R A;  2EIL H;  2TRT A;  3PIP F;  4ZC3 A;  1O75 A;  3I59 B;  4RM3 A;  1XS9 A;  3PO3 J;  2PN1 A;  4PGG A;  5KAF C;  4XSX F;  1JGS A;  3JRC A;  1EV7 A;  4A3C J;  2FF4 A;  1MJ9 A;  3A2K A;  4UB6 C;  2L7K A;  3L09 A;  3M7G A;  4RNN A;  4GC6 A;  4CCK A;  3CCE I;  1V55 H;  1I6H J;  3WTT C;  3J80 Z;  4XLP F;  3HYJ A;  2RAE A;  1TL8 A;  1Y8Q B;  4I02 A;  3GTJ A;  2RQQ A;  4Q8E A;  2VPQ A;  2D1H A;  1B59 A;  3CCV I;  4A3D J;  5ICF A;  2D2W A;  1UZC A;  3REO A;  4MV6 A;  1I7L A;  5EJC A;  5F27 A;  3H35 A;  3I12 A;  3HOX G;  2V4R A;  1S97 A;  2DDB A;  2DOF A;  1SAN A;  2YS9 A;  4DYQ A;  5IP9 J;  1CGP A;  3GTQ A;  4AAG A;  2EX5 A;  4IHJ F;  2W9C B;  4RB0 A;  1FX7 A;  2ICW G;  5D1O B;  3LWF A;  2HJW A;  1XCV A;  4Y52 J;  2CO5 A;  5KG3 A;  4LF9 H;  4DR1 H;  1P7I A;  2A05 A;  3MR3 A;  1TWG A;  2XPU A;  3TGN A;  1ETK A;  2QQA A;  1AKH B;  1HKQ A;  5TIS C;  4HRI A;  3N40 P;  4DL7 A;  3VYT B;  2EK5 A;  2L7M P;  1JTY A;  2W8K A;  4DUY H;  2I5U A;  2FPI B;  2CW7 A;  1K6O A;  4Z2Y A;  2KEQ A;  5CLS A;  1RJP A;  1Q1H A;  1XMQ H;  2VQH A;  2P5K A;  4G94 A;  2E5L H;  2J6U A;  2CQ7 A;  2X6O A;  5E1X A;  1R1T A;  4DGW B;  3RGX A;  1FT9 A;  5DM7 F;  2O3F A;  3OYM A;  4TUY F;  1UJ8 A;  4C2M A;  1J9I A;  4BDY A;  2LVS A;  2UVU A;  5GTI C;  3CC2 I;  3R6S A;  5IYB J;  1ZYR F;  1R1U A;  3V4Z A;  4A3J J;  4RBO A;  2WB1 A;  1R23 A;  1EA3 A;  2GXG A;  4ECQ A;  4OIO F;  3PL8 A;  3CZ6 A;  3ETH A;  1P4A A;  3CVZ A;  2KZV A;  5KCM A;  1QVT A;  3G6X A;  1R4N B;  1PUF B;  1OFC X;  2AXL A;  4IOC F;  4A0X A;  4I0B A;  4LF7 H;  1JXL A;  4DV7 H;  3M1C A;  3S14 J;  1X4P A;  4P1W A;  1WH2 A;  2V9V A;  3L4K A;  4XMY A;  3MR5 A;  1S03 G;  1XN7 A;  4MV8 A;  3I4M G;  3JSN A;  1WCM G;  2DAO A;  1B4A A;  2CGP A;  4EEF G;  4GDF A;  3OUZ A;  1DDN A;  4BJT A;  4I0A A;  4II2 A;  2L01 A;  4RGU A;  4AC0 A;  2LKP A;  1FMW A;  3WTV C;  4O3M A;  2AGP A;  1P9Q C;  2GM4 A;  1JE8 A;  3T5J A;  4MA0 A;  1G9Y A;  2F4O B;  2MD0 A;  4IL6 C;  3ZMU A;  4BEH A;  1X2M A;  4FBT A;  1IN8 A;  2FPG B;  1YS6 A;  4EEQ A;  2E1N A;  1Z3Y A;  4J00 A;  3HJE A;  1ZEL A;  1J0R A;  4P96 A;  4G7Z F;  2FXA A;  3IHU A;  4II3 A;  2ZME A;  4E7H A;  4E4T A;  4HX4 A;  1LFU P;  5EEA A;  4ASN A;  3BPV A;  3MKW B;  3FIS A;  1VBH A;  3H0G A;  1LE8 B;  3PIO F;  2HOS A;  4BXX G;  3HRS A;  2RDI A;  1IXS B;  3J81 W;  4O5V A;  1ONV A;  2A3S A;  1LQ1 A;  1WJE A;  1BI0 A;  2VBX A;  3RF2 A;  3JRH A;  2F4M B;  4ANJ A;  1FLI A;  4B3M H;  1WJB A;  1K79 A;  5FD5 A;  1HKS A;  4UCO A;  2AGQ A;  3QAH A;  3GCM A;  1XGO A;  1W36 C;  5F0C A;  4A0Z A;  2JA5 J;  1OCP A;  1K83 J;  4MV9 A;  2D1V A;  3BR6 A;  3JW4 A;  4XOT A;  1H89 C;  3CQZ J;  3VPB A;  3M9O B;  4GYI A;  5KFC A;  2GIZ A;  2EBI A;  2V26 A;  3Q9V A;  3WTW C;  3JSO A;  5D6E A;  3IL2 A;  5FKO A;  5LL6 b;  4IPA A;  4ED3 A;  3HC7 A;  3MZH A;  5DGA A;  1IW7 F;  3OHA A;  3V6K A;  3F6V A;  2C35 B;  2VPL A;  2ASJ A;  1TQI A;  2XV4 S;  3DP7 A;  2HYG D;  3PNV A;  5KNL A;  2O9L A;  2IGO A;  4NDL A;  5K7F A;  2VQD A;  3WU0 A;  3IV5 A;  3J7A K;  2TCT A;  4HV5 A;  4IHX A;  2PVP A;  2ECB A;  1R9T J;  2R7Z J;  1RK6 A;  2BQ3 A;  2PBZ A;  5LMN H;  1IRF A;  4BE2 A;  2HKO A;  2KP6 A;  3H0G G;  4JV1 A;  1T95 A;  1I50 J;  3HTS B;  4UNB A;  2Z1D A;  1QNT A;  2LQM A;  2ASL A;  3TW7 A;  4JI5 H;  4BQN A;  2JSP A;  3IKV A;  1JKQ C;  5BMZ A;  1KJQ A;  4EGY A;  3WGH A;  3W3C A;  2QCO A;  1G2H A;  2XE0 B;  4X62 H;  4JX5 A;  2I8C A;  1G9Z A;  2E35 A;  3KEO A;  2ZNY A;  2ZXI A;  2L9N A;  3U9S A;  3PSI A;  1LNW A;  5F0H A;  4E2T A;  1FSE A;  3RKQ A;  1I1G A;  2O5R A;  2DT5 A;  3PNY A;  1T9I A;  3I56 I;  2OA4 A;  2OLS A;  4RGS A;  4F52 A;  1G3Y A;  2K3P A;  3GV5 B;  2IS1 A;  4DYC A;  4M9S A;  1A6Q A;  2DA2 A;  4RB2 C;  3OSN A;  1WH5 A;  1RKT A;  4NBQ A;  2R7D A;  4GC7 A;  3RB0 A;  3A02 A;  2XGX A;  4FT8 A;  2WA0 A;  1RUN A;  4LFU A;  3S2H J;  1JVA A;  5L1L A;  4YR3 A;  2VOB A;  3MKZ A;  4KIS A;  2VT3 A;  3ZQH A;  2XGE A;  4E7J A;  4UCU A;  5KFT A;  3GUD A;  1SMY F;  4QWC A;  2CQY A;  3DPL C;  3JRA A;  2P6S A;  1HR0 H;  5DG9 A;  3ASN H;  5J6X A;  3A0H C;  1VTN C;  4F4X A;  1XDS A;  2IEK A;  1B33 N;  1U78 A;  2R7K A;  2VJ5 A;  5DGB A;  2O6G E;  3H4D A;  3GTK J;  3G1M A;  4A3G J;  2RQP A;  2I3Q A;  2L3D A;  5BOX A;  1X3U A;  4Z20 A;  2JVH A;  2ZDG A;  4XL9 A;  9ANT A;  2QQ8 A;  3IKT A;  3I4N G;  5C1P A;  3RV4 A;  3WO1 A;  1IJW C;  3PFY A;  3ZMV A;  1WJ5 A;  3RB3 A;  2M1B A;  1BJZ A;  1W93 A;  5IY5 H;  3HOY G;  1OQY A;  3F8N A;  2HZD A;  3O2P E;  3T5H A;  1J5E H;  1G3T A;  2V1X A;  3JRE A;  2YU9 J;  3KEY A;  3PR4 A;  3BDD A;  2XAH A;  3PJR A;  1Y0N A;  2NYX A;  2CYY A;  4MGR A;  1J75 A;  2MAB A;  2H1K A;  4KNY A;  1O4X A;  3OYB A;  4ZQI A;  2MBF A;  3K70 C;  3VSL A;  2VPS A;  4F7Z A;  4AYB E;  1ZG5 A;  2NNY A;  3PO2 G;  1T39 A;  5J3L A;  3QYB A;  1Z9C A;  1JKO C;  2E19 A;  4PCQ A;  2VBL A;  2X1E A;  4B09 A;  1FOW A;  1YJW I;  2KHM A;  4RLF A;  3ZQ7 A;  3MR2 A;  3OOL A;  3HDD A;  3F9K A;  1UHS A;  5LEK A;  3JTG A;  3I58 A;  4UN9 A;  4MA5 A;  1BIA A;  3AG3 H;  4OIN F;  4EQQ A;  3CP8 A;  2OTJ I;  4CIC A;  4XN0 A;  3GZ6 A;  2L8L A;  2JJ7 A;  3QWL A;  3NGD A;  4NLG A;  3KZI C;  2IT0 A;  1WZ2 A;  2EFN A;  1U3E M;  2FNP A;  4DL2 A;  4PFP A;  1ZRD A;  1WSC A;  1POG A;  5K5R A;  1AUX A;  1TWC A;  1HSJ A;  3QZ8 A;  3TBI A;  2FNA A;  4WK8 F;  2XAG A;  5CAE B;  3WOD F;  3E6C C;  5AON A;  2RC4 A;  3CD6 I;  1PX2 A;  5JLX A;  4ZJZ A;  1X1C A;  2JWT A;  2ETH A;  2B0L A;  5LMU H;  1TBX A;  2J5P A;  3BG3 A;  2QYO A;  3HL2 A;  2P8T A;  4L9N A;  5JFR A;  4IZO A;  4OX9 H;  2A6E F;  4LOC A;  3DEU A;  5DUK A;  3I4P A;  5KK1 A;  5KFU A;  4YHH H;  1LFB A;  4LF5 H;  4LFA H;  1O7F A;  3ZQC A;  4L5E A;  3MWD A;  3W2W A;  2ASD A;  2EIN H;  4FU0 A;  4BGD A;  1DP7 P;  1IUY A;  3HBL A;  1UG0 A;  2XF6 A;  1YRN A;  2HGS A;  4D7N A;  4A12 A;  1VBG A;  5CVV A;  1S5L C;  5DUI A;  5L3D A;  4LSX A;  2MLK A;  5IYC J;  3GYH X;  1N33 H;  1OCO H;  2Y48 A;  3BG5 A;  3BZK A;  4C30 A;  3MEX A;  1MW7 A;  1BBY A;  2I8D A;  1KJJ A;  5BQT A;  4UN9 G;  2BHY A;  3PW5 A;  2LCJ A;  3A4C A;  2UZK A;  2UXD H;  4PJJ A;  4A69 C;  1JKR C;  2R82 A;  3RIZ A;  4EBC A;  3PUF A;  1PDN C;  4R7R A;  5IOY A;  1LKX A;  2CUJ A;  2YX7 A;  1EUC B;  1VF9 A;  4ESB A;  3Q9S A;  3EYY A;  2F4V H;  4BHB A;  5LGT A;  3M07 A;  4A3F G;  3FIW A;  3ULQ B;  2FSW A;  5FD6 A;  4GIG A;  4NHJ A;  3GTO A;  4QIW N;  1VQK I;  2W6M A;  2XUB A;  2BXY A;  2J5O A;  2DFI A;  4DV2 H;  3KTM A;  1SAX A;  1GGO A;  1T0F C;  2JN6 A;  2WAQ N;  2M7B A;  3WU2 C;  4Y8V B;  1BC8 C;  1W36 D;  2B7E A;  2E5N A;  5E67 A;  1FBU A;  3H5N A;  5DCM A;  4ENM A;  5EZH A;  2EZL A;  4HYK A;  5FLV A;  1GXQ A;  2KQR A;  3DKW A;  3FXK A;  2RKH A;  5EGO B;  1GSH A;  4BBR J;  1DV2 A;  4A3K G;  4JI4 H;  2LF7 A;  5M3M J;  1B6R A;  3J81 K;  3GID A;  1ZAR A;  2DBB A;  3ELK A;  2AGO A;  4IAJ A;  5KG2 A;  2LK2 A;  4ED8 A;  1WQ2 A;  1E3O C;  3CES A;  3DV8 A;  4X65 H;  1MOW A;  4QIW E;  2VT2 A;  2VKH A;  2I10 A;  2VPR A;  1PYV A;  5FGM A;  2X6Y A;  1IDZ A;  2WAQ E;  2HQ5 A;  2KFD A;  4ZYA A;  5KT5 A;  4YHX A;  4F4W A;  3PVX A;  4G6T B;  2C22 A;  4QWQ A;  3CCJ I;  5KT4 A;  1SMT A;  2XAF A;  1E4E A;  3M9M B;  1IZ1 A;  3CCY A;  4X0G A;  2CS3 A;  1H9T A;  5HDK A;  4B44 A;  4TQS A;  2ZCW A;  1RI7 A;  4BY1 J;  2BZT A;  1K61 A;  1RC9 A;  4RS8 A;  1BI1 A;  2XGD A;  1TLH B;  2X1C A;  1A6I A;  5ERI A;  3CCQ I;  4CCM A;  2A5Y B;  2VC0 A;  2HDW A;  3M4O J;  1S0O A;  4Y3O A;  1UHM A;  4MQV A;  1NG6 A;  4HBL A;  4PJM A;  2HYJ A;  2MH9 A;  2PEX A;  2DMU A;  2RNJ A;  5FFZ A;  4UHT A;  2EV0 A;  3R0J A;  5J40 A;  1LDK B;  1QVU A;  3L9F A;  2OWO A;  3ZQI A;  4EFB A;  2M87 A;  5HS7 A;  1YX3 A;  3CDH A;  3KHL A;  5B1A H;  2HOE A;  3T0Y A;  1BOA A;  1XGN A;  2DYS H;  2JEI A;  1SD4 A;  1B72 B;  4DLK A;  3DF7 A;  2UXB H;  3DF8 A;  2ZFU A;  1A04 A;  1LUJ B;  3V6J A;  3CF2 A;  4U7D A;  4RAG A;  3LL7 A;  3PO3 G;  2W84 A;  2MC3 A;  1VQ7 I;  2M45 A;  3FMQ A;  1XSD A;  3GV7 B;  3IRR A;  5FJ8 J;  3S16 J;  2VBO A;  1Y39 A;  3Q1K A;  1U5T B;  3O6B B;  3KE2 A;  4GCV A;  1I7N A;  2PMH A;  1B9N A;  1FIP A;  3GLL A;  2FML A;  4G3I A;  1RRJ A;  5DEQ A;  2W71 A;  3LSM A;  3ZQL A;  3BPX A;  5EZY F;  4UN7 G;  4BU2 A;  1CF7 A;  2EZI A;  2C2D A;  4DIQ A;  4HQM A;  1UB9 A;  3C0F B;  4A3D G;  1YFH A;  3IC7 A;  5FPR A;  1B1B A;  3MZY A;  5E18 F;  4LIV A;  4P5O A;  4A3E G;  2HQR A;  1FSH A;  3A1Y A;  1IC8 A;  2VIX A;  5IP9 G;  5DLF A;  3OYL A;  5EDW A;  1XSX A;  1UST A;  2EJR A;  4AIK A;  4FX4 A;  1Y1W J;  2UUA H;  4KMF A;  3GBG A;  2AHQ A;  1OJL A;  1HBX G;  1CF7 B;  5KHD A;  3PW7 A;  5C4X J;  3QOP A;  2IRF G;  1HNW H;  3Q8Q B;  3HOS A;  1CQT A;  3GME A;  6PAX A;  2QZ8 A;  3RJP A;  4QIW A;  2XVC A;  2E71 A;  1MBJ A;  3K70 D;  2WAQ A;  4U87 A;  2HFH A;  1HLV A;  4A93 J;  4C2T A;  3DTE A;  4J0M A;  1TW2 A;  2Y0S N;  5K7H A;  4DV1 H;  1U5T C;  2NAZ A;  2RDP A;  1R5I D;  4DV0 H;  1I5Z A;  2F5V A;  1JHH A;  3HGG A;  4HLY A;  1S7A A;  5J1Y A;  3TIN A;  5L9X A;  2NNN A;  3ORR A;  3MJF A;  4BE1 A;  4CH7 A;  5F9N A;  1S29 A;  2IS2 A;  3AG1 H;  2AQ4 A;  3H9J A;  4YIR X;  3G6E I;  1CQI B;  2DTR A;  4XNF A;  3JSP A;  4DYR A;  4PJN A;  4A3J G;  2AB5 A;  1K1Q A;  4JYA H;  1QPI A;  3HOY J;  1OCZ H;  2WY7 Q;  2V4Q A;  4K0K H;  4D6N A;  3CO6 C;  2MSY A;  2X9D A;  4G6Q A;  4XRS A;  1AM2 A;  2R92 J;  3HRT A;  3DXJ F;  3OYA A;  2JA5 A;  1T56 A;  1K83 A;  1O3R A;  5E8I A;  5I47 A;  4IHV A;  2JQ7 A;  3CQZ A;  2Y0S E;  3WGG A;  2NU9 B;  1JT6 A;  3FWE A;  1ZLK A;  1A5J A;  2JK3 A;  2LH9 A;  2W9B A;  3IP4 B;  4TV7 A;  2Z33 A;  4PUS A;  4DV4 H;  4FX0 A;  3BTL A;  1TA8 A;  1ITY A;  4EGQ A;  3HOZ J;  3H4B A;  1UMQ A;  4YAK B;  3EUH A;  5ILS A;  4LFB H;  3ESW B;  1YW8 A;  4FET A;  4C3H J;  1AHD P;  2Q2U A;  4EAT A;  1ZR4 A;  3MFK A;  3HOT A;  3G71 I;  1TP4 A;  2Z2S B;  3TO9 A;  4KT5 C;  4J01 A;  3CLO A;  3KAK A;  2Y30 A;  5JVT A;  2VE9 A;  1EYZ A;  3MR6 A;  4LLL A;  3FZV A;  1ETW A;  5FRO A;  3L2U A;  2K40 A;  1ODD A;  1T08 B;  2FK1 A;  4LG3 A;  4A2A A;  1D5Y A;  3GLX A;  4V2G A;  3FMA A;  2CRG A;  2ZO4 A;  1RR8 C;  1R9T A;  1KYZ A;  2R7Z A;  2ZDQ A;  3HEF A;  4LLN A;  4OOI A;  3U21 A;  2R86 A;  1M6V A;  1I50 A;  5HOO A;  3LA2 A;  2LG4 A;  3BTI A;  1LDD A;  5CVI A;  3R60 A;  1V3F A;  4ZYG A;  3I0T A;  4KIF A;  3GO5 A;  1F43 A;  4NC7 A;  2JPB A;  2E2I J;  3JSL A;  3CDL A;  3DKX A;  3HSF A;  2QBY A;  4BBS J;  1DIK A;  5LOV F;  4UV9 A;  1MJB A;  3TOB A;  2E7X A;  4ZYH A;  2IN8 A;  2BE5 F;  2R5Z A;  4BNC A;  1PK8 A;  4XRS G;  4LSA A;  2UXN A;  1KEE A;  3WE2 A;  2JA5 G;  1JJ6 C;  3E0J B;  3FKI J;  2VJJ A;  1ZLJ A;  2RNG A;  1X58 A;  2CUE A;  5DD8 A;  4V2F A;  4E4H A;  3I54 A;  5KFF A;  3P9C A;  3LSK A;  2DYR H;  4PDB A;  4F92 B;  1K4S A;  4HG2 A;  2V79 A;  2D45 A;  3I64 A;  5F08 A;  2W6P A;  2QGU A;  3QU6 A;  3A01 A;  2R7S A;  1HKT A;  1SC7 A;  1SD6 A;  2BV6 A;  2E2H J;  1EH6 A;  3CC4 I;  2XC7 A;  4DW6 A;  1VKZ A;  1BW6 A;  2ADU A;  4IF4 A;  3EUH C;  1YS7 A;  4IX7 A;  3LST A;  3GQC A;  1BJA A;  1GXP A;  1IF1 A;  2YX4 A;  5FLM J;  2EWN A;  2HNH A;  2R7Z G;  2C2R A;  3E3V A;  3QPS A;  3QYF A;  4RM2 A;  1YE9 A;  2F5C A;  2ZM6 H;  3D5S C;  4ITV A;  1N34 H;  2PG4 A;  4PSW A;  1BR4 A;  4M3E A;  4L9T A;  3GTK A;  2CUF A;  3MAJ A;  4Y17 A;  2KT0 A;  4A3B J;  5A0M A;  2KLO A;  2HPI A;  5EEH A;  2NVY J;  2A6H F;  3ISP A;  4AAF A;  1WPK A;  2DZD A;  2JEF A;  2CMP A;  5EG0 A;  4F4Z A;  3DKY A;  3QOD A;  4IRC A;  2EPF A;  4EFE A;  1KGS A;  5J2U F;  4IRK A;  1U8R A;  2HS5 A;  3QPT A;  3H1C A;  3UFX B;  4EG0 A;  4K2E A;  3H3Z A;  5KAI C;  3E97 A;  4I01 A;  2R7U A;  1FMV A;  1ZRF A;  4C5C A;  2VB6 A;  2YU9 A;  4Y15 A;  2FOW A;  2QUF A;  5JI6 A;  3RI4 A;  1OR7 C;  2V4J C;  4JBA A;  1R00 A;  1S7O A;  1KC7 A;  2R7Q A;  3BR3 A;  3H92 A;  3BP8 A;  4APM A;  4JK1 X;  2FRH A;  2O7M A;  2E7W A;  3BT9 A;  2MGQ A;  4MLO A;  4FTH A;  3G8C A;  2EV6 A;  4YFN F;  3H36 A;  2IGK A;  2IBK A;  3NRV A;  3IAM 2;  4A5M A;  4P9U A;  4BAY A;  4QTR A;  3S3N A;  4O1R A;  1MIJ A;  2NVX A;  1K6Y A;  1Z2P X;  3CCU I;  4G9Y A;  1JXS A;  2PMZ A;  2UV1 A;  2XKO A;  3KZZ A;  4LLG F;  4OAY A;  5IT9 Z;  2EA2 A;  3CUQ B;  2NVQ J;  2ZJT A;  3VFZ A;  4LF4 H;  1TNT A;  1KU3 A;  3ZQQ A;  4ZYE A;  1GDT A;  4F93 B;  1OCR H;  3TMO A;  2DPI A;  1P4W A;  3MN2 A;  4A3G G;  1XDN A;  4A2B A;  2HVQ A;  2UXX A;  2R5Y B;  1IUF A;  3EDP A;  2R3S A;  3V4G A;  4CYC A;  3TED A;  1EJ9 A;  4I4T F;  2FJZ A;  4HDU A;  4GXO A;  4IKF A;  4LIU A;  1S72 I;  1LEB A;  1ZET A;  3EUK L;  2CV1 A;  2QSF X;  3WO0 A;  4O3P A;  1Y8R B;  3EPZ A;  4HQ6 A;  2VLA A;  1PUE E;  3R5X A;  1TAE A;  3FXO A;  2R7N A;  4Y33 A;  2BR0 A;  2W85 A;  3R61 A;  4L0Z B;  1LEA A;  1ETV A;  2VAS A;  4KMU X;  4DR4 H;  3BJA A;  2MYS A;  1ON2 A;  1QHG A;  2ELK A;  2R7T A;  4BAC A;  1HST A;  1MD0 A;  3FDY A;  4ESF A;  4BQA A;  1TZL A;  5KFQ A;  2C6Y A;  2LOO A;  2VQE H;  4AWX B;  3CUQ C;  2Y0M A;  2AS5 F;  4YBZ B;  1X1B A;  2VI6 A;  3K5H A;  5GON F;  4JV0 A;  5IP7 J;  2B9S A;  4RNM A;  1V51 A;  1AF5 A;  2RDJ A;  3S8P A;  2R8H A;  2FBI A;  1JDB B;  2EQR A;  1VI0 A;  3I9V 2;  2IJL A;  1WWX A;  3JRI A;  3BZC A;  2DTZ A;  2IP2 A;  3K4L A;  4AM3 A;  5BPH A;  3BLY A;  2W9C A;  5AIQ A;  5D1O A;  5BR8 H;  1L0O C;  1OYW A;  1WJA A;  2W7P A;  4RZQ A;  1Z21 A;  2NOG A;  4RUC A;  4ZZL A;  1MSE C;  2UVR A;  3C3W A;  4A3E J;  1M7J A;  4FS2 A;  4ECW A;  3QYE A;  1AKH A;  2J9G A;  4YP3 A;  2PBI A;  3LSH A;  1IOV A;  2YCH A;  3QU3 A;  3F72 A;  4DQ2 A;  4DOZ A;  3GFI A;  1X2N A;  2M4K A;  4AQY H;  3SJM A;  1S10 A;  5J8C A;  2GAU A;  2X6X A;  5A2Q W;  3K9T A;  2HOT A;  4EGZ A;  1WCM A;  1E4G T;  3M9N B;  2RV8 A;  4AD9 A;  3M8F A;  5DG8 A;  2XGQ A;  1FVI A;  2CQK A;  4EJT A;  4NXN H;  5HNH A;  2DJN A;  1FYM A;  4Q47 A;  1OWT A;  4JI7 H;  2BHZ A;  5L1I A;  2UVW A;  4IHT A;  3SZP A;  2D5V A;  3GFM A;  1U8B A;  1MJA A;  2VOO A;  5IYC G;  1YQA A;  4I50 F;  3HPG A;  2FQ4 A;  4IWY A;  1G6N A;  3FHN A;  5FPO A;  2C28 A;  1PUF A;  3DWL E;  3J7A Y;  4BXF A;  3GTL J;  2W4S A;  1ZQ3 P;  1TTY A;  1XC5 A;  3HHG A;  2W24 A;  1IN6 A;  1N75 A;  5FB2 A;  4ECS A;  4UN8 A;  4DV5 H;  3FXM A;  2H8W A;  4M6X A;  5GP9 A;  3MWE A;  2DMP A;  3K1M A;  4LG0 B;  3QPH A;  1GO3 E;  4BQQ A;  3K4C A;  4NUB A;  5KG7 A;  4BQO A;  4C5B A;  2XIG A;  4IVN A;  1LVK A;  4HZF A;  2PQ8 A;  3H3V H;  3L4J A;  1AUV A;  2YSR A;  2A61 A;  1OYY A;  1TWA J;  2E60 A;  1D5V A;  2Q8K A;  1QRY A;  4WCG A;  1QHH D;  5KG1 A;  4BBR G;  2XKP A;  1I94 H;  3WGI A;  3OL4 A;  2IPQ X;  1LE8 A;  2P7V B;  2LMD A;  4A3L J;  3DEW A;  2OZ6 A;  4HNT A;  2VQC A;  1G3S A;  5JUM A;  2K27 A;  2KSW A;  3M4I A;  3GXO A;  3FBN B;  1HNX H;  1YW9 A;  1V9P A;  1PP7 U;  4GKJ H;  4EBD A;  5CA1 F;  5AKM A;  2OV7 A;  1SFO J;  4LGW A;  1R5G A;  3CMY A;  4M9X A;  1QA6 A;  1S3J A;  1S7E A;  2FA5 A;  3DEE A;  4JX6 A;  5DYM A;  3IAS 2;  5E1W A;  5ED4 A;  3N41 B;  4AVP A;  2XAQ A;  1IG7 A;  3K4K A;  1SFU A;  4EJO A;  2R87 A;  3ZMS A;  2K9M A;  5DM6 F;  4AIH A;  4ETS A;  2GA2 A;  1WR2 A;  1WI3 A;  4UN8 G;  2KIM A;  4YAJ B;  3WTU C;  4KHP H;  2GIV A;  4CCJ A;  3Q8S B;  2KZG A;  4UUS B;  4ESJ A;  4EBE A;  4LB5 A;  1S9F A;  2LRE A;  5AIP A;  1BL0 A;  1IXR C;  2JA8 J;  1M5X A;  3T5X A;  4BY1 G;  4EMS A;  4LF6 H;  2QQB A;  1D8J A;  1UC8 A;  2HQN A;  3NWS A;  4R79 A;  2ZXH A;  1F1Z A;  3BJY A;  4XRF A;  2CU7 A;  2KL4 A;  2YPR A;  5F04 A;  3S93 A;  2Y9Z A;  4ABZ A;  1Y1W A;  4ED0 A;  3TDZ C;  1KA8 A;  4YIS A;  2AU0 A;  2MG4 A;  1T9J A;  4UUT A;  4KYW A;  2OCC H;  1XPX A;  5F64 A;  3D1N I;  5KG5 A;  4ZTF A;  4F3Q A;  5M5Y J;  3OYF A;  3H5A A;  1UC9 A;  4F91 B;  3UVF A;  2E2J J;  3T1Y H;  1WSU A;  1MNM C;  1A35 A;  3RAQ A;  4E7S A;  1XMK A;  2N8G A;  4E7L A;  5D1P A;  4Q44 A;  2XE0 A;  4QWE A;  3GIP A;  3H3U A;  5E79 C;  4ZDL A;  1K1S A;  1GSA A;  3TDU C;  5HDN A;  4O6J A;  5EZG A;  4X6A J;  1V4Y A;  4O2B F;  4BWS C;  2DK5 A;  2H6C A;  3OOP A;  5FJ8 G;  3RTR A;  3A0B C;  2IGM A;  3LOC A;  4DZJ A;  5CJ9 A;  4HAM A;  1UCR A;  2EB7 A;  3K7A J;  3LQR A;  4LF8 H;  3AAF A;  2DPD A;  5KFJ A;  1IO2 A;  4R8U A;  1D8K A;  2GXA A;  2W6N A;  1WKM A;  1IOW A;  3BJ6 A;  1KZH A;  2CV2 A;  4AU7 A;  1T6S A;  3V7S A;  1DQ3 A;  1MMN A;  2RGR A;  1TW3 A;  2DU9 A;  2WTE A;  3HUG B;  4UV8 A;  5DD4 A;  1YTY A;  4OMZ A;  3FMS A;  3NZM A;  3N43 B;  1Y1W G;  3K2A A;  3GTG J;  1MMS A;  2V5A A;  2W6Z A;  2YS6 A;  4R8U B;  5L3E A;  2JMZ A;  5C4X G;  2V9K A;  1NG7 A;  3JRD A;  2F48 A;  2MD5 A;  3PSF A;  5J8F A;  1RUO A;  5IYD J;  4YY3 H;  4PSX A;  1XNQ H;  4MV1 A;  3LFU A;  2XHK A;  2EFO A;  1FOK A;  3ETJ A;  4PK4 A;  1G3W A;  4D7M A;  2VQG A;  4PZJ A;  1MMA A;  4A93 G;  4HF0 A;  2PMU A;  1RNL A;  1TWH A;  3NWT A;  3W6J B;  2FK3 A;  5E8G A;  3OS2 A;  3OYC A;  1JGG A;  4YIF A;  1DUX C;  4PJ0 C;  1M1E B;  2VXD A;  4AYB N;  3MXB B;  1EUD B;  4EYH B;  4FM9 A;  5KFI A;  4ECY A;  5FKL A;  2HPM A;  3EUA A;  1W0T A;  1HW2 A;  3RDI A;  3OOU A;  2VOP A;  1AOY A;  1LWT A;  3BG7 A;  3GIL A;  3HTU A;  5HS9 A;  1UAA A;  2JA6 J;  5KFA A;  2STW A;  3OIO A;  4BDZ A;  3ONQ A;  2VBY A;  4MIM A;  3DTI A;  1N56 A;  2ATL A;  2CZG A;  4X66 H;  5FLX K;  2FLP A;  4BXU A;  2R92 G;  2HGC A;  2XAJ A;  2Y75 A;  4MEY F;  3D5L A;  4NQW B;  4UVB A;  2MA3 A;  3BR1 A;  1XCB A;  3WHB A;  3FKI A;  4WBN F;  4BYY A;  2MCT A;  1F5T A;  2VS7 A;  2ALZ A;  2YRW A;  3BRO A;  4EFJ A;  4ZTJ A;  2R0Q C;  1N3E A;  4RB1 A;  2H6B A;  3HOZ G;  3RJ0 A;  1IAW A;  1ETX A;  3JRW A;  1W5C C;  3JAM W;  4Y4R A;  2CV0 A;  1SEI A;  1IRG A;  2Q2E A;  3K69 A;  1ORK A;  1EHI A;  1SVL A;  3OS1 A;  2E2H A;  3FK7 A;  3HRU A;  2BGC A;  3E5Q A;  4M3G A;  5CQE A;  1E0E A;  1OYI A;  3ZGK A;  1IDY A;  3BR5 A;  2P7C B;  4GFB A;  2DOE A;  3MQ0 A;  4N0B A;  2EV5 A;  3DFG A;  4A3C G;  4Y7N J;  1G4D A;  5TJJ A;  2YZG A;  1I3A A;  2Q2E B;  2WV0 A;  5CVR A;  1R58 A;  1F36 A;  3Q0W A;  4XLH A;  2DQR A;  4O4L F;  1KU7 A;  1VQL I;  1X3Z B;  3IUO A;  1J59 A;  1HA8 A;  2NVY A;  1T0F A;  5KFZ A;  3ZP5 A;  5LXT F;  4BBS G;  1FJL A;  2L0K A;  1Z1D A;  3DBH B;  3IWZ A;  4FHT A;  3BAB A;  1FIA A;  3V7C A;  4F55 A;  4TV8 F;  4YJ2 F;  3KP5 A;  4JV2 A;  3HSE A;  2ZNZ A;  5DG7 A;  2WC2 A;  3FXQ A;  3CLQ A;  5HLI A;  3FKI G;  4HNV A;  3EYI A;  1HW5 A;  3GFL A;  5A72 A;  3KFW X;  1HOM A;  2M3A A;  4O3O A;  4I98 B;  5GAH J;  3O8G A;  4XLC A;  2LKX A;  2FMA A;  1X1D A;  5CVJ A;  1J2X A;  2P5V A;  1QBJ A;  2NS0 A;  2QOJ Z;  4UNO A;  2R7X A;  3MIP A;  3UR3 C;  3QZ7 A;  3CF5 F;  1W5S A;  3V6H A;  3S3O A;  1WVR A;  3CJT B;  4Y13 A;  3EPG A;  4ECX A;  3VYU B;  1LDJ A;  1USS A;  1KU9 A;  3OWT A;  3HIF A;  4XZ3 B;  5KFH A;  3GTM J;  5IT9 W;  3H5R A;  4QW8 A;  2Z5U A;  4CSW A;  1QGP A;  4RLQ A;  3RIR A;  2NOJ B;  1B04 A;  1P8L A;  4DBR A;  5D6F A;  5FLM G;  3FM5 A;  3F8C A;  4ECR A;  4JI8 H;  2LBF B;  3LSP A;  1RJQ A;  2R93 J;  1SFK A;  3HSR A;  3HM5 A;  2ZSI B;  2CFX A;  2KIF A;  2O03 A;  5HDG A;  3T8T A;  5DQH A;  3ERM A;  4A3B G;  5L1K A;  2VA2 A;  2IXS A;  1LWS A;  4A0Y A;  5EGO A;  4F50 A;  4QSH A;  5GAE J;  2VBW A;  2HVR A;  2FBK A;  3C2B A;  1E4F T;  2VN2 A;  4UCS A;  4KIC A;  2DA3 A;  2JTV A;  3GZN B;  2R85 A;  5EYR A;  2V58 A;  4QWA A;  2FJ1 A;  1SEU A;  1HNZ H;  2XCL A;  3RCO A;  3ECH A;  1DQU A;  2GLT A;  4AYB A;  2V6E A;  2DA4 A;  2DN0 A;  2R8J A;  1IBL H;  4ED1 A;  1S6L A;  2OF7 A;  3HPH A;  2DLN A;  3S1Q J;  3SQN A;  1GV5 A;  1A31 A;  1A36 A;  3PNT A;  2ME6 A;  2KJB A;  1TNS A;  2ID6 A;  3LSG A;  1I39 A;  5J4V A;  3NEU A;  4HR7 A;  4O1S A;  1ULZ A;  5K5Q A;  1EZ1 A;  1ERD A;  2MC4 A;  4PFO A;  1C3O A;  1XD7 A;  4DR5 H;  3ZN0 A;  2JA2 A;  1U9O A;  4I7H A;  5L3F A;  1YW7 A;  5E17 F;  5KKN B;  3BC8 A;  4KUM A;  2I3P A;  2BOL A;  4RB3 C;  3V42 A;  3BTC A;  3PQJ A;  4NNJ A;  5HOD A;  5IT3 A;  5K5O A;  4H4K C;  4IHY A;  5D8L B;  4LIT A;  3E54 A;  3J80 W;  2R8I A;  3KIO A;  1ZTR A;  2ZB9 A;  2XC9 A;  4MQ9 F;  1GHC A;  1XG1 A;  2K3F A;  2LF8 A;  4UN7 A;  1Q1V A;  2I87 A;  2WBM A;  4HOB A;  4M9U A;  3JCU C;  5LD2 C;  4FCY A;  2OD5 A;  2HI3 A;  2IW5 A;  3P9I A;  3FXL A;  4DV6 H;  2FD5 A;  3AG2 H;  1I3Q J;  2XGP A;  3W2V A;  1H8A C;  1WJF A;  1OLT A;  1B72 A;  4NXM H;  1BC7 C;  3OIP A;  4CZZ A;  2E1M B;  1XX5 A;  2ZC2 A;  4ECT A;  2IN0 A;  2QLZ A;  5LP6 F;  2PJR B;  3M8E A;  3HYI A;  1U5T A;  5B66 C;  3GW2 A;  3J7Z I;  2YW2 A;  1AU7 A;  3MKL A;  3FDS A;  5C3E J;  3G2B A;  5CVU A;  2M5W A;  3KP2 A;  2Q0O A;  3ASO H;  3QFF A;  4XOR A;  2BW3 B;  2F2E A;  1G8X A;  2M2E A;  3LA7 A;  1S8N A;  4CCL A;  5IP7 G;  1MNE A;  3KX2 A;  5AKF A;  4LH7 A;  3O3K A;  3P7N A;  4IEJ A;  3Q8P B;  1I27 A;  4XN3 A;  3ZN1 A;  1T2K A;  5DDG A;  4D9J A;  4AIJ A;  4IRH A;  4EYI B;  1JUM A;  2G7H A;  2K9S A;  3V7R A;  5HVQ C;  3CCS I;  3GTL A;  1WJC A;  4R8H A;  3TQN A;  1MKM A;  3K3V A;  2XSJ C;  3E6M A;  5DV5 A;  1QU3 A;  1FC3 A;  5FRN A;  5F9L A;  2FB9 A;  5DQI A;  2VBZ A;  1X1P A;  3B73 A;  2A5W A;  4Z6Y A;  4A2U A;  3KP3 A;  3FX3 A;  4LJZ F;  3ERE D;  4HF1 A;  2XF5 A;  1XMA A;  2ZJP F;  2Z3Y A;  2E1M C;  3AG4 H;  4WXH A;  4S04 A;  4XKV A;  5K1Y A;  4ECZ A;  4B47 A;  1ZGW A;  3KP4 A;  3BCB A;  3BZ6 A;  5KFL A;  4UCT A;  2DMN A;  3B6A A;  2ZXW H;  4J9R A;  3J81 Z;  2H8R A;  1TWA A;  1FEX A;  3CDI A;  3F8M A;  4BKX A;  4NB5 A;  1P92 A;  2VUM J;  5KG4 A;  2W1O A;  4W97 A;  4MV7 A;  3OMY A;  2VC1 A;  3JTH A;  2EFP A;  5T14 A;  1WI9 A;  4CZC A;  3G1L A;  1P8K Z;  5KVR A;  1Z3X A;  5LHH A;  2NS7 A;  3P9K A;  3WG9 A;  1V4R A;  3R5H A;  4O3R A;  1T98 A;  5KFK A;  2FK2 A;  1ACI A;  2O8X A;  4UB8 C;  2QWW A;  3KYC B;  1ETQ A;  2L7Z A;  4JOM A;  1F4K A;  1SFO A;  1ZR2 A;  2M7A A;  2NUA B;  2R7W A;  1P7J A;  3OTO H;  2V9W A;  3OYI A;  4B3R H;  2QEX I;  1N77 A;  2DT6 A;  4O3S A;  5A77 A;  5LGN A;  4PDK A;  2FKL A;  4PJL A;  5J1R A;  3QQY A;  4O3N A;  2RRE A;  4XKW A;  3RGZ A;  1D3Y A;  4M72 A;  5KFR A;  1Z7U A;  3H40 A;  3BG6 A;  3KO2 A;  4HNU A;  1F9N A;  4S0H B;  5F1R A;  1YG2 A;  2UVV A;  2IGN A;  1FKA H;  2O0Y A;  1AWC A;  2HOA A;  3VB2 A;  5D5X B;  1C30 A;  1RR7 A;  3KLN A;  1BJT A;  3R23 A;  3K1N A;  3BQ2 A;  1O7L A;  1W7P B;  1U0C A;  3JAM K;  2AO9 A;  2VE8 A;  3SEQ A;  3WHC A;  1ZGJ A;  5ILU A;  4JQF A;  4EJV A;  2NVU B;  1ZRC A;  1NK3 P;  3U2R A;  3HB9 A;  5HNF A;  3M1E A;  5H6R A;  3WTS C;  1SD7 A;  4KA4 A;  1RJR A;  1N36 H;  2GWR A;  2KMU A;  4A3L G;  4IZZ A;  3VEP A;  2VOD A;  5KFG A;  3K4J A;  3V8K A;  3X2Q H;  2EZK A;  5LEJ A;  2R7R A;  1PP8 F;  1VQ8 I;  1WJD A;  3KPH A;  4U0V A;  5KFO A;  1W5T A;  4J9P A;  2ECC A;  3OYJ A;  2VS8 A;  3G6V A;  3VYS B;  5A74 A;  4M3D A;  1REP C;  2VUG A;  4OMY A;  4FS1 A;  4ME6 A;  2XCA A;  2LKS A;  2A68 F;  2ACJ A;  2GOX B;  5E3O A;  2GPS A;  1O3S A;  1GT0 C;  1HDP A;  5JQW A;  2KRH A;  2K4B A;  1ZK8 A;  2ZSH B;  4UNC A;  3JRX A;  4UFZ A;  1EH7 A;  3SFZ A;  2VKE A;  1TT0 A;  3VPC A;  2ZFW A;  1RK5 A;  3RB6 A;  2JZY A;  1TQM A;  2OAZ A;  2V1D A;  3ABU A;  1TC3 C;  3LAP A;  2IP4 A;  1OR7 A;  2V6C A;  1YX5 A;  3ZXS A;  2CJJ A;  4U6P A;  2JA8 G;  5LA6 F;  3H3V K;  3O8H A;  1KBL A;  2OH2 A;  2DO7 A;  1GV2 A;  4M73 A;  1VQO I;  2NU8 B;  2IVM A;  1EH8 A;  2DA5 A;  2R7L A;  3DLA A;  3GEZ A;  5LYJ F;  3GTG A;  3F6O A;  3SDB A;  1RYS A;  4GO1 A;  3HKZ E;  1D0Z A;  1KQ9 A;  3MMY B;  1MBG A;  4Z1X A;  3RKY A;  2ZJ2 A;  5BPF A;  4O4H F;  3NQO A;  3E7L A;  3R0A A;  3R4K A;  4ZOL F;  5JVL A;  3CCM I;  1SAU A;  4ZDO A;  1Y1V J;  4YIT A;  4CO8 A;  1FTZ A;  1BXR A;  5DLG A;  3K10 A;  5FKN A;  2DA6 A;  2X48 A;  3NAR A;  4R1H A;  5AK9 A;  1YI2 I;  4CUG A;  4IR1 A;  3PZP A;  1RET A;  1VFC A;  2LR8 A;  4AAE A;  4DUZ H;  2M8E A;  3TP0 A;  2X0S A;  1JDE A;  2NS8 A;  2LSO A;  4E6K G;  2B63 J;  2QKM B;  1IXC A;  1R7M A;  2EZH A;  2HYF A;  1KYW A;  2Y0S A;  4B3X A;  2ELH A;  3E6B A;  3F8F A;  2OC6 A;  3HGY A;  2GBY A;  3ZMZ A;  1DGS A;  1WFX A;  2DFH A;  2UUB H;  4E7Z A;  2JA6 A;  1TQP A;  5KFP A;  3VPD A;  3C18 A;  3KHH A;  1R4M B;  2VR1 A;  2XGC A;  1J09 A;  3DLL F;  1MZB A;  2P0W A;  4IQ4 A;  1I6U A;  2DMT A;  1W4M A;  3C7J A;  2VXZ A;  2VBJ A;  5D4R A;  2QF7 A;  4XR6 A;  4E2U A;  5EWG A;  1SYX B;  2VQF H;  3CUQ A;  3CCL I;  4M71 A;  2FLN A;  2KPM A;  1MDM B;  4HEA 2;  1KJ9 A;  3J80 K;  1OMI A;  5IYD G;  2DA7 A;  3VOD A;  4EM2 A;  4LOX A;  2WV1 A;  4WX9 A;  2FP4 B;  4J9K A;  2R5Y A;  1JJ8 C;  4NC6 A;  1VQP I;  3U9T A;  3H9G A;  1A9X A;  3RBD A;  2KRF A;  2JUG A;  2HVS A;  2VBJ B;  5EWE A;  2FPP B;  3DCF A;  1M0W A;  2MH2 A;  2ZKZ A;  4U88 A;  5FKK A;  2BY2 A;  3L2Q A;  5CB4 F;  4GLX A;  4HLX A;  1BR2 A;  4QPQ A;  4C3J J;  2LWY A;  2E36 A;  2EIK H;  2LYC A;  2DA1 A;  1YHQ I;  1BA5 A;  3RUP A;  1B24 A;  3BQZ A;  1B8I B;  1KJI A;  5HBR B;  2WYO A;  2W9A A;  3Q0V A;  1SFX A;  5KT2 A;  2CKZ B;  2FEZ A;  4YII A;  4C2U A;  3FK6 A;  2F5E A;  2O61 A;  2JA6 G;  1MBE A;  3GF2 A;  1ZN2 A;  4A3F J;  4LK1 F;  5LLQ A;  2YL2 A;  1GYF A;  1XGS A;  2JEG A;  3G6Y A;  4DL5 A;  3PW0 A;  5IP6 A;  4ZYD A;  3BG9 A;  4GGG A;  3PFI A;  3KCC A;  3VYR B;  2EH3 A;  5BS6 A;  1FYK A;  5CA0 F;  5DCF A;  1BN5 A;  3KP7 A;  3L00 A;  5GPA A;  3KAJ A;  2P81 A;  1ZRE A;  3S15 J;  3Q2O A;  1P2F A;  3KAL A;  2RVC A;  3H9Q A;  1UNN C;  4LFC H;  1NHA A;  1V5G A;  3CCR I;  4FIS A;  3K4B A;  5KT6 A;  1LB2 A;  3PN1 A;  1MBH A;  3OS0 A;  4HQE A;  1O3T A;  3BWG A;  2R7V A;  1JTX A;  4DR2 H;  4HYE A;  4HPQ A;  4L9V A;  4ED7 A;  4P55 A;  2WB1 E;  1FYL A;  3BR2 A;  5KFD A;  3HXL A;  3GTM A;  3N97 A;  5IOZ A;  3PW2 A;  3K2Z A;  1HC8 A;  3WE3 A;  1BOB A;  1R6R A;  2R93 A;  3TIG A;  2LDU A;  3CP2 A;  1MBF A;  1HF0 A;  5H20 A;  2YZN A;  4CC6 A;  1Z2N X;  2LY1 A;  3C1D A;  2KDO A;  2WAD A;  5LGU A;  5J4Y A;  1GVD A;  1HDD C;  5KT3 A;  3E6D A;  5CYV A;  3J7Y J;  3CME I;  3S1M J;  3S3M A;  3V8J A;  3V8L A;  3LAJ A;  5D8D A;  1XNR H;  4BHP A;  1QZE A;  2G9W A;  1JKJ B;  5DTD A;  4B3S H;  5KFV A;  2LC2 A;  3ZQG A;  4ZDP A;  2CFO A;  3RPQ A;  3QPL A;  5HLH A;  5C44 J;  1VQ4 I;  2NVT J;  3CMM A;  4XYL B;  1Z2O X;  3QQA A;  5B3S H;  2EIJ H;  1Y6I A;  2FQ3 A;  4BJ5 C;  3TO6 A;  4YEL A;  2KIQ A;  4FAS D;  4ZH4 F;  3RV3 A;  4BL0 B;  4LMY A;  1OIS A;  1Y0U A;  4E70 A;  1YLF A;  3L7W A;  5TGT A;  2P6T A;  1J5Y A;  3LQQ A;  4RGR A;  1GVJ A;  4N9I A;  4MEX F;  3HOU G;  4LG0 A;  1BR1 A;  2IS6 A;  5IYZ F;  2FX0 A;  5ICC A;  1VDE A;  3FF5 A;  1FZP B;  3LP8 A;  3MX9 A;  4KN7 X;  4BHC A;  3PR5 B;  4BY7 G;  2R93 G;  1GPP A;  2XAS A;  2DOA A;  3CMA I;  3Q8R B;  1D1B A;  1VQN I;  4BH9 A;  2W25 A;  3N6X A;  4XLE A;  3OV8 A;  1H0M A;  4QW9 A;  4N4O B;  4UCV A;  4EM1 A;  3KXY T;  2W6O A;  3SI8 A;  4YFX F;  2KDZ A;  1QZZ A;  2F4I A;  2DIK A;  4AID A;  3AKZ A;  3N8D A;  1DGR M;  5KFX A;  1DFA A;  2L5Q A;  2NXN B;  3WTX C;  1I3Q A;  1MMG A;  1T38 A;  3GTP J;  1W7P D;  3TO7 A;  1V5E A;  4JUZ A;  1S0N A;  2DT7 B;  1LVA A;  4ECU A;  2J6S A;  4C5A A;  3SYT A;  2Y69 H;  3ZMT A;  3ZPL A;  1SVO A;  2DCE A;  3L2C A;  1VQ6 I;  3H20 A;  2XPV A;  3GV8 B;  3I53 A;  2DI3 A;  4Q4Z F;  4RUA A;  1FOY A;  2X6W A;  3E5U A;  2EA4 A;  2DCH X;  3C0W A;  4KIG A;  2VBN A;  1YIT I;  4UUS A;  5H80 A;  2EIM H;  3I3L A;  4A6E A;  2EFW A;  3H0D A;  1STZ A;  2OCE A;  3UNG C;  1Z05 A;  2FMY A;  4CCN A;  3E5N A;  4N9H A;  3G1O A;  1WRJ A;  4M3F A;  4I99 C;  1APL C;  1DPR A;  5B5E C;  2HDC A;  4LK0 F;  2VBN B;  3LSJ A;  2R6F A;  2P0A A;  3OSF A;  3BCA A;  1PVE A;  2G7U A;  2JVG A;  4RU9 A;  1O57 A;  4PGH A;  3HZJ A;  2QYZ A;  2ZDH A;  2DJI A;  3B6C A;  3AYH B;  2ISZ A;  4OWR B;  2W00 A;  1HQC A;  5GAD J;  1MGT A;  1XSV A;  4JYK A;  2IA0 A;  1FOX A;  4XYM B;  4OZ6 A;  2FOK A;  1ZKG A;  2CH0 A;  1LJ9 A;  1MH3 A;  3ZRG A;  1KQ0 A;  4BEH B;  1K7A A;  2STT A;  2FBH A;  3PUB A;  2VUM A;  3N44 B;  2ZME B;  1X3W B;  4ENJ A;  4KFC A;  1BP7 A;  5J2T F;  4AVZ A;  5ILV A;  4IOA F;  3MFH A;  4AAB A;  2W7N A;  2BY0 A;  5C3E G;  1QZY A;  2K9N A;  2F5F A;  2FLD A;  1U0J A;  2M8G X;  3C2G A;  4A3M J;  2R7O A;  3KP6 A;  3M8J A;  4UY8 I;  1FJG H;  4B48 A;  2LD5 A;  4ZHQ F;  2E1O A;  3I71 A;  4ECV A;  3VOE A;  1DGW Y;  3ROU A;  4XX0 B;  1SVM A;  1V5F A;  3HUG A;  1N3F A;  1MBK A;  1R22 A;  2M0M A;  2O8K A;  3OHB A;  3W2A A;  3TL4 X;  3DPT A;  3OL3 A;  4X1E A;  1SD5 A;  3HOV J;  3I55 I;  2M4G A;  3CUO A;  4RAZ A;  4EEY A;  1UM2 A;  2R8G A;  5FKM A;  2E1C A;  4L5J A;  3CJN A;  4JI3 H;  1JKP C;  3K4M A;  2K9L A;  2H27 A;  2R92 A;  1FBS A;  1Z91 A;  1R5H A;  3HHH A;  3SHF A;  1CS0 A;  1D1C A;  4ENN A;  4MV3 A;  3U1D A;  2ZME C;  2V59 A;  2FLL A;  4KDP A;  2CG4 A;  4E7I A;  4QJF A;  2DLL A;  1GLN A;  3K1P A;  3C0X A;  4MHG A;  2VUM G;  2LNB A;  1BNC A;  4FE7 A;  4JX4 A;  1OCT C;  2YS7 A;  5EF6 A;  2KRC A;  2LY2 A;  3RSN A;  5JHU A;  3MXB A;  5L3G A;  2FE3 A;  1E3P A;  1JLL B;  2PX9 A;  1R1V A;  3FMR A;  4RNO A;  3RBE A;  2H1L A;  4U7B A;  2JRT A;  1ZGA A;  5JVD F;  1K4T A;  3BQ1 A;  1AN7 A;  2ESH A;  4HX8 A;  3TQ1 A;  1ETO A;  5LFA A;  4MV4 A;  3KZY A;  2JEJ A;  1EKE A;  2LY9 A;  4C3I J;  3BOQ A;  2VL8 A;  4AUX A;  3JRB A;  1A0I A;  5E5O A;  2UUZ A;  4NQW A;  1TWF J;  3TP3 A;  1IRZ A;  3JR9 A;  4UNA A;  4RZR A;  3T1H H;  2GPW A;  4A3I J;  2RN7 A;  4C9Y A;  4XOP A;  4Q5S F;  5E3L A;  2E2I A;  2QM3 A;  3OYK A;  3QOE A;  3W6K B;  2A69 F;  3GVA A;  3CO7 C;  4U7C A;  3GII A;  3NAU A;  2DWC A;  3MFI A;  3L2R A;  2AXT C;  3DU5 A;  3HOW J;  3MVP A;  2W6Q A;  5L1J A;  1YYV A;  1K78 A;  1MMD A;  2F5D A;  2L9V A;  3LA3 A;  3Q5F A;  5LRS A;  4Q45 A;  3IGD A;  3ZMD A;  4IRG A;  1IGN A;  2ESN A;  5A0W A;  1CE8 A;  4MTE A;  1XMX A;  1X4O A;  2KJC A;  1O3Q A;  1QQI A;  2YUS A;  2LFB A;  3MCZ A;  1LPQ A;  4L0Y B;  2XD4 A;  2R8K A;  2YU3 A;  3GIJ A;  1VQM I;  1K78 B;  1VZ0 A;  2A07 F;  1U0D A;  4LX3 A;  2JA7 J;  4M9Z A;  2ZJR F;  2GZW A;  2K7L A;  3LSR A;  4PWQ A;  3QRF F;  3TW6 A;  3V4S A;  2BQU A;  1Y1V A;  2Z99 A;  1YJ9 I;  4KIB A;  3HG9 A;  4KL5 A;  4HSR A;  4IWX A;  1Z67 A;  2J6T A;  2VA3 A;  1HXD A;  2L2O A;  4D0P A;  5M5X J;  4YR0 A;  2MLG A;  2DK8 A;  2H94 A;  2WWY A;  3I5U A;  1YIJ I;  5A2Q K;  3VSK A;  2BQR A;  2B63 A;  1GLV A;  2K4J A;  1W0U A;  4O2A F;  4YR2 A;  3Q3S A;  1OCC H;  3BJO A;  4M74 A;  2NVX J;  4QWB A;  4M7E A;  3SZT A;  3ORQ A;  2XRO A;  1ULY A;  2IBD A;  2BY3 A;  4A6D A;  3LMM A;  4QFQ A;  4M3B A;  4B1R A;  2XB5 A;  3RPU D;  5LBQ A;  5K08 A;  2L54 A;  3KEQ A;  1Z0X A;  2DXI A;  4UCR A;  1D1A A;  3A03 A;  2BXZ A;  4JI1 H;  1J7K A;  4WF2 A;  2VBL B;  4J9M A;  4LH6 A;  3BA8 A;  3MZ8 A;  4EVI A;  2XSD C;  4D6O A;  2HQA A;  4BJ6 C;  2IA6 A;  1ZG1 A;  1DU6 A;  4H0E A;  2LBF A;  5IPA A;  3HOX J;  3GX4 X;  5HLG A;  2TDX A;  2IA1 A;  1T36 A;  3L2P A;  2M9H A;  3FBI B;  1T8I A;  5KFM A;  2HXO A;  4L5I A;  3UKG A;  2W48 A;  4DNC A;  3OYE A;  3HOU J;  1Y1V G;  3Q0U A;  3QP5 A;  3IN5 A;  2UU9 H;  5F1J A;  3RAX A;  2IAI A;  1Z6T A;  4BY7 J;  3RYR A;  2QVO A;  3RKW A;  3ZCO A;  5H2F C;  4EV0 A;  4XK4 A;  1VQ9 I;  3GIM A;  2XB0 X;  3FHZ A;  3IWF A;  5J47 A;  2HEO A;  4YB8 B;  4DL3 A;  2B63 G;  4XON A;  1R71 A;  5FO5 A;  1Y56 A;  1G59 A;  2HU9 A;  3OR2 C;  1UHW A;  4MFE A;  2IS4 A;  4UVA A;  1W1W E;  5CKT A;  5FLX Z;  4D1Q A;  5LRR A;  1D0X A;  3EH8 A;  3OYN A;  3TII A;  1KON A;  3WTZ A;  3G4S I;  3RZO J;  1JX4 A;  3AFH A;  3CTA A;  2BYV E;  3WG7 H;  1YRN B;  3RKX A;  5HS8 A;  4IO9 F;  1BGW A;  3IG0 A;  4YJ3 F;  1WGX A;  4UT0 A;  1RYR A;  2DPJ A;  3GTJ J;  1BI2 A;  2DFF A;  3ZQF A;  3KHG A;  4RMN A;  5BNG A;  2ME0 A;  4G8X A;  2K85 A;  2L4A A;  4XBF A;  4ENK A;  1QO0 D;  2ELJ A;  4HDV A;  2XRN A;  3F3X A;  3FXU A;  1H9G A;  1NH3 A;  3DTK A;  3LNQ A;  4RDU A;  3VPR A;  4J19 A;  1ZDE A;  1B6S A;  3GTQ J;  1V54 H;  4CA0 A;  2A6T A;  4J9S A;  4E7K A;  2JRM A;  1I1S A;  2M05 A;  3GIK A;  4I55 F;  1S68 A;  1T33 A;  4J9O A;  2Z9O A;  3EPI A;  4RAY A;  3K4N A;  3SE7 A;  3I4M J;  1Y14 B;  1TWG J;  1WCM J;  2OQG A;  5J1U A;  2XAU A;  3RZD J;  4KZS A;  3AL0 B;  4F4Y A;  3L2V A;  5A2Q Z;  3JZI A;  4YEJ A;  3WTY C;  4IRI A;  3F0C A;  2K86 A;  2HDD A;  4XKC A;  2M30 A;  1VS0 A;  1GSO A;  2IMW P;  3TOA A;  2JNQ A;  2DMQ A;  4ED2 A;  2Y2Z A;  1OPC A;  2X0L A;  2WAE A;  3ABK H;  5DCM B;  5LHI A;  5JHF A;  5KFE A;  1FY7 A;  4M6Y A;  5JVG F;  2OUM A;  5E63 A;  3DQV C;  3GFJ A;  1DV1 A;  1IV8 A;  2QA4 I;  2PJR A;  1M0T A;  2OQR A;  4C2M J;  1JT0 A;  3FXJ A;  5GPC A;  2I80 A;  2SCU B;  2YYA A;  3VMM A;  1IBK H;  4DR6 H;  2HKX A;  4BXX J;  4QWD A;  5D8K B;  1NTC A;  3RFC A;  1X19 A;  4IJA A;  3SXY A;  1B9M A;  1U9N A;  2BW3 A;  4A5N A;  4QPO A;  4I6Z A;  5KFN A;  2ID3 A;  3LWB A;  1N78 A;  1TT5 B;  4XSZ F;  2X51 A;  5ICE A;  4DL4 A;  1N32 H;  1LFP A;  5M5W J;  2VJI A;  2CW0 F;  4JI2 H;  2L9S A;  3GZ5 A;  3KHR A;  4DR7 H;  4RGX A;  3F8B A;  2P5L C;  2UXC H;  1MND A;  1E2X A;  1R7J A;  4FBU A;  3F21 A;  3BTJ A;  5JH7 F;  2CSO A;  4OAZ A;  3U1K A;  2E5Z A;  4W1U A;  1P4X A;  1JHF A;  2FUG 2;  5C4J J;  3AL0 C;  3OYD A;  1RIO H;  3S2D J;  3OYG A;  1E4E B;  3BR0 A;  2GLO A;  1DU0 A;  5C1O A;  2QK4 A;  2Q1Z B;  3M3Y J;  2NRA C;  2PI0 A;  2IN9 A;  3ECO A;  2K5C A;  1ETY A;  4EGJ A;  3JRG A;  5F6F A;  3QP6 A;  2VJ4 A;  1R49 A;  4O3Q A;  4HST A;  1JUS A;  2NU7 B;  3SEZ A;  2M0C A;  4WXD A;  3F23 A;  4KL6 A;  4KJZ A;  1RES A;  2JT1 A;  4JV5 H;  3OSP A;  4L18 B;  1N25 A;  5FRM A;  1T3N A;  2L7F P;  2MW8 A;  1Z6R A;  2ISY A;  3H0G J;  4YFK F;  1FTT A;  2Z16 A;  1VND A;  1YIO A;  3CJQ B;  2HTS A;  3IFJ A;  1P6R A;  3OYH A;  3F22 A;  4AQX A;  3N05 A;  2HR3 A;  1ZH5 A;  3J7A O;  5DQG A;  1ZHF A;  4IHW A;  1ZQ7 A;  3GTP A;  1JUP A;  4HA8 A;  1N48 A;  5C44 G;  4BS9 A;  1U2W A;  3HRM A;  3GLK A;  4CC5 A;  1L3L A;  4Q0Y A;  2KKO A;  3ZR8 X;  2OTL I;  3ABM H;  3VWB A;  4XLN F;  3GWZ A;  2Y31 A;  2XDV A;  2VBO B;  5D4S A;  3K5I A;  5KX5 F;  1Z7L A;  2OPT A;  4S05 A;  4G7H F;  3U9G A;  3T5K A;  4IQJ A;  2V9P A;  3RB4 A;  3FXR A;  2GA1 A;  2CQX A;  4YQW A;  2XRL A;  3OY9 A;  1PJR A;  1RPW A;  4HW0 A;  3DBR B;  5JLW A;  4I76 A;  1RKW A;  3ABT A;  4MTD A;  3W6V A;  2UWM A;  2C00 A;  3GIQ A;  5IWA H;  4B3T H;  2HWV A;  1AT0 A;  5JR3 A;  4I09 A;  4J9Q A;  2K9Q A;  1ZG3 A;  4CHU A;  2W8L A;  3ZOB A;  2WDT A;  3SZG A;  2RGV A;  1W7P A;  1IV6 A;  1JI8 A;  2Q2T A;  1FPQ A;  4I2O A;  3SDG A;  1EF0 A;  1UG2 A;  4BUP A;  1FWZ A;  3S2W A;  5FFX A;  1ZD7 A;  3S1N J;  4G7O F;  1KQ8 A;  4XQF A;  3CJR B;  4B43 A;  4CYD A;  4JI6 H;  2G0E A;  2AQE A;  2CWE A;  1ZHQ A;  2QQ9 A;  5ICG A;  3MIS A;  4IHS A;  4OU0 A;  2WTF A;  5LHG A;  3IH4 A;  4OIQ F;  3I4N J;  5IYB G;  2BY1 A;  4XLA A;  4O4I F;  1FBQ A;  4B3A A;  4MO7 A;  4LB6 B;  2JPC A;  2PN6 A;  1Z77 A;  1RZ4 A;  4Q48 A;  3VDX A;  4QLC U;  4IRD A;  5EWF A;  1E3H A;  3BAA A;  2VQL A;  1KU2 A;  4OIP F;  3S1R J;  4CCO A;  2IA2 A;  4RAF A;  1ENH A;  3KET A;  2W70 A;  3BQY A;  3T1B A;  4WWC A;  3BQ0 A;  3C2H A;  2PMZ N;  3HKZ N;  4KN4 X;  1ZHS A;  2PJP A;  1W96 A;  2JSC A;  2L02 A;  1XB4 A;  5D5U B;  3JRF A;  3L2W A;  3PO2 J;  3N42 B;  2XCP A;  2QEN A;  3RQ4 A;  1UFM A;  5K7Z A;  2YZM A;  2XPW A;  4YRV A;  2P4W A;  2R84 A;  2ZJQ F;  3RTX A;  3PM1 A;  2M34 A;  4BE0 A;  2F4L A;  2COB A;  4DV3 H;  1OKR A;  5E3N A;  2GXB A;  2V1U A;  2W9B B;  3R7P A;  4WD3 A;  1TWH J;  3TKY A;  4ZZD A;  1EF4 A;  5C5J A;  2KIU A;  3BY6 A;  4JI0 H;  5BMV F;  1DP3 A; 
#chains in the Genus database with same CATH homology
 4PSX A;  4ZDP A;  2CFO A;  1D0Y A;  2WY8 Q;  2BVM A;  2V1N A;  2VKH A;  3CMM A;  3LFU A;  4NC8 A;  1PYV A;  1Z2O X;  2X6Y A;  4PK4 A;  2VQG A;  2IMZ A;  1Y6I A;  4ZYA A;  4KIT B;  4YHX A;  1MMA A;  3FKJ A;  3BA9 A;  4BJ5 C;  4G6T B;  4XKB A;  4YEL A;  3NWT A;  4FAS D;  4BL0 B;  4LMY A;  3OS2 A;  5TGT A;  3OYC A;  4X0G A;  1X9N A;  2CS3 A;  3E1S A;  2VXD A;  3MXB B;  3OOR A;  4FM9 A;  2W57 A;  4B44 A;  2HPM A;  3EUA A;  1LWT A;  1BR1 A;  2IS6 A;  3OOU A;  3BG7 A;  3OR1 C;  3DU6 A;  1VDE A;  3MX9 A;  1UAA A;  1GPP A;  2X1C A;  3KYL A;  3K6G A;  2DOA A;  4CCM A;  3ONQ A;  1D1B A;  4BDZ A;  5AKN A;  2HDW A;  3DTI A;  2QKL B;  4Y3O A;  3N6X A;  4XLE A;  4X66 H;  1NG6 A;  2CUZ A;  4N4O B;  2CW8 A;  4NQW B;  1S9H A;  3D5L A;  4PJM A;  4UCV A;  2V7F A;  2MCT A;  1LDK B;  3LSI A;  2VS7 A;  2F4I A;  2OWO A;  4EFB A;  3AKZ A;  2BVL A;  1DGR M;  1X1A A;  4GKK H;  1DFA A;  1YX3 A;  2L5Q A;  4ZTJ A;  4EFJ A;  1N3E A;  3OIQ A;  4RB1 A;  2LRD A;  1MMG A;  3RJ0 A;  4Y4R A;  3MXA A;  3DPU A;  2CV0 A;  1SEI A;  1V5E A;  2ZFU A;  3DF7 A;  4DR3 H;  1IBM H;  3CF2 A;  2DT7 B;  2UXB H;  3OS1 A;  2X85 A;  3LL7 A;  3SYT A;  5CQE A;  1E0E A;  3UQ8 A;  2X1D A;  4N4N B;  2DCE A;  3ZGK A;  2VBO A;  3H20 A;  2X6W A;  4Z1Z A;  2WAF A;  2DCH X;  3C0W A;  2VBN A;  3LSM A;  4UN7 G;  2Q2E B;  4BU2 A;  3I3L A;  5I0A A;  4DIQ A;  3H0D A;  5A0M B;  4XLH A;  4KT6 A;  4AQU A;  3C0F B;  3UNG C;  3IUO A;  1HA8 A;  5FPR A;  2AQF A;  4LIV A;  4P5O A;  3FD2 A;  4CCN A;  3A1Y A;  4AAD A;  2VIX A;  2XF7 A;  2VKD A;  3OYL A;  3BAB A;  2UUA H;  4F55 A;  2VBN B;  3S32 A;  3GBG A;  3BCA A;  4GRI A;  2JVG A;  5KHD A;  1HNW H;  3HOS A;  2DJI A;  5A72 A;  2M3A A;  2W00 A;  4OWR B;  1UEL B;  4XLC A;  5HLT A;  5A78 A;  1X1D A;  3LML A;  4LQ0 A;  3K70 D;  2UUC H;  2WAQ A;  4U87 A;  3HKZ A;  4OZ6 A;  4XM3 A;  2QOJ Z;  2R7X A;  2CH0 A;  3MIP A;  3UR3 C;  3ZRG A;  4BEH B;  4C2T A;  3DTE A;  1AA7 A;  4J0M A;  3S3O A;  4DV1 H;  3MKY B;  5E5S A;  3PUB A;  3N44 B;  3VYU B;  2R4G A;  4DV0 H;  2F5V A;  2WE6 A;  3OWT A;  1BP7 A;  5IT9 W;  4BE1 A;  4AVZ A;  3H5R A;  5EOY A;  3MD2 A;  4CH7 A;  4CSW A;  4RLQ A;  2W7N A;  2IS2 A;  4AAB A;  2NOJ B;  3D5R C;  3H9J A;  5CPR B;  4DBR A;  1B04 A;  1P8L A;  4XNF A;  4DJA A;  4JI8 H;  2LBF B;  2FLD A;  1U0J A;  2W82 A;  1SFK A;  2MFZ A;  4PJN A;  3C2G A;  4DBQ A;  2R7O A;  2AB5 A;  3M8J A;  2HHH H;  2ZSI B;  1FJG H;  4B48 A;  2O03 A;  4JYA H;  2WY7 Q;  1MI8 A;  4K0K H;  4D6N A;  1DGW Y;  2IXS A;  1LWS A;  3MWM A;  1V5F A;  1AM2 A;  1N3F A;  2F6C A;  2M0M A;  3OYA A;  2HVR A;  1E4F T;  4UCS A;  3W2A A;  3TL4 X;  3DPT A;  1IRX A;  3OL3 A;  4XLF A;  1HNZ H;  2M4G A;  2LH9 A;  3RCO A;  1DQU A;  3IP4 B;  4AYB A;  2V6E A;  2GOM A;  1UM2 A;  4RAZ A;  5CQG A;  4PUS A;  4DV4 H;  1IBL H;  1TA8 A;  3HPH A;  4JI3 H;  3K4M A;  2K9L A;  4X64 H;  4LFB H;  4FET A;  1XMO H;  5FLX W;  2Q2U A;  3PNT A;  4EAT A;  3HOT A;  1L2Z A;  2Z2S B;  3LSG A;  1O75 A;  1D1C A;  4ZC3 A;  4J01 A;  3KAK A;  4RM3 A;  4O1S A;  3A2K A;  5FRO A;  2MC4 A;  4PFO A;  3L2U A;  2L7K A;  4E7I A;  1ERD A;  4LG3 A;  4A2A A;  1GLN A;  4CCK A;  4DR5 H;  3C0X A;  2JA2 A;  3FMA A;  4I7H A;  2KRC A;  2LY2 A;  3RSN A;  3MXB A;  3BC8 A;  3HYJ A;  2FE3 A;  3U21 A;  2I3P A;  2BOL A;  4RB3 C;  5HOO A;  2LG4 A;  2RQQ A;  4B3S H;  3V42 A;  4U7B A;  4NNJ A;  4NC7 A;  4H4K C;  1AN7 A;  3JSL A;  3H35 A;  3DKX A;  4LIT A;  5LFA A;  3E54 A;  3J80 W;  2VL8 A;  4AAG A;  2EX5 A;  2IN8 A;  4RB0 A;  5D1O B;  1A0I A;  5E5O A;  2UUZ A;  4UN7 A;  4LSA A;  4LF9 H;  4DR1 H;  2WBM A;  4JI0 H;  3E0J B;  4UNA A;  5LD2 C;  3T1H H;  2VJJ A;  2RNG A;  4C9Y A;  4XOP A;  4DV6 H;  4E4H A;  3OYK A;  3QOE A;  4HRI A;  3N40 P;  3VYT B;  3LSK A;  4PDB A;  4F92 B;  3W2V A;  4HG2 A;  4DUY H;  1WJF A;  1OLT A;  2CW7 A;  3L2R A;  3DU5 A;  2KEQ A;  4NXM H;  3OIP A;  2E1M B;  2R7S A;  1XMQ H;  1MMD A;  2VQH A;  2E5L H;  2XC7 A;  2IN0 A;  3IGD A;  3EUH C;  4IX7 A;  4DGW B;  3RGX A;  2PJR B;  5A0W A;  4MTE A;  3HYI A;  1X4O A;  3OYM A;  4CC6 A;  4BDY A;  3G2B A;  2HNH A;  4RM2 A;  3QYF A;  2ZM6 H;  1YE9 A;  1N34 H;  3D5S C;  4ITV A;  4XOR A;  4PSW A;  2BW3 B;  1U0D A;  1G8X A;  1BR4 A;  1VZ0 A;  4CCL A;  1MNE A;  2WB1 A;  3KX2 A;  5A0M A;  1EA3 A;  5AKF A;  4LH7 A;  2KLO A;  2HPI A;  3PL8 A;  3CZ6 A;  4XN3 A;  4AAF A;  3CVZ A;  2KZV A;  5KCM A;  4D9J A;  2CMP A;  3HG9 A;  4KL5 A;  3DKY A;  3QOD A;  4HSR A;  4EFE A;  4LF7 H;  5HVQ C;  4DV7 H;  2L2O A;  3M1C A;  1WJC A;  1X4P A;  4P1W A;  1WH2 A;  3L4K A;  4XMY A;  2R7U A;  3K3V A;  2XSJ C;  1QU3 A;  1S03 G;  5FRN A;  1FMV A;  3VSK A;  3JSN A;  2VB6 A;  2A5W A;  4BJT A;  1OR7 C;  2V4J C;  2XF5 A;  4II2 A;  4M7E A;  1FMW A;  2E1M C;  1P9Q C;  2R7Q A;  4XKV A;  4B47 A;  4APM A;  3LMM A;  1G9Y A;  2O7M A;  2MD0 A;  3BCB A;  4BEH A;  3RPU D;  5K08 A;  4UCT A;  4MLO A;  4EEQ A;  1Z3Y A;  2DXI A;  2IGK A;  4J00 A;  1ZEL A;  4UCR A;  3IAM 2;  1D1A A;  4II3 A;  3S3N A;  4O1R A;  2W1O A;  4E7H A;  4JI1 H;  1K6Y A;  1Z2P X;  4MV7 A;  2VBL B;  3OMY A;  3MKW B;  4LH6 A;  3BA8 A;  4D6O A;  2PMZ A;  2UV1 A;  4OAY A;  2ZJT A;  4CZC A;  1P8K Z;  1Z3X A;  2HQA A;  4BJ6 C;  3J81 W;  4LF4 H;  2LBF A;  3ZQQ A;  1WJE A;  4F93 B;  3TMO A;  3RF2 A;  4ANJ A;  1XDN A;  4A2B A;  1WJB A;  2HVQ A;  3FBI B;  5FD5 A;  4UCO A;  3L2P A;  4B3M H;  4JOM A;  3OYE A;  1W36 C;  2M7A A;  4OX9 H;  4IKF A;  4LIU A;  4MV9 A;  4XOT A;  2UU9 H;  2R7W A;  3EUK L;  1XNQ H;  2CV1 A;  2V26 A;  3OTO H;  3OYI A;  3ZCO A;  1N77 A;  4B3R H;  2DT6 A;  3EPZ A;  5A77 A;  2VLA A;  1TAE A;  5LL6 b;  3HC7 A;  4Y33 A;  4PJL A;  4XON A;  3QQY A;  1Y56 A;  2RRE A;  4XKW A;  2VPL A;  2VAS A;  1G59 A;  2HU9 A;  3OR2 C;  3RGZ A;  4DR4 H;  3PNV A;  3BG6 A;  2IS4 A;  5KNL A;  3KO2 A;  2MYS A;  4HNU A;  2IGO A;  1QHG A;  5CKT A;  4D1Q A;  4BAC A;  2IGN A;  2R7T A;  1FKA H;  3FDY A;  1D0X A;  3EH8 A;  3J7A K;  3OYN A;  1BJT A;  1KON A;  1TZL A;  1U0C A;  2LOO A;  2VQE H;  3SEQ A;  3AFH A;  1X1B A;  1BGW A;  5LMN H;  4JQF A;  3IG0 A;  4BE2 A;  2KP6 A;  4UT0 A;  1T95 A;  5HNF A;  1N36 H;  4UNB A;  2KMU A;  1AF5 A;  2Z1D A;  4IZZ A;  4RMN A;  2LQM A;  3S8P A;  3K4J A;  4JI5 H;  4BQN A;  2JSP A;  2ELJ A;  3I9V 2;  2R7R A;  1WJD A;  3DTK A;  1ZDE A;  3K4L A;  3W3C A;  3OYJ A;  2VS8 A;  4CA0 A;  2A6T A;  3VYS B;  3BLY A;  4E7K A;  2XE0 B;  5A74 A;  4X62 H;  1G9Z A;  5D1O A;  5BR8 H;  1WJA A;  2VUG A;  2ZXI A;  1S68 A;  2L9N A;  3PSI A;  4RZQ A;  1Z21 A;  2GOX B;  3K4N A;  4E2T A;  4RAY A;  2KRH A;  2O5R A;  2XAU A;  2ZSH B;  4UNC A;  3PNY A;  3AL0 B;  1T9I A;  3QYE A;  3L2V A;  4UFZ A;  4YEJ A;  1TT0 A;  4F52 A;  2K3P A;  3LSH A;  2YCH A;  4XKC A;  2IS1 A;  1VS0 A;  3ZXS A;  4DOZ A;  1YX5 A;  2JNQ A;  4RB2 C;  2M4K A;  1JVA A;  2WAE A;  4AQY H;  2WA0 A;  2X6X A;  5A2Q W;  5JHF A;  5E63 A;  2VOB A;  3MKZ A;  2OUM A;  4KIS A;  1E4G T;  4E7J A;  4UCU A;  3DQV C;  2PJR A;  1M0T A;  4DR6 H;  3DPL C;  3DLA A;  1FVI A;  1IBK H;  1HR0 H;  3SDB A;  4NXN H;  5HNH A;  1D0Z A;  3MMY B;  1X19 A;  4Z1X A;  2BW3 A;  2VJ5 A;  4QPO A;  4JI7 H;  1N78 A;  2X51 A;  2I3Q A;  1N32 H;  1LFP A;  4Z20 A;  2JVH A;  3HPG A;  1SAU A;  2VJI A;  4XL9 A;  2L9S A;  4ZDO A;  4JI2 H;  4DR7 H;  2UXC H;  3FHN A;  5FPO A;  4YIT A;  1MND A;  3DWL E;  3K10 A;  3J7A Y;  4BXF A;  5AK9 A;  2W4S A;  4CUG A;  4OAZ A;  3PFY A;  1WJ5 A;  2E5Z A;  2FUG 2;  3AL0 C;  3KXY T;  4AAE A;  1N75 A;  3OYD A;  4DUZ H;  3OYG A;  4UN8 A;  4DV5 H;  3F8N A;  2HZD A;  1J5E H;  2Q1Z B;  4E6K G;  2IN9 A;  3KEY A;  2K5C A;  2QKM B;  3PJR A;  1R7M A;  4BQQ A;  3K4C A;  4NUB A;  2Y0S A;  4B3X A;  2MAB A;  4BQO A;  1DGS A;  2XIG A;  2OC6 A;  2VJ4 A;  3OYB A;  1WFX A;  2UUB H;  1LVK A;  4HST A;  4E7Z A;  3SEZ A;  3K70 C;  3VSL A;  4KL6 A;  2VPS A;  3L4J A;  2E60 A;  4KJZ A;  1J09 A;  4JV5 H;  1MZB A;  2P0W A;  4IQ4 A;  1I6U A;  3QYB A;  1QHH D;  5FRM A;  1I94 H;  2VXZ A;  2VBL A;  2X1E A;  3OL4 A;  2VBJ A;  2Z16 A;  4XR6 A;  4E2U A;  1SYX B;  2KHM A;  2VQF H;  3CJQ B;  4HNT A;  2VQC A;  4RLF A;  3IFJ A;  2KPM A;  3OYH A;  3OOL A;  4HEA 2;  3F9K A;  3N05 A;  4AQX A;  2KSW A;  3M4I A;  3FBN B;  4UN9 A;  1HNX H;  1V9P A;  3JAM W;  4GKJ H;  3CP8 A;  2L8L A;  4LOX A;  4XN0 A;  5AKM A;  2OV7 A;  4BS9 A;  3H9G A;  2JUG A;  2HVS A;  2VBJ B;  3DEE A;  3N41 B;  4Q0Y A;  4CC5 A;  3IAS 2;  4PFP A;  3ZR8 X;  3K4K A;  1M0W A;  3VWB A;  2K9M A;  3TBI A;  3L2Q A;  2XDV A;  2VBO B;  4ETS A;  1Z7L A;  4GLX A;  2LWY A;  1BR2 A;  4QPQ A;  4UN8 G;  2LYC A;  4IQJ A;  4ZJZ A;  1X1C A;  4KHP H;  4CCJ A;  1B24 A;  5LMU H;  2LRE A;  2WYO A;  3OY9 A;  1PJR A;  3HL2 A;  1M5X A;  2UWM A;  5IWA H;  4YHH H;  4C2U A;  4MTD A;  4LF5 H;  4B3T H;  4LF6 H;  3NWS A;  4LFA H;  4R79 A;  1AT0 A;  2ZXH A;  2KL4 A;  1GYF A;  3S93 A;  3SZG A;  2WDT A;  2RGV A;  3W2W A;  1JI8 A;  2Q2T A;  4BGD A;  1UG0 A;  2XF6 A;  2HGS A;  1EF0 A;  4BUP A;  3VYR B;  4YIS A;  1T9J A;  3KAJ A;  1ZD7 A;  4LSX A;  4XQF A;  1N33 H;  3CJR B;  4B43 A;  4F3Q A;  4ZTF A;  3KAL A;  4C30 A;  3H9Q A;  4JI6 H;  4LFC H;  1MW7 A;  2I8D A;  3OYF A;  3H5A A;  2AQE A;  1V5G A;  4F91 B;  4UN9 G;  2LCJ A;  3UVF A;  3MIS A;  1ZHQ A;  3A4C A;  3T1Y H;  3K4B A;  4E7S A;  4E7L A;  4PJJ A;  5D1P A;  3PN1 A;  2UXD H;  3OS0 A;  2XE0 A;  2R7V A;  4DR2 H;  3RIZ A;  4XLA A;  4R7R A;  4HPQ A;  4ZDL A;  1LKX A;  2CUJ A;  3EYY A;  4BWS C;  2F4V H;  3HXL A;  3VDX A;  3RTR A;  4GIG A;  5FD6 A;  3BAA A;  2VQL A;  2IGM A;  4CCO A;  1BOB A;  4DV2 H;  4LF8 H;  1R6R A;  1T0F C;  2M7B A;  3C2H A;  3CP2 A;  1W36 D;  2CV2 A;  2E5N A;  5E67 A;  1ZHS A;  1Z2N X;  4AU7 A;  3L2W A;  2LY1 A;  3H5N A;  1DQ3 A;  1MMN A;  3N42 B;  2KDO A;  2RGR A;  2WAD A;  3RQ4 A;  2KQR A;  3HUG B;  4YRV A;  3NZM A;  3N43 B;  4JI4 H;  3RTX A;  4BE0 A;  4DV3 H;  4IAJ A;  2JMZ A;  3S3M A;  3R7P A;  2V9K A;  1XNR H;  1NG7 A;  4X65 H;  3CES A;  3PSF A;  1MOW A;  4YY3 H;  1DP3 A;  2LC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...