2CW7A

Crystal structure of intein homing endonuclease ii
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
537
structure length
537
Chain Sequence
SILPEEWLPVLEEGEVHFVRIGELIDRMMEENAGKVKREGETEVLEVSGLEVPSFNRRTNKAELKRVKALIRHDYSGKVYTIRLKSGRRIKITSGHSLFSVRNGELVEVTGDELKPGDLVAVPRRLELPERNHVLNLVELLLGTPEEETLDIVMTIPVKGKKNFFKGMLRTLRWIFGEEKRPRTARRYLRHLEDLGYVRLKKIGYEVLDWDSLKNYRRLYEALVENVRYNGNKREYLVEFNSIRDAVGIMPLKELKEWKIGTLNGFRMRKLIEVDESLAKLLGYYVSEGYARKQRNPKNGWSYSVKLYNEDPEVLDDMERLASRFFGKVRRGRNYVEIPKKIGYLLFENMCGVLAENKRIPEFVFTSPKGVRLAFLEGYFIGDGDVHPNKRLRLSTKSELLANQLVLLLNSVGVSAVKLGHDSGVYRVYINEELPFVKLDKKKNAYYSHVIPKEVLSEVFGKVFQKNVSPQTFRKMVEDGRLDPEKAQRLSWLIEGDVVLDRVESVDVEDYDGYVYDLSVEDNENFLVGFGLVYAHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endonuclease PI-PkoII
publication title Crystal structure of intein homing endonuclease II encoded in DNA polymerase gene from hyperthermophilic archaeon Thermococcus kodakaraensis strain KOD1
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 160
structure length 537
sequence length 537
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2005-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14528 LAGLIDADG_3 LAGLIDADG-like domain
A PF14890 Intein_splicing Intein splicing domain
A PF18714 PI-TkoII_IV DNA polymerase II intein Domain IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1010 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2cw7A02
2.170.16.10 Mainly Beta Beta Complex Endonuclease - Pi-scei; Chain A, domain 1 Hedgehog/Intein (Hint) domain 2cw7A01
3.10.28.10 Alpha Beta Roll Endonuclease I-creI Homing endonucleases 2cw7A03
3.30.1490.210 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2cw7A04
2CW7A 3HYJA 5A0MB 2VBOA 2AB5A 2VBLA 2IN9A 2I3QA 2VBJB 5AK9A 2IN8A 4OZ6A 4AAEA 1U0DA 1LWSA 1EF0A 2IMZA 5AKNA 4AQUA 4AAFA 4O1SA 5K08A 4UN8A 3KO2A 3QQYA 2LQMA 1N3EA 4O1RA 1M5XA 5AKMA 4UNCA 2I3PA 4KL5A 4UN9G 5A74A 3MIPA 3MXAA 2JNQA 4GIGA 1MI8A 2EX5A 1AM2A 2LWYA 1B24A 5A78A 4E2UA 1GPPA 4AQXA 1AF5A 2JMZA 4EFJA 5I0AA 2VS8A 3MX9A 4Z1ZA 4YISA 4Z1XA 3R7PA 5A77A 2XE0A 3MXBA 1DQ3A 1DFAA 1JVAA 1G9ZA 2IN0A 2VBNA 1N3FA 4UN7A 2VBOB 3NZMA 3HYIA 1VDEA 3C0XA 2DCHX 5E5OA 2VBLB 3EH8A 4Z20A 2CW8A 4E2TA 1T9JA 2O7MA 5A0MA 3IFJA 1R7MA 1T9IA 4D6OA 1BP7A 1ZDEA 3UVFA 2VBJA 5A72A 2VBNB 3OOLA 2VS7A 1P8KZ 2L8LA 3E54A 4LQ0A 4AADA 4LOXA 5AKFA 1U0CA 2KEQA 5A0WA 4UN9A 3FD2A 5E5SA 2LCJA 1MOWA 3IGDA 4UT0A 4AAGA 3C0WA 4YITA 5E63A 4AABA 4YHXA 5E67A 2FLDA 1UM2A 1AT0A 2XE0B 1LWTA 3MXBB 1ZD7A 4UNBA 1G9YA 3MISA 2QOJZ 4UNAA 3OORA 4UN8G 4KL6A 4D6NA 4UN7G
chains in the Genus database with same CATH superfamily
2W6OA 1XX5A 1U0JA 2OV7A 2XIGA 5E3NA 2LDUA 2VBOA 3N6XA 1YW9A 3PL8A 2STTA 1YE9A 3OIQA 2NYXA 2IN9A 2V6EA 5GONF 2NS8A 5D5XB 3RPUA 3EUHA 3F3XA 4CZCA 2KQRA 5ICCA 3AAFA 1EF0A 5IP6A 4G7ZF 4XRFA 1EZ1A 5IYCJ 3KO2A 1XMAA 2NU6B 2RVCA 1Y1VJ 3R6SA 2E60A 3RB4A 4NBQA 2EZIA 4YR3A 3H92A 3VFZA 2I3PA 4E6KG 5B5EC 4O2BF 3FDYA 4WXHA 3FXJA 4D5FA 3A03A 3LSIA 2A07F 2M8GX 1AU7A 1EUDB 5IOYA 2XAQA 2JPBA 4M6XA 1JJ8C 3JRXA 1ZH5A 2JMWA 3I4MG 4XX0B 1TC3C 1K61A 1XMQH 2YX7A 4UCUA 3VMMA 2A6TA 4ASNA 2YR2A 5JVDF 4FE7A 1JKRC 4I55F 1BOAA 4YR2A 3GTJA 4B47A 2PJPA 3KXYT 3V6KA 2EJRA 4XL9A 5J1YA 1DFAA 4MGRA 5BPIA 4M3DA 4P5OA 2ECBA 3BJYA 2J6SA 3H4DA 2VN2A 4KZSA 3PR5B 1GVDA 5M5XJ 3J81K 1I7NA 4OAYA 3TO9A 5C1PA 4JI6H 2CG4A 5F6FA 5HOOA 1Y56A 4A3BJ 4Z20A 1ZREA 2C2DA 5DEQA 2DN0A 1DP3A 5FRNA 1EJ9A 1ZN2A 3H0GG 2YS9A 4C2TA 3MJFA 4DR6H 5CKTA 3HGYA 3M9MB 5B1BH 2MH2A 2R92G 3FXMA 2H6BA 3HOUG 1CF7B 2FNAA 5J2TF 2HNHA 3I54A 4BY1G 2JEFA 3REOA 3D5RC 3WO1A 5KFIA 3KAKA 3AL0C 5EOYA 1CQIB 5KCMA 1QPIA 2ZO4A 1R1UA 3HEFA 4RA2A 3LSTA 1RR7A 1SAXA 3BG6A 2KEQA 2VBWA 4DV2H 3H0GA 4ANJA 3TL4X 5DQHA 2BYVE 1W96A 4D9JA 4OAZA 1FSHA 2OJED 3TW7A 3QZ8A 1TWAA 5D5UB 2FK3A 3CO7C 3H5NA 3A2KA 2LKPA 4WXDA 4TV9F 5F1RA 2E2HA 4ME6A 3TMOA 3G71I 5E67A 3OS2A 1VBGA 3G3ZA 1U5TB 4GGGA 5CAEB 3W6KB 1R00A 1LVKA 3K70C 1UB9A 1IO2A 3FXUA 3OS1A 2YS6A 5E1XA 1ETYA 1SFUA 3BZKA 2LOOA 4PFOA 3T1BA 4AUXA 4IWYA 1W7PB 4XRSG 5I47A 4ZZLA 3JSNA 4EYIB 5KFMA 4AQYH 2ZJ2A 3MZYA 2M8EA 3OYAA 4UNAA 4UUVA 5HDKA 4A3IJ 1IV6A 4UN7G 5FROA 1SVOA 4OINF 2R85A 5KG7A 1WJEA 3QRFF 4CCLA 3T5LA 4X62H 2RREA 2WAFA 3QPHA 3P9CA 1VNDA 2AHQA 5LHHA 3M1EA 1XNQH 3DTKA 1ZRFA 2V79A 3TO7A 3PIPF 1YITI 4J9NA 1OYWA 2VASA 3GFJA 2FOWA 2XSJC 4L18B 3KHRA 4X1EA 2H1LA 2IMZA 2YU3A 1BI0A 4BL0B 3HM5A 4XKBA 3JSOA 2W8KA 4O4LF 4Y52J 1K4TA 4A3KG 4CHUA 1Y1WA 2W84A 2R87A 2WDTA 3HSFA 1D0YA 2LYCA 4QWQA 5FJ8J 5AKMA 4YBZB 4IHYA 5BR8H 3VEPA 1OLTA 4LIVA 5TISC 2X6OA 4J00A 3V4GA 4U0YA 1IRZA 1MJBA 4G6DA 3GV8B 1AM2A 4XOTA 4DYCA 1I6HJ 5K1YA 4XK4A 1CQJB 2Z1DA 1GUUA 4HYEA 1MBKA 2W48A 4BACA 2LF7A 1IJWC 2X6XA 1V4RA 3CF2A 3KP6A 3MD2A 2L9SA 1VQOI 4Z1XA 4XONA 1U6GA 2RDPA 4CA0A 3TIGA 5F64A 3GBGA 2XRNA 2WB1E 1MMSA 2KJBA 3HOVG 2CRGA 5KFQA 4YJ3F 2W70A 3EPIA 3NZMA 1Z1DA 4F50A 1U9NA 4BXFA 1Z77A 1ZRCA 5HS8A 5KFTA 4AYBE 2ZSHB 2AGOA 1FBUA 3RAXA 3KX2A 2NVYJ 3V8JA 2F4LA 4ITVA 4XN0A 3BR6A 2EQRA 3ABUA 3CCJI 4Y8VB 3ZQIA 1ENHA 4HW0A 1SC7A 1ZDEA 2XD4A 3G6YA 2PFBA 2GXAA 3BG3A 3FIWA 5L3FA 5M5YJ 1OKRA 2L02A 2C00A 3BQYA 2JVHA 4IRIA 4QW9A 2GOXB 3IC7A 4PZJA 3JCUC 2V7FA 4YIFA 3A1YA 4ZHQF 1WCMG 1E4GT 1HSTA 3X2QH 2DLNA 3IUOA 5H6RA 2GQQA 3FD2A 1YLFA 5DLFA 1QPMA 3CCYA 3IG0A 3OMYA 2YSRA 1WQ2A 3E7LA 5E1ZB 2HPMA 3K5HA 3RQ4A 2K9LA 5FO5A 1YIJI 3AKZA 5F08A 3QYFA 2JUCA 2HI3A 4A3JG 2D2WA 2PMHA 3PO3G 2KISA 3K3VA 1OJLA 1MMNA 1P2FA 5D5VB 4E7ZA 5LEKA 5CPRB 4QW8A 3F8MA 3K4JA 1UG0A 2X85A 2ZXHA 3DBRB 2R5ZA 1T95A 2WAEA 4LJZF 2GZWA 1QRYA 3O6BB 1JI8A 3OIPA 3DXJF 4L5IA 5E79C 1JIHA 3DF7A 1N34H 1E4EA 4IXAA 3J80W 1CE8A 2P81A 5J40A 1E2XA 2KPMA 4KL6A 3N41B 3V6JA 3GO5A 3M7GA 4RB2C 4LSAA 3BJ6A 5HBRB 3PN1A 1G4DA 1F4KA 2DT5A 1SD6A 2G9WA 3HSEA 3OIOA 3I9V2 4UCSA 2M0CA 2YU9J 3I5UA 2W9CA 4RB0A 3I4MJ 4ZYAA 2RC4A 2JA8G 3HXLA 3EETA 3LOCA 2M87A 2LRDA 3QFFA 1OR7C 2VA3A 5C44G 5F27A 2HYJA 3H5RA 4BKXA 3GIMA 2I8DA 4E7LA 3QYBA 5IYDG 4OMYA 2CYYA 3LSGA 5GTHC 5LGTA 2KDZA 1HW2A 1AKHA 3OYGA 3WTUC 5BPFA 1KU3A 4UUTA 2FMAA 2DPDA 4UCTA 3IAM2 3T1YH 1IW7F 3GTOA 3NAUA 2F4OB 3OR2C 1Y8QB 3RB6A 3G6EI 4Q8FA 2K9MA 2HVSA 1VQ7I 4KL5A 2FQ4A 4P9UA 1HLVA 3RTXA 3MZ8A 1RRJA 3OHAA 4F52A 1BBYA 3BQ0A 4UVAA 3L4JA 3BR3A 2XAJA 4NUBA 4OIQF 3NEUA 5L3DA 3V7CA 2D1VA 5EEAA 2TDXA 1ZQ3P 5IT9K 5KFZA 1R9TJ 1K7AA 2TCTA 2R8JA 1KU9A 5F0FA 3ZOBA 1E0EA 1IGNA 4RAGA 3KETA 2D1HA 3CCMI 3WU1B 2WWYA 3RKQA 2FSWA 4BY1J 2VQDA 3B6CA 4ZOLF 2BV6A 4UCRA 3MAJA 2PMZE 3PW4A 4JOMA 1D8KA 3I59B 3BTJA 3EYYA 3HL2A 5E3MA 3NGDA 2IRFG 2WB1N 2HTJA 2G0EA 2OU2A 3Q8PB 1J0RA 2NVXA 3HOYG 4MAMA 4Q8EA 4BBSJ 2H8WA 4IZZA 4HYKA 1GYFA 4HQMA 1FYKA 2LC2A 3ROUA 5EDNA 5KFVA 2EFQA 2Z9OA 2Q0OA 4A3FG 2LTPA 2NVQJ 2R4GA 4ZDOA 2MSYA 1BA5A 2P5LC 3I4NG 2AXLA 3I55I 4XLFA 2JA7G 3N43B 5HVQC 2D45A 5JLXA 2LMDA 1R23A 1VS0A 2R7ZJ 1TL8A 2JEGA 4J0MA 4FHTA 4U87A 4BQNA 1EF4A 2DW4A 3MWEA 2KIUA 2ID3A 5KFBA 1QZYA 1ZLJA 4OMZA 2CV1A 4E7HA 4RU9A 2K40A 2MW8A 1FVIA 5LA6F 4Y3OA 5LD2C 1N33H 1PYVA 3FMSA 4I4TF 2HS5A 5GAHJ 4A2AA 3OS0A 4YFKF 5CVUA 4JV5H 2VBZA 2J5OA 3MKWB 1W5CC 4C2UA 2OBPA 1U9OA 3MXBB 4M6YA 3ABLH 4S05A 3LSKA 1NK3P 3S2WA 3T8TA 5AIQA 3CD6I 1T98A 3DKWA 3ZR8X 3LAPA 4ED7A 2NOGA 1W5SA 2MCTA 1RNLA 1WVRA 3H1CA 3GFIA 1FT9A 4A3KJ 4HSTA 1PP7U 4BBRG 5A2QW 4M9SA 5KFDA 1WH7A 4NHJA 1VI0A 1PK8A 3J80K 4IL6C 2L2OA 1DP7P 3TP3A 4D6NA 3HZJA 5FPRA 3CP2A 4LH6A 3F72A 4RAYA 4KITB 2MLGA 1FTZA 3PVXA 4LLNA 2IS4A 3DBLB 2XASA 5CJ9A 1FJLA 4J19A 2LY9A 4PJ0C 4DUZH 3RJPA 4HDUA 4Q48A 4C30A 3VOEA 4R1HA 5AK9A 1U0DA 2YS7A 2DO7A 2ZXIA 1ZTRA 2R7LA 4J9MA 4ON0A 3ZQFA 2BVLA 2V6CA 2Y0SE 5J8FA 1S9FA 2E1MC 1WSCA 4PDKA 1CF7A 2ESNA 3DF8A 2DWCA 1OCOH 1TWFJ 4BWSC 3KLOA 3HOVJ 3MFHA 4P55A 2RGRA 2R7KA 4XYMB 1DGSA 3BTIA 2BY1A 3K1NA 2E35A 3OYKA 1OWTA 2YZNA 1N25A 4V19K 3RCOA 2FB9A 3ZQHA 1MI8A 2EX5A 5A78A 2FJ1A 1I1SA 2CW0F 3WG7H 1W7PD 2F5FA 3G4SI 4K0KH 4UV8A 2W6MA 2DJNA 3FMQA 2VJJA 3SXYA 2OD5A 2ZCWA 3G73A 3BTLA 5B1AH 2A5WA 3GUDA 1U5TA 1P4AA 2AQEA 3NQOA 1HCRA 2EZHA 5EZHA 1VQMI 3G1LA 1Z6RA 1GVJA 2H94A 2IS1A 4TV8F 1O57A 3CC4I 1R7JA 1W7PA 3K4LA 5J8CA 1M1EB 2P6SA 3LSRA 1KYWA 3S15J 1ZYRF 3H3VK 1MBFA 3HC7A 2YRWA 4B43A 5FPOA 4GYIA 1BOBA 1WRJA 2X48A 4A3JJ 4X66H 2H8RA 4J9LA 2K5CA 2MC4A 3PO3J 1S0OA 5F0CA 5FFXA 1USTA 2XGEA 2I80A 4PSWA 1X3UA 1H89C 3Q8SB 4RLQA 1JUMA 2V1NA 3IWFA 1SD7A 4ECWA 2JZYA 3FXOA 4JI4H 3ESWB 2CGPA 3FZVA 2HYFA 1TTYA 2EFWA 5IYCG 1OFCX 3F8BA 4NQWB 4LB6B 2LBFB 4IKFA 4DOZA 1DIKA 1Y1VG 1O3TA 1GSHA 3LA2A 2P5VA 4YELA 3SEQA 3D0SA 4HNVA 3L2VA 4EGJA 3LQRA 1LFUP 4O2AF 1LPQA 1T0FC 1Z7UA 5GAGJ 1MOWA 2YW2A 2ZBKA 2QQBA 1XCVA 1V3FA 2X1EA 2VPSA 1TWHJ 1ZHFA 3GTPA 5J1RA 2R92A 3IH4A 2EH3A 2NAZA 1D1BA 3H0DA 5C44J 3GQCA 4KIBA 3PO2J 3KHGA 3ABKH 5IYDJ 3CUQC 3GZ5A 2L4AA 4XN3A 2E5ZA 4FASD 1WSUA 2QENA 2UUZA 1J5EH 2L9NA 3ECHA 3QP5A 4M3FA 1KZHA 5EJCA 5A2QK 4U7BA 2L9VA 1SFOJ 2C35B 4WWCA 1KA8A 2FBKA 5C5JA 4L5EA 3RIZA 2ZDGA 3F8NA 1TW3A 3N40P 3RBEA 1J75A 3VYRB 1BJTA 4BYYA 3G1OA 4MQ9F 5K7FA 3TDUC 2BQRA 1LNWA 4A3BG 2PJRB 1YS6A 3GMEA 3A01B 2QQ9A 3FKJA 3KTMA 3K69A 1PJRA 2M30A 2HR3A 4FBUA 3J81Z 3PQJA 3ZPLA 3EUHC 2WB1A 3ASNH 3E97A 1E3OC 2VPLA 4L9TA 5IYZF 2W7PA 1RKTA 3SYTA 3A4CA 3I64A 1ZR4A 2VBYA 4JX4A 2Y0SN 1S29A 1WH5A 4MFEA 4DZJA 5LHIA 1MW7A 4XRSA 1T39A 3P9KA 2R6FA 3AG3H 4AYBA 3RGZA 4L9VA 4A0YA 4O4IF 2R8IA 4BE1A 5GPCA 4RB3C 4JQFA 4DBQA 4UN9G 2R7MA 3SI8A 3LFKA 2FLLA 3GTKA 2R7NA 1BM9A 1NTCA 3MXAA 4CO8A 3RIRA 2PG4A 1JDEA 2E2IA 1SFKA 4AVZA 1JKQC 4FQGA 4X0GA 4EGZA 2RV8A 1B24A 4A3FJ 3G6XA 1WGXA 2NUAB 3Q8QB 1B9MA 1LDJA 3AYHB 4J9QA 4UV9A 2Y9ZA 1M0WA 2HOSA 1MJ9A 2JA6A 2JA7J 3TDZC 1LB2A 5A77A 1QGPA 4NC7A 3K9TA 4DW6A 2P5KA 1QVTA 3LP8A 3HGGA 2KIQA 3DQVC 3BCBA 2IN0A 2K9SA 1HA8A 1X1CA 3PJRA 2IJLA 4A5MA 3SJMA 2JEJA 3H35A 3CCEI 4YY3H 2HQ5A 4A3IG 4HZFA 4UB6C 2ZXWH 2R7OA 3MR3A 4P9FA 3HG9A 3JRFA 2MD0A 2DTZA 3WGHA 2G7UA 3OOUA 3TKYA 2DMQA 4M72A 5K5QA 3IFJA 5D1OB 1OCPA 5KG6A 4HDVA 3LFUA 1MNMC 4PSXA 2E34A 5KK1A 5C4JJ 5LGUA 2OTLI 3R5XA 3ELKA 5KG1A 1KQ0A 3E6BA 2DFFA 4GKJH 4LITA 2EA4A 3E54A 4X65H 3ASOH 4C5BA 4TQRA 3R5FA 4BY7G 4BBRJ 2E7XA 4RUAA 1MZBA 2JA5A 1U0CA 2ZM6H 5A0WA 3CDIA 4YAJB 3U9GA 2A69F 3D1NI 2W57A 1K78B 4A3CG 2LP0A 4MFDA 1VKZA 4AAGA 3RZDJ 2B63J 3QU3A 2UXBH 1S7AA 2EFOA 2L9RA 3PUBA 5ICGA 4YITA 1S68A 1M0TA 1RETA 3E6MA 2CMPA 1AA7A 2PVPA 3C1DA 4U0WA 4NDLA 1RJRA 4ECTA 4KNYA 2EWNA 5LRRA 4ECSA 2FK1A 4LSXA 3KE2A 4UVBA 3IL2A 2V5AA 1MKMA 3DBHB 1GDTA 2FJZA 3GIQA 3O8HA 2O8XA 3OYIA 1WCMA 4G7HF 1G9YA 4MV7A 3FM3A 2FLPA 5ILSA 1H88C 4HPQA 3BZ6A 2DPJA 5KFOA 4UN8G 4BAYA 1NK2P 4BXXG 3I59A 4I76A 1L0OC 1T0FA 3SZTA 1WH2A 3KALA 2GIVA 5A0MB 1IN6A 4PJLA 4DL5A 2ESHA 2BZTA 3N44B 2DU9A 2HDDA 3JRDA 3H3VH 5EDWA 2R5YB 3CC2I 1T3NA 3BJAA 4HEA2 5E1WA 2FQ3A 2I3QA 2W8LA 5KT3A 1P6RA 4LD5A 2PMZA 3BR0A 3ZCOA 3K3PA 1VQ6I 1RC9A 2J5PA 3QYEA 1IV8A 2O6GE 4EEQA 1FWZA 2VQGA 2A68F 1K83J 3NWTA 3H4BA 4LF4H 4BDYA 2OCEA 5BPDA 4IHVA 4KYWA 3GILA 2C2EA 2PLYA 3HRUA 3VODA 4GXOA 4Q45A 3GEZA 2E2JJ 1ZK8A 2VJIA 1M5XA 5CVRA 1GSOA 3LSHA 3CCLI 1AN7A 1JTYA 3M4IA 5ICFA 1ACIA 4IHWA 3ZMTA 2XF7A 1FP1D 2BBYA 2FBHA 4LG3A 1MDMB 2BVMA 4BGDA 2WTEA 3H9GA 1ITYA 1X1BA 2CV0A 3N42B 1USSA 5GTIC 4E7KA 2NS0A 1NH3A 2HZDA 2UUBH 1ULYA 2VKDA 4HV5A 5ILVA 1BGWA 3I56I 3Q9SA 4EFJA 1B6SA 3D5LA 4LH7A 4I01A 5EEGA 3MX9A 3R7PA 5C1OA 3GTQA 1UHSA 2VUMA 1R1VA 3MXBA 2HU9A 5CA0F 1PX2A 4BJ5C 2NS7A 4RGRA 1ZELA 2VE9A 2R7QA 2XGCA 4PJNA 2W9BB 3FXRA 4KUMA 2BHZA 3P9IA 4KN4X 4RGUA 3ZQ7A 3WTWC 4EJTA 3RF2A 5KT2A 4DR4H 3KP7A 2C22A 4PK4A 4IZOA 2WTFA 1FZPB 2VOBA 1V4YA 1Y8RB 2BQUA 2HOAA 2CUJA 3CQZA 1I3QJ 3K4MA 1R7MA 3VYUB 3BCAA 3CLOA 1STZA 4C3JJ 1Y0NA 2OAZA 4BEHA 4DR2H 4DR7H 1UELB 5LEJA 3KZZA 4HR7A 4ECUA 1E3PA 3KEQA 2MABA 3GTMJ 1A36A 1S72I 5DLGA 3CMAI 3I12A 1BNCA 2LK2A 4AADA 2ID6A 5D6EA 2E71A 1IG7A 3T8RA 3LMMA 4CUGA 3AG1H 3DEUA 3TOBA 2KFDA 2FP4B 4WK8F 1YHQI 3JRAA 3ZRGA 4B09A 1I50A 2F4MB 1R5HA 2KSWA 3QOEA 3V6HA 4A69C 2K7LA 4OX9H 3BLYA 4PFPA 2DA4A 1V9PA 1LKXA 2XV4S 1FBQA 2Y0SA 3IH3A 4EJUA 1U78A 1IOVA 4XRMA 1VF9A 2MFZA 1QZEA 3KYDB 4ECZA 4BQQA 4EQQA 1PUEE 2AS5F 1TWCJ 1JXSA 2P7CB 1K1QA 4MV3A 2Z99A 2BW3B 2FPIB 2HKOA 5IY5H 1HKQA 4RNMA 3KCCA 2OH2A 4DV5H 3FHNA 3L2RA 1D1AA 2X9DA 1HF0A 5F0HA 4HAMA 1UJ8A 4L0ZB 1XMOH 3OYBA 4MIMA 5JQWA 5LOVF 2F4VH 1X3WB 2E19A 2CV2A 4LLGF 2CQKA 1VFCA 1MBEA 4BBSG 3RB0A 2V9WA 3WU2C 3SE7A 5E3OA 1D1CA 1EV7A 1Z67A 2VE8A 5HV6A 2OWOA 4R7RA 1EH7A 2CFOA 4I99C 2IGOA 3C2BA 3JTGA 1WHUA 1RESA 2C2RA 1FBSA 3J7AY 4ED2A 4EEYA 3FK7A 3WODF 4WBNF 2WADA 2V59A 2Z33A 4AQUA 4QPOA 4LFUA 3GTLA 2VONA 2L54A 3I3LA 1MSEC 3VPDA 2W6QA 4KHPH 4KICA 2V1XA 1MMAA 3O2PE 1XPXA 2UXNA 4F3QA 4NQWA 2LBFA 5A74A 2AQ4A 2DPIA 3C3WA 2WC2A 3HOSA 1MD0A 2QBYB 4WCGA 2V1DA 3KHLA 4JX6A 5M5WJ 4E2UA 1FJGH 3PQKA 2DI3A 1ZETA 4XLHA 1EYZA 4BXUA 1V51A 4ESJA 2GXBA 4E7SA 4IRCA 2W85A 2DOEA 4Y13A 4YISA 5CB4F 4JI2H 5L3EA 2YL2A 4DV0H 3KHHA 2VC1A 2ZB9A 3QQAA 5D6FA 4BY7J 1YJ9I 5IPAA 1TQMA 4F4YA 1YIOA 3I4PA 4YFXF 4FX4A 2IMWP 4M3EA 1QA6A 3R60A 4QLCU 1UZCA 2KMUA 2QGUA 5E5OA 3BABA 4A3CJ 3PW0A 1IAWA 3DU6A 1VQLI 1BR2A 2KIMA 5IT9W 3ORRA 4NC8A 5HDNA 1G2HA 2J9GA 1D8JA 4O6JA 3OYDA 1TWGJ 2GOMA 4HQEA 4ENKA 2PJRA 4XM3A 2P8TA 3J80Z 4C5CA 4FT8A 3A01A 2M0MA 2XHKA 3FKIA 3VPCA 3J7AO 4DUYH 2VBNB 2X1CA 5KT4A 2VS7A 4ZDPA 1IRFA 4HNUA 1AOYA 3BQZA 3KEOA 3TQTA 4ECVA 2O3FA 1MH4A 5E8GA 4ZJZA 1KGSA 4BXXJ 1HXDA 3GZNB 5DYMA 1B59A 4EMSA 4HQ6A 3TGNA 2W9AA 4NXNH 4XOPA 1G3TA 3CTAA 3K4BA 1OPCA 2LREA 1D3YA 2F2EA 3R4KA 4PGGA 2R7RA 4JI8H 2C6YA 3M9OB 5KG3A 1I39A 5M3FJ 4G94A 3K4CA 4A3EG 2OQGA 2KIFA 4MV6A 1MBGA 2Z2SB 4YIIA 4YHXA 1M6VA 1EA3A 3BG9A 4E7IA 4CCOA 1J7KA 2ISZA 2R7TA 1FIAA 2EIKH 2OCCH 3S3OA 1ZD7A 3UQ8A 1U2WA 1Y1VA 2R86A 4CCNA 4XICA 4H4KC 1AUXA 1Z05A 4RS8A 4IJAA 3ZN0A 2CJJA 2F5CA 4D1QA 2R84A 3OORA 1SANA 2RGVA 2K02A 2QF7A 3L9FA 2MD5A 4XIDA 3U21A 1VQNI 5KG5A 4EYHB 5T14A 2ZC2A 3D5SC 4IQJA 4RUCA 1G8XA 4XLPF 5C3EG 4Y7NJ 3TQNA 4GRIA 5KFYA 5FKMA 2CH0A 4AM3A 2K86A 2ZFWA 1PDNC 2IP2A 3EPZA 4L0YB 3SDGA 3GIDA 2ZJPF 1V5EA 1G6NA 2IN8A 1LDDA 1GV5A 4IHSA 5D1OA 4IRGA 4LF6H 2DA3A 4IR1A 2JWTA 4PGHA 4DV6H 2LKSA 3LMLA 3Q9VA 1VQ5I 3S1NJ 1S97A 5JLWA 1RKWA 3M07A 4MV4A 3U2RA 2JUGA 4GC6A 1LQ1A 2DYSH 1V55H 2XPUA 1N3EA 3OTOH 2ECCA 4BJTA 5KAIC 4HRIA 3CMMA 2AO9A 5CVJA 3VPRA 1Q1VA 3MR5A 4DV1H 2DA7A 2STWA 3OYCA 4EFBA 2KKOA 2DFEA 5D8LB 2ZNYA 3CDLA 1IN5A 1K78A 3W6VA 1YYVA 3F8CA 1QZZA 2L4MA 3S1QJ 1T08B 3K4NA 1K1SA 2DFHA 5JVGF 1PUFB 4F4WA 1GXPA 4AQXA 2UVUA 5KKNB 3Q3SA 4BS9A 1RUNA 1S9HA 5KFHA 2IA1A 5EWGA 4AIDA 4Q0YA 4KDPA 3PO2G 3H20A 3OSPA 5DG8A 3E0JB 4YP3A 5H20A 2O8KA 3GTGJ 1U5TC 1QHHD 4GFBA 1APLC 2R82A 1J2XA 1YG2A 3CP8A 1WJFA 5C4XJ 4ESFA 1EH6A 1QQIA 3FMRA 4LK0F 3MZHA 3FF5A 3TBIA 4LG0B 2VUGA 3S16J 4DQ2A 3SHFA 2VBLB 4IEJA 2DT6A 3NRVA 1JJ6C 2O7MA 2HQAA 3A02A 3FBNB 2O61A 5A0MA 2XUBA 3RFCA 4UHTA 1XGSA 4QFQA 5A2QZ 5KX5F 2R5YA 4LFCH 4UCOA 3TOAA 3MMYB 3TEDA 3DTIA 4IQ4A 2BHYA 3DKXA 2K4JA 5KG4A 2ZXJA 2ZSIB 3K7AJ 2AU0A 1T56A 5DGBA 4JV2A 4CYDA 3E5NA 3ML6A 4G6TB 2OA4A 2HWVA 5AONA 1Y6IA 1Z0XA 5J6XA 4YIRX 2XKOA 1FSEA 1ERDA 4NXMH 3CVZA 4DL7A 4YEJA 2KP6A 5ILUA 3GF2A 2EZLA 2XKPA 2H1KA 3F8FA 1XCBA 5E20A 5E5SA 3AG2H 2V58A 1MMDA 2VQLA 3C18A 2EIMH 2EPFA 1YI2I 2WY8Q 3K0LA 4Z6YA 4E7JA 3C0WA 4O3QA 4AYBN 1P8LA 3HDDA 4YFNF 3GCMA 4XZ3B 1YX5A 2E1OA 1V54H 2NNYA 1MDMA 2RDJA 2Q1ZB 4IR9A 2WV1A 1QBJA 5FFZA 2UV1A 3S3MA 3QP6A 3BOQA 3J7YJ 1Z6TA 4O3OA 1XSXA 2CUEA 4WF2A 4GKKH 2Y0MA 2DFIA 4Q4ZF 1UNNC 2VKVA 4DV3H 1SVLA 3CZ6A 4OIPF 2DXIA 2P7VB 1FKAH 1YQAA 1LDKB 2CQNA 4GLXA 5DUIA 5E17F 4BE2A 2XAUA 1X3ZB 3GIPA 4CC5A 2DBBA 5CA1F 2W9BA 3EQLF 1RJPA 2KRFA 3WE2A 4QIWE 2XPVA 5IP7J 4A6EA 1W0TA 4IHJF 2QVOA 1HDPA 2JRTA 4RM2A 1LE8B 1QHGA 3QPLA 4II2A 4LGWA 3ERED 2EINH 5KFGA 2VBJB 3PNVA 1LFBA 3PR4A 2XAGA 3HPHA 3SFZA 4FS1A 2ZJTA 2L7FP 3Q5FA 2ZJRF 1BW6A 1R58A 4XBFA 4MA0A 3A0HC 4FX0A 1S10A 2VQCA 2CSOA 4UN8A 2FMLA 1NG7A 4PJMA 1IBKH 4DV4H 1K6OA 3C7JA 4HF2A 4D7NA 4O1RA 2IGKA 3KAJA 1EH8A 1TT0A 1A35A 3HUGB 4ENNA 3MIPA 2V9PA 1ZHSA 4RGXA 4EJWA 4UUSB 2NVYA 4N4NB 4IPAA 1MSFC 3M9NB 2B63G 2COMA 5CVIA 3OWTA 3H5AA 4B1RA 3JREA 2A61A 2XROA 5E18F 4LF9H 2F5EA 2R93J 3N4MA 3KP3A 2HQNA 1AF5A 4O5VA 4CYCB 4EGQA 1RYRA 5KFRA 5HLGA 2W82A 3K1PA 4HBLA 2A6HF 2XDVA 1K4SA 1DPUA 3FDSA 2RQPA 3FBIB 2IW5A 3DPTA 4H0EA 2FPPB 2BW3A 1FPQA 3O3KA 1KU7A 3TO6A 3K2AA 5IOZA 2QSFX 2ZKZA 1IUYA 1GO3E 3C0XA 9ANTA 2DCHX 3GLXA 2X6YA 1IXRC 4U7DA 4ENMA 5F9NA 3BQ1A 4QWAA 1ETKA 1IN8A 1HW5A 4M9XA 4A3EJ 3GIKA 5FKKA 3TQ1A 2BY0A 1HKTA 4DV7H 2HVQA 3DTEA 1UC8A 2KZVA 1ZG3A 1JT0A 4ED8A 1ZRDA 1HW1A 2JK3A 3GFLA 1XGNA 3E5UA 2PMUA 2W7NA 1FYMA 4CGZA 5JHUA 2ASLA 1S8NA 2VT2A 2DT7B 1SAUA 1IDZA 2YX4A 4M73A 2O03A 5FKNA 2JQ7A 1O3SA 4AIJA 5HDGA 1JKJB 2X0SA 4EG0A 4A2BA 1ZARA 2K3FA 5KG0A 1BJAA 1BR1A 2PMZN 4TUYF 2JA5J 1Y1WG 2F48A 3M1CA 1KYZA 2L7ZA 1IXCA 2QM3A 3WTXC 4DNCA 1B04A 1QVUA 2LCJA 2QLZA 2VI6A 1V5GA 2M5WA 2XB0X 3EUAA 3L2UA 1D5VA 3RB3A 5C3EJ 5DG9A 1N75A 2LG4A 2OPTA 4RDUA 2YU9A 2ELJA 2J6UA 3HIFA 1BC8C 3OL3A 1U8BA 3T5KA 5L1LA 4IF4A 1UMQA 1MMGA 1YOVB 2QBYA 2ZDQA 3KFWX 3VSKA 3K10A 2M4KA 4B3SH 5FKLA 3JAMW 3S2HJ 4MHGA 3ZXSA 4J9RA 3FX3A 3K1MA 3DU5A 3GV7B 2R8GA 3IH2A 2M9HA 2CQYA 3SEZA 2Y48A 1S03G 2UWMA 3VPBA 2HOEA 2NU7B 3LQQA 1POGA 5K5OA 1XGOA 4C2MJ 3M8EA 5GADJ 3BR1A 4NB5A 4U88A 4JI7H 4B3RH 2RKHA 1I27A 2YUSA 1A9XA 3S1RJ 1FEXA 2AB5A 1XMKA 2FUG2 2JA2A 5ERIA 1RI7A 1Y39A 3RV3A 1R9TA 3IV5A 3RJ0A 4I50F 5DM7F 1P7JA 3FK6A 1X1AA 1YJNI 4LX3A 2PBIA 3ABTA 4E4TA 1VQPI 2ZMEB 5EYRA 4ZYGA 1JT6A 1N78A 2NU9B 5HS7A 3TIIA 3OYFA 2QA4I 4EEFG 2OLSA 3PIOF 2AGPA 4S0HB 2PX9A 2VR1A 2P4WA 4JP0A 1BL0A 2ELHA 3IP4B 1HBXG 3QQYA 5EG0B 2KRHA 3GIJA 1Z91A 4XR6A 3RZOJ 3N8DA 3GLKA 3RDIA 3OYEA 3OYJA 1S0MA 5DCFA 2VKHA 5F1JA 3Q1KA 4ECRA 4K2EA 4KMFA 3R23A 2IPQX 5L1IA 1VQ9I 2DDBA 5AIPA 4DYQA 5J4YA 4DYRA 3I0TA 2C28A 4G6QA 4RBOA 3JZIA 4R8UB 1W4MA 3WGGA 1XDNA 1JGSA 1YS7A 3TP0A 4WD3A 1KU2A 2VS8A 2E1NA 5EZYF 3RI4A 2XAHA 3CMYA 5LL6b 5C8YF 2R7ZA 4A2UA 3HHHA 3HPGA 3HJEA 3HOXG 2QZ8A 1C0WA 1N3FA 4O3NA 1RJQA 4BHCA 3CC7I 4UN7A 3FXKA 3RYRA 3ZQLA 4Z2YA 4DBRA 2Z3YA 1WFXA 3DLAA 3I53A 4HNTA 4DIQA 1QNTA 4LFAH 1MNEA 2BXYA 3BA9A 1DGWY 3EYIA 2NOJB 2W6NA 4II3A 4D7MA 3VYTB 1VBHA 3PW7A 3RKXA 2BR0A 2TRTA 2HPIA 3M8FA 3H3ZA 1NHAA 5E3LA 1BP7A 1X19A 1VTNC 3DPLC 5FRMA 3G8CA 3LNQA 4V2FA 1XN7A 2HXOA 4X64H 2AXTC 2I10A 1OCCH 4PWQA 4IHXA 1ZKGA 3GTJJ 2R7UA 1EKEA 3JR9A 4M9UA 4RAZA 1DGRM 4EFEA 2F5VA 1A6QA 5J47A 2XGXA 4DR1H 1SVMA 4CXFA 1YFHA 2A3SA 1AHDP 1ZG5A 3L09A 3JRGA 4U0VA 3IGDA 4UT0A 1SEIA 2HOTA 1IBMH 1I50J 4I98B 4P96A 2IGNA 4XLAA 4XKVA 2M4GA 5GP9A 3W2AA 4OOIA 4QWEA 3U9TA 3ISPA 5L1JA 1Y0UA 1D0XA 2QQ8A 5K7ZA 2YYAA 2UU9H 1HNWH 3CCQI 4LOCA 2HQRA 2ZNZA 1AT0A 3ZMUA 1ZHQA 4F4XA 4IRKA 4A3GG 4O3RA 1SD5A 2EFNA 5TJJA 3TW6A 4CH7A 1PUFA 3JAMK 5EWFA 3E3VA 3S32A 3BDDA 4N9IA 1FMWA 2HJWA 1EUCB 1JLLB 1TWFA 5JI6A 2UUCH 1ZG1A 2X0LA 3CESA 3QOPA 2A05A 1BC7C 2GM4A 3PFYA 4RAFA 5FLMG 2CW7A 3H0GJ 2PI0A 5F04A 4APMA 4LG0A 4D5CA 2AGQA 4HLYA 2VBLA 2F5DA 1PP8F 5FD6A 1TWAJ 2VODA 2V4JC 4FU0A 3V8LA 2M2EA 3C2HA 1WI3A 3GVAA 4UFZA 1UFMA 1JX4A 5LBQA 1ETVA 3AL0B 2E2HJ 5HS9A 4IAJA 1KBLA 4DGWB 2M05A 3BY6A 5LLQA 1WZ2A 2W25A 3ULQB 1WKMA 2F6CA 3VDXA 2GPWA 2ASJA 2ALZA 3M4OJ 1P4XA 2EB7A 2M7AA 3RPQA 5JUMA 2FPGB 3U1DA 1ETQA 4M71A 3ZMVA 1E3HA 1JGGA 4YQWA 1VAJA 1UHWA 4A3MG 3VB2A 4BDZA 4KJZA 1OYIA 1O7LA 1TNTA 5KG2A 4R8HA 2CUZA 5KFJA 3G1MA 3PW2A 2BXZA 4ZZDA 2WV0A 2V9VA 4BH9A 3ETJA 1YW8A 2DOAA 1FY7A 2KDOA 1R6RA 4TQSA 3BR2A 3JRWA 1VQ4I 5KFKA 5I0AA 1XDUA 1YO5C 4Z1ZA 3LA7A 2OQRA 2LNBA 2DK8A 3ONQA 3JTHA 1P7IA 1QO0D 1JE8A 3HOZG 2XB5A 3HRSA 2OF7A 5GPAA 1Y1WJ 4YAKB 3L2PA 2FF4A 1TLHB 3KLNA 4BJ6C 1VDEA 3JRHA 4G12A 1HNXH 4G3IA 3G2BA 3SFIA 5KT7A 4ZYHA 1TWHA 5DS9A 2F4IA 1JKPC 1IN7A 2IXSA 4XYLB 1TAEA 2DQRA 5IYBJ 1LE8A 5D8DA 4PUSA 3AFHA 3ETHA 3KYCB 1Z21A 3MR6A 3OR1C 2VBJA 4FS2A 1KEEA 2Z5UA 2ADUA 3S1MJ 2HHHH 4JYKA 2DAOA 2Y9YA 3RQIA 2ACJA 3K5IA 3LSJA 4QIWA 1GHCA 5KFUA 1SFOA 3CCUI 1YW7A 4ED3A 4CICA 2AQFA 5AKFA 2YCHA 2ATLA 1R1TA 3H36A 3HKZE 4EBEA 2LD5A 3LWFA 3PSIA 3Q2OA 4CSWA 4FTHA 4N4OB 4IWXA 1XDSA 5DV5A 2R7DA 3QPSA 2GAUA 2JRMA 3HUGA 2YPRA 1BIAA 1J09A 4UUSA 5CYVA 2ZDHA 3KZIC 4KFCA 4AABA 4B3AA 2R8HA 1UAAA 2QYZA 2FLDA 2VJ5A 3R5HA 2DQLA 2XE0B 4MQVA 3P7NA 3PFIA 2W24A 3NARA 3GX4X 1ZGWA 4W1UA 2KL4A 4CYCA 5FGMA 3W2WA 1T6SA 1W36D 3FMAA 2Y69H 1FOWA 1RIOH 3WGIA 3F6VA 3OHBA 2Q2EB 1IRGA 2IGMA 2KLOA 4G8XA 5C4XG 2IT0A 5HLTA 1HQCA 4V2GA 5H6QA 4DLKA 5FLXW 4J9KA 5KFAA 4BNCA 5KT6A 3OSFA 2RDIA 1NG6A 3GXOA 4OU0A 3TINA 2K85A 4I6ZA 3LSMA 3V4ZA 1HR0H 2CFXA 1RYSA 3NWSA 1IBLH 4GC7A 4AAEA 2EV5A 3JSLA 3HBLA 3OV8A 2JA7A 1XD7A 4LF7H 4ED1A 3BZCA 2DMTA 3HRMA 4O1SA 4FETA 2HKXA 4D0PA 3JRIA 4CDGA 1L2ZA 1W5TA 1IF1A 2EV0A 5IT9Z 3HOXJ 3BROA 3OL4A 1A5JA 2LQMA 2RAEA 5ICEA 3LA3A 4I7HA 1K6YA 3WTSC 1RZ4A 3F21A 2DA1A 3M9AA 1R71A 4QJFA 4G9YA 3FXQA 2DK5A 3DEEA 4GIGA 3IRRA 5EF6A 2XF5A 2RN7A 4WXCA 4EATA 3S93A 2L01A 1B1BA 2V1UA 2VXZA 3V7RA 3PW5A 1HKSA 3FHZA 2K9NA 3UFXB 4Y4RA 4JI5H 1C3OA 2N8GA 2LY1A 5DD4A 2P0WA 2XPWA 3CJNA 4ESBA 4IOAF 3HRTA 2A5YB 1I3AA 3ABMH 1OISA 2Z16A 4C3HJ 5FD5A 3HOTA 2W00A 5BOXA 2GLTA 1IZ1A 1RUOA 4MNUA 1ON1A 5IP9G 3GTOJ 4J9PA 1LFPA 4RNOA 4ECXA 2GA1A 3BTCA 1HC8A 4M9ZA 5IT3A 4F92B 4O3MA 4GYGA 2B63A 5DM6F 3UR3C 4HSRA 1T9JA 2L7KA 5IP7G 1N77A 2FLNA 3F9KA 3Q0VA 3WU0A 5DG7A 3MWDA 3P5JA 3QU6A 1YTYA 5GAEJ 1E17A 1T9IA 1WPKA 2ICWG 2DA5A 2HZTA 2WAQE 1ZQ7A 2YZMA 4A3GJ 2ETHA 3IWZA 1IN4A 3GW2A 5H2FC 5A72A 5BMZA 2ZMEA 3SZGA 3HB9A 4CZZA 2NXNB 1WWXA 1G59A 1DU6A 3WE3A 2GLOA 2O0YA 1EHIA 3T5HA 3FM5A 4DL3A 4JI0H 2GPSA 4ED0A 1Z3YA 5EG0A 5FLMJ 1P92A 2CUFA 4JK1X 2NVXJ 1GXQA 4UVCA 1Z2NX 1ORKA 2CU7A 2R7FA 3HKZN 4ETSA 5JFRA 5JR3A 1A31A 4KISA 5JH7F 5L1KA 2MH9A 2ISYA 2VL8A 2ELKA 3W2VA 1GLVA 3IAS2 5CVVA 1H9GA 4M6VA 3IRQA 3VSLA 5KFEA 2EK5A 2R93G 4FISA 1JHFA 1Z2OX 4YB8B 2UVRA 5D1PA 1K83A 4R8UA 2JA6G 5LXTF 1BN5A 4EGYA 5LRSA 2QSHX 3N05A 2WYOA 4QWBA 2JTVA 2PN6A 4S04A 1BI2A 4U7CA 2VT3A 3HOWJ 2XCLA 3ZQGA 1DUXC 1ULZA 1WR2A 1B6AA 2MGQA 3RTRA 3HYJA 2HGCA 2R7XA 4A3MJ 2CKZB 2CZGA 2CQ7A 4A6DA 3CMEI 1P4WA 1FC3A 1BXRA 4A12A 4O3PA 2V4RA 5FLXK 1FP2A 3C2GA 1Q1HA 3T5JA 3K4KA 4MTDA 4UNOA 2FX0A 2WBMA 4W97A 1I94H 2IP4A 4L1KA 2VB6A 4JV1A 3LAJA 4BHBA 2FMYA 1LWSA 5HODA 4NLGA 4KN7X 1MBJA 3IKVA 2UXCH 5LMUH 2EZKA 4B44A 5CQGA 4EM0B 2DJIA 3ZMZA 1TQIA 3HOZJ 2E7WA 2I87A 2XC9A 1WJBA 3DKYA 5CQEA 3MKYB 2DIKA 2UVVA 4KIGA 1F43A 4C3IJ 1MNDA 4CCKA 4ENJA 2H6CA 1YRNB 4M7EA 2R7VA 2JA5G 3GIIA 4O4HF 1FOKA 1SFXA 4N9HA 5HNFA 4XKCA 4DR5H 2OTJI 2WA0A 3F22A 1BJZA 1I3QA 4AC0A 1VQ8I 4A0XA 5IWAH 2W4SA 2D5VA 2UVWA 1SFEA 4JX5A 4ECYA 3S14J 2QCOA 2CQXA 4KIFA 3L2WA 3OUUA 4HV6A 3GTMA 2EFPA 4F91B 5LHGA 1TT5B 2B0LA 2QK4A 3S17J 2MA3A 3L00A 5DCMB 1DV1A 3MEXA 4A3LJ 3E1SA 2LF8A 1JTXA 4I0BA 3CCVI 1S6LA 4XLCA 4MV1A 3S8PA 2YZGA 2DPUA 5LFAA 5L9XA 3U9SA 5K2MA 3GFMA 3H40A 4E2TA 1OYYA 3DPUA 3I58A 5HLHA 3LSPA 1B6RA 4RB1A 4ZH4F 3CCRI 3S3NA 1GT0C 5BPHA 4PJJA 4CCJA 4RZRA 1X58A 4RGSA 4D6OA 2E5LH 2KRCA 1T2KA 1X4OA 2E1MB 1ONVA 2EV6A 3FWEA 1UCRA 5BNGA 1PVEA 2ZJQF 1ZR2A 2XGDA 2B9SA 1FNNA 1TWCA 2WAQN 4B48A 5KVRA 2K27A 3KP2A 2EILH 1J59A 3L7WA 2FE3A 3OUZA 4LQ0A 4HLXA 1T33A 1RPWA 2XGPA 1YX3A 4G7OF 3K70D 1C30A 4QWDA 2KT0A 3RYPA 4ED6A 2R7WA 4UN9A 3BA8A 4EBCA 1SD4A 2ASDA 3CJTB 3CO6C 1A04A 3RKYA 4FCYA 5BMVF 1IRXA 5L3CA 1B8IB 2Q2TA 4E4HA 1G3WA 5B66C 4XLNF 2JT1A 2HXIA 4JV0A 5E8IA 3GYHX 3H3UA 1ODDA 3S2DJ 4C9YA 4L9NA 4XSZF 2PBZA 1SCUB 1DDNA 3KP5A 1REPC 2X1DA 1UM2A 1N32H 2FU4A 3OYLA 4A93G 2WE6A 2V4QA 2GBYA 2W6PA 5K7HA 5KAFC 5HLIA 4IHTA 5JVLA 3V42A 2L3DA 3HTSB 5H80A 2VUMG 2NVTJ 3MISA 1TA8A 3N97A 5J4VA 2DODA 4KT5C 2QKMB 4LLLA 2HEOA 1MGTA 2KHMA 3AG4H 2JEIA 2DDAA 1KJQA 1Z9CA 4QTRA 1KJJA 4DL4A 2HFHA 5DDGA 4AVPA 1E4FT 3R0JA 3T1HH 2HTSA 5ED4A 3WTYC 1MIJA 3T0YA 2NNNA 2DMUA 2LKXA 2JVGA 1IXSB 3PM1A 3GTPJ 4J9SA 2PQ8A 2IVMA 2R92J 1TBXA 2XSDC 4ZTJA 2O9LA 3HOUJ 4JUZA 5D4SA 1CQTA 3VYSB 5AKNA 4F7ZA 5DGAA 1F5TA 3L2QA 4O3SA 1FOYA 2E5NA 1U3EM 1VQKI 1O3RA 4ZDLA 3RAQA 2CO5A 4DL2A 5IP9J 4UNCA 3CF5F 3JRCA 2DZDA 3V4SA 4LF8H 5EGOB 2MBFA 2VC0A 4TV7A 2R8KA 5TRDA 1X2NA 3SZPA 3KYLA 4JYAH 2V26A 1F36A 2MC3A 2RNGA 3MFIA 1B72B 4LK1F 1TWGA 4Q44A 1U8RA 3CUQB 1WJCA 1I1GA 2PN1A 4ECQA 3BJOA 1I5ZA 1GPPA 3G6VA 3U1KA 4HX7A 3OSNA 3RUPA 3QWLA 5TGTA 1FTTA 1S3JA 2BOLA 2VBXA 2HYGD 1KJ8A 3SDBA 3F6OA 1W0UA 2XE0A 4BHPA 2GXGA 1S0NA 2IBDA 3HKZA 2VIXA 3H9JA 3RGXA 3GLLA 4CC6A 4UCVA 4XMYA 1JKOC 3GV5B 1AWCA 2VBOB 3DCFA 3FISA 5KFXA 1JXLA 1WJAA 2W1OA 2UZKA 1H9TA 2FKLA 4A0ZA 2DLLA 2Q2EA 2BE5F 3JAMZ 2ME0A 2H27A 3BG7A 3WTZA 2CW8A 3GTKJ 3H9QA 2X51A 4HF0A 5J1UA 2OZUA 4KT6A 3OY9A 4ZTFA 5KFCA 4L9JA 2E2IJ 4DZPA 2R7SA 2Q8KA 1WI9A 2EA2A 1SYXB 1GLNA 2DCEA 3ZN1A 4OIOF 3E5QA 3MKZA 3WTVC 1TNSA 4YHHH 1LUJB 2GIZA 3UVFA 1IC8A 5KFSA 3WNZA 4XKWA 4MA5A 3ZMDA 5D4RA 2JA6J 2PEXA 3QODA 1ETWA 1R4MB 2FA5A 2BY2A 2QYOA 4YG2F 2RF4A 3BR5A 1T36A 2XCAA 1WJ5A 2BY3A 3UNGC 5JVTA 3BQ2A 2E36A 3UKGA 5BS6A 3CJQB 3W6JB 2VPRA 4KMUX 4MV9A 2W7OA 2YRXA 3CUOA 4DL6A 4MV8A 1TP4A 4EM2A 4BEHB 5EEHA 3BPVA 2A6EF 1B4AA 1F9NA 3WG9A 3ZQQA 1TW2A 2CWEA 2QUFA 3OYMA 4Q47A 5KFNA 4RNNA 1H0MA 2CQQA 3B73A 4M3GA 3V7SA 3PSFA 2QWWA 3GZ6A 1UG2A 1CS0A 4F55A 4NNJA 4HA8A 4UNBA 2IEKA 2Y31A 4BE0A 4A3DG 3HHGA 3BC8A 5D5WB 3L2CA 4BU2A 1TQPA 2O7OA 1IDYA 2Y30A 1X2MA 2DTRA 2DA6A 2VQHA 1MBHA 1FMVA 1N56A 1R36A 1XG1A 5KHDA 4EBDA 1RK5A 3A0BC 2IS2A 3T5XA 2DMNA 5KFFA 3KEYA 1BI1A 4LMYA 1LEBA 1HOMA 1OR7A 4FBTA 4GDFA 2HDWA 3M8JA 3HSRA 5IYBG 3MVPA 2FBIA 2IBKA 4LF5H 1A6IA 3FKIG 5CLSA 4AAFA 3GTGA 2P0AA 2XC7A 2DA2A 5K08A 3B02A 3MQ0A 3RV4A 2LFBA 3W3CA 1DPRA 1LJ9A 1ON2A 1WCMJ 2FXAA 4LIUA 4N0BA 1XC5A 3SQNA 3E5XA 5FLVA 2VQEH 3ERMA 4B3MH 1HDDC 3K2ZA 1IOWA 4M3BA 2VOOA 4OIRF 2XRLA 1Z7LA 4XQFA 4U6PA 2M45A 1VZ0A 2JNQA 1N48A 1FLIA 2IA2A 2JN6A 2WAQA 3MN2A 3KP4A 2NVUB 4Y15A 4QIWN 5KNLA 1K79A 2IS6A 4WX9A 3B6AA 2MYSA 3C0FB 1Y14B 2V9KA 4R79A 4MEYF 1FOXA 2JPCA 1O3QA 1OCZH 2X6WA 2JMZA 1T94A 1S7OA 1T8IA 1B9NA 2IAIA 5DUKA 5F9LA 5DQGA 1RR8C 4EJVA 3E6CC 2LH9A 2MG4A 3ZQCA 4JI3H 5KFPA 1L3LA 1DQ3A 1W93A 1DU0A 4DR3H 3OOPA 1JVAA 1G9ZA 1KJIA 2VBNA 5LYJF 3GWZA 4F93B 4ZI7F 2WY7Q 2OC6A 3ECOA 3L1PA 2XVCA 1S7EA 1R5ID 3L4KA 4IO9F 1KQ9A 3MWMA 3PZPA 2M34A 1N36H 4PCQA 4HOBA 4MO7A 2BEOA 4Q5SF 1X1DA 2JA8J 1YJWI 4UXNA 3ORQA 2KJCA 3FXLA 1KONA 4QPQA 2VOPA 2KZGA 3MFKA 1KQ8A 4AIKA 2R0QC 4A93J 3F0CA 1HSJA 4XSXF 2L7MP 5FKOA 2BGCA 3DP7A 3OOLA 1MJAA 1P8KZ 3CCSI 2RQQA 2I8CA 2EBIA 2EIJH 3GTQJ 4EM1A 2VUMJ 3M3YJ 3BP8A 4LOXA 4I09A 1BR4A 3BAAA 2I5UA 1TZLA 3HTUA 4J9OA 1SMTA 3IN5A 2G7HA 1R5GA 3ZMSA 4AD9A 3BWGA 1B33N 1FYLA 5DD8A 3OSGA 3QZ7A 4I0AA 1JUPA 1YRNA 3RBDA 5BQTA 2P6TA 1I6XA 2XF6A 3BG5A 2VKEA 1R49A 1S5LC 3JW4A 2QSGX 4CCMA 1FIPA 4A5NA 1ETOA 3MR2A 4PDBA 3QPTA 3CQZJ 3Q0WA 4GO1A 5D8KB 2W71A 1MH3A 3R61A 4RMNA 1XTAA 4ABZA 4ZYDA 1XMXA 4UB8C 2FD5A 3BPXA 4EJOA 2HDCA 4B4CA 1KJ9A 1BI3A 4RLFA 3QAHA 4L5JA 1H8AC 3E6DA 1I7LA 2XGQA 1KC7A 1ETXA 4ZQIA 3I71A 1A0IA 1XNRH 1G3SA 4LFBH 4XLEA 2QEXI 4XNFA 2HVRA 4IVNA 5DCMA 3HOYJ 4B3XA 1F1ZA 4AWXB 4E70A 3EPGA 2L0KA 2LSOA 4F4ZA 2X4HA 1G3YA 2XAFA 3K6GA 1V5FA 3JSPA 4GCVA 1OCTC 1M7JA 5M3MJ 1CGPA 1ZAOA 1OCRH 4IX7A 3O8GA 3CDHA 2ME6A 4J01A 1XSDA 1X1PA 3CJRB 3DFGA 4P1WA 2UXDH 1DQUA 2R3SA 3PNYA 5LGNA 4X6AJ 2IA6A 2R93A 4LB5A 1R4NB 2LR8A 5JHFA 4MEXF 4OZ6A 4Y17A 3I4NJ 3IHUA 4EVIA 1W36C 4IRHA 4QWCA 2NU8B 4MTEA 2QQAA 2IA0A 2VQFH 4RZQA 4Y33A 1ZGAA 4IOCF 1Z3XA 4RM3A 1JDBB 1W1WE 2M1BA 5L3GA 5L3BA 5KFLA 3BT9A 3OYNA 1I6UA 1GV2A 2FK2A 3IKTA 2H09A 3DV8A 4BQAA 3DWLE 1WJDA 2OUMA 4HX8A 1T38A 5LMNH 1UHMA 3EDPA 2Q2UA 1AUVA 1LVAA 3KIOA 4DJAA 4UY8I 3F23A 2B7EA 1ZGJA 3KPHA 3KZYA 3DLLF 1XS9A 2FEZA 1B8IA 2LWYA 1XSVA 4HX4A 2JSPA 2VLAA 1O7FA 4MLOA 1Z2PX 3PNTA 3WTTC 2R5ZB 2M3AA 3WHCA 1OQYA 4B8XA 3OYHA 4Q43A 4FM9A 4BUPA 2RNJA 5J2UF 2FRHA 1IUFA 1XB4A 2FOKA 1E4EB 5K5RA 2LLKA 4JI1H 4OWRB 3ZGKA 3GTLJ 4NC6A 3VWBA 1XGMA 2K9QA 3J81W 1HNZH 5FJ8G 1R22A 2OZ6A 2Y2ZA 3HYIA 3LL7A 3PUFA 3Q0UA 3RSNA 2DOFA 5DTDA 2E1CA 1OMIA 5HNHA 3JRBA 4YJ2F 3HOWG 4EV0A 5B3SH 3EH8A 4QSHA 2W6ZA 2W9CB 4B3TH 2VXDA 2VA2A 4ZC3A 2GA2A 4BQOA 3COAC 1SMYF 4FE4A 2UUAH 2COBA 4M74A 1AKHB 1RK6A 2SCUB 5J3LA 1GGOA 2VPQA 3R0AA 5LP6F 2JJ7A 2LY2A 2MLKA 3ZP5A 3LWBA 4HF1A 1JUSA 2ZMEC 2L8LA 1QU3A 4I2OA 5FLXZ 3EUKL 3RKWA 4A3DJ 3WO0A 2DYRH 1X9NA 2K3PA 2CS3A 2Y75A 1GSAA 4C2MA 2JSCA 1D5YA 2GWRA 3WHBA 1BIBA 2HGSA 3DEWA 1J9IA 2UXXA 4ZYEA 2VJ4A 2R7ZG 4XORA 2QKLB 5EGOA 1O4XA 1JHHA 5E63A 2ZFUA 3J7ZI 1DV2A 4AU7A 1ZLKA 5DQIA 3J7AK 2L5QA 5EZGA 1LEAA 5FB2A 4I02A 2M7BA 3MCZA 1SEUA 5KFWA 4YR0A 1D0ZA 1FX7A 2DMPA 1B72A 3Q8RB 3CUQA 1LWTA 4HG2A 3FKIJ 1BW5A 5EWEA 4IRDA 2XCPA 1J5YA 4YRVA 4C5AA 2O5RA 2BQ3A 6PAXA 2J6TA 4JBAA 4AIHA 2K4BA 3CLQA 2QOJZ 3RPUD 1X4PA 2FNPA 4A3LG 3V8KA 1P9QC 2LVSA 1O75A 1UC9A 3MKLA 4KA4A 2NRAC 5KT5A
chains in the Genus database with same CATH topology
3RIZA 3RTRA 1U0JA 2OV7A 3HYJA 2R7XA 2XIGA 2VBOA 3F8NA 3N40P 3N6XA 1BJTA 3VYRB 3PL8A 4RM2A 2PJRB 1YE9A 1QHGA 3OIQA 3FKJA 4II2A 2IN9A 3C2GA 2V6EA 1PJRA 3K4KA 4MTDA 2WBMA 2VBJB 1I94H 3PNVA 2VB6A 3HPHA 1LWSA 4CZCA 2KQRA 3EUHC 2WB1A 1EF0A 2ZJTA 2VPLA 3L4JA 5LMUH 4B44A 2UXCH 5CQGA 3SYTA 3A4CA 2DJIA 2VQCA 1WJBA 3DKYA 5CQEA 3MKYB 1MW7A 4UN8A 1NG7A 3KO2A 4PJMA 2E60A 4CCKA 1MNDA 1IBKH 4AYBA 3RGZA 4DV4H 4M7EA 4O1RA 2R7VA 4E6KG 2I3PA 2IGKA 3FDYA 4BE1A 3KAJA 4RB3C 1TT0A 4JQFA 4DBQA 4UN9G 1ZHSA 3HUGB 5HNFA 4XKCA 3MXAA 3MIPA 3LSIA 4DR5H 4N4NB 2WA0A 1SFKA 4AVZA 1B24A 4X0GA 3OWTA 3H5AA 5IWAH 2W4SA 4LF9H 1XMQH 4UCUA 1M0WA 1AF5A 2A6TA 3L2WA 4F91B 2W82A 5A77A 4NC7A 2XDVA 4B47A 3KXYT 3DQVC 3BCBA 3FBIB 4XL9A 1DFAA 3E1SA 3DPTA 4XLCA 4P5OA 2IN0A 1HA8A 2BW3A 3S8PA 1X1CA 3PJRA 5LFAA 3H35A 3C0XA 4OAYA 4YY3H 4JI6H 2DCHX 2X6YA 5HOOA 4Z20A 1Y56A 2R7OA 4E2TA 3DPUA 3HG9A 1DP3A 4RB1A 5FRNA 3S3NA 2MD0A 4PJJA 4CCJA 3IFJA 3OOUA 2HVQA 3DTEA 5D1OB 2KZVA 4C2TA 4D6OA 2KRCA 4DV7H 1X4OA 2E1MB 5CKTA 2E5LH 4DR6H 3LFUA 2W7NA 4PSXA 2HNHA 4GKJH 2DT7B 1SAUA 4B48A 3D5RC 4LITA 3KAKA 3AL0C 2FE3A 3E54A 2O03A 4LQ0A 5EOYA 4X65H 5KCMA 1YX3A 4A2BA 3K70D 1MZBA 1BR1A 2R7WA 1U0CA 3BG6A 3M1CA 2KEQA 5A0WA 4UN9A 1B04A 3BA8A 2ZM6H 4DV2H 4ANJA 2LCJA 1V5GA 3L2UA 1IRXA 3EUAA 2Q2TA 3TL4X 4E4HA 2W57A 4D9JA 1N75A 2LG4A 4OAZA 4AAGA 2UXBH 4YITA 2ELJA 3PUBA 1S68A 1M0TA 3OL3A 2CMPA 1AA7A 4C9YA 3H5NA 3A2KA 1MMGA 3TMOA 3VSKA 3K10A 2M4KA 2X1DA 3OS2A 1UM2A 5E67A 3JAMW 4B3SH 3OYLA 1N32H 3ZXSA 4LSXA 3DU5A 1LVKA 3K70C 2WE6A 1S03G 3SEZA 3OS1A 3OYIA 2UWMA 3V42A 1G9YA 4MV7A 3MISA 2LOOA 4HPQA 4PFOA 1TA8A 4UN8G 2QKMB 3JSNA 4AQYH 2KHMA 3OYAA 4UNAA 4UN7G 4B3RH 5FROA 1WH2A 3KALA 4JI7H 5A0MB 4PJLA 1WJEA 4CCLA 2AB5A 2FUG2 2JA2A 3N44B 1E4FT 4X62H 2RREA 3RJ0A 2WAFA 3T1HH 1X1AA 4HEA2 3DTKA 2I3QA 2JVGA 1XNQH 2VASA 4ZTJA 2PMZA 2XSJC 3ZCOA 3QYEA 3VYSB 1N78A 2IMZA 5AKNA 4EEQA 2VQGA 4BL0B 4XKBA 3OYFA 3L2QA 3NWTA 4LF4H 2E5NA 4BDYA 3IP4B 4ZDLA 3QQYA 2WDTA 1D0YA 2KRHA 4XR6A 2LYCA 2VJIA 1M5XA 5AKMA 4UNCA 3OYEA 5BR8H 3OYJA 1OLTA 4LF8H 4LIVA 3LSHA 2VKHA 1AN7A 3M4IA 4J00A 3KYLA 4JYAH 2XF7A 4LG3A 2V26A 2BVMA 4BGDA 2RNGA 1AM2A 3H9GA 4XOTA 1X1BA 2CV0A 3N42B 1WJCA 4E7KA 2UUBH 2HZDA 2Z1DA 1GPPA 2VKDA 1BGWA 4BACA 5TGTA 1XDNA 4EFJA 2BOLA 2X6XA 4LH7A 3CF2A 3D5LA 3MD2A 2VS8A 2L9SA 3MX9A 4Z1XA 3R7PA 4XONA 3SDBA 2XE0A 4CA0A 5LL6b 3MXBA 3HPGA 2HU9A 3GBGA 3HKZA 2VIXA 3H9JA 4BJ5C 4CC6A 4UCVA 1ZELA 4XMYA 2R7QA 4PJNA 1N3FA 4UN7A 2VBOB 3NZMA 4BXFA 1WJAA 2W1OA 4DBRA 3RF2A 4DR4H 1WFXA 2ZSHB 3DLAA 4HNTA 4DIQA 3BG7A 2CW8A 3KX2A 3H9QA 2X51A 1MNEA 4PK4A 4KT6A 3OY9A 4ZTFA 2VOBA 1DGWY 3BA9A 2NOJB 2R7SA 4II3A 2CUJA 4ITVA 3K4MA 4XN0A 3VYTB 1R7MA 3VYUB 2HPIA 1SYXB 1GLNA 2DCEA 3BCAA 3MKZA 4BEHA 1BP7A 1X19A 4YHHH 3DPLC 4DR2H 1ZDEA 5FRMA 3UVFA 4DR7H 1UELB 4XKWA 2MABA 4X64H 2JVHA 3QODA 2GOXB 2R7UA 4AADA 2V7FA 4RAZA 3A1YA 1DGRM 4EFEA 2F5VA 1WJ5A 3LMMA 3UNGC 1E4GT 4CUGA 4DR1H 3IUOA 3FD2A 3CJQB 3IG0A 3OMYA 3IGDA 4MV9A 2HPMA 4UT0A 1SEIA 3RQ4A 2K9LA 3ZRGA 1IBMH 3AKZA 4XLAA 4XKVA 2IGNA 3W2AA 2KSWA 2M4GA 3QYFA 4BEHB 3QOEA 1D0XA 4OX9H 3BLYA 4PFPA 3ZQQA 1V9PA 1LKXA 2Y0SA 3OYMA 3K3VA 2UU9H 1HNWH 1MMNA 1AT0A 2MFZA 1ZHQA 4E7ZA 4BQQA 5CPRB 4CH7A 3K4JA 3PSFA 1UG0A 2X85A 3S32A 2ZXHA 1T95A 4F55A 2BW3B 1FMWA 2WAEA 4NNJA 4UNBA 1JI8A 3OIPA 3DF7A 4BE0A 3BC8A 2UUCH 1N34H 3J80W 4BU2A 4DV5H 3FHNA 3L2RA 3CESA 1D1AA 4KL6A 2KPMA 1XMOH 3N41B 3OYBA 3PFYA 4RB2C 2F4VH 2VQHA 2CW7A 4LSAA 2CV2A 3PN1A 4APMA 1FMVA 3I9V2 5KHDA 2VBLA 4UCSA 1D1CA 5FD6A 2OWOA 2IS2A 4R7RA 4RB0A 3KEYA 2CFOA 2V4JC 2IGOA 4ZYAA 4LMYA 3C2HA 3HXLA 4UFZA 2HDWA 3M8JA 2LRDA 1OR7C 3AL0B 3J7AY 3H5RA 4IAJA 2I8DA 4DGWB 3QYBA 4E7LA 2WADA 4LF5H 3LSGA 4AQUA 4AAFA 4QPOA 2XC7A 3OYGA 5K08A 2F6CA 3VDXA 3W3CA 3I3LA 4UCTA 3T1YH 3IAM2 4KHPH 4LIUA 1MMAA 2VQEH 4B3MH 3OR2C 2M7AA 4F3QA 2K9MA 2HVSA 4KL5A 2LBFA 3RTXA 5A74A 1Z7LA 4XQFA 4F52A 1VZ0A 2JNQA 4BDZA 4KJZA 4NUBA 3HOSA 2CUZA 2WAQA 5KNLA 2IS6A 2MYSA 4E2UA 3C0FB 1E0EA 1FJGH 2DOAA 2V9KA 4R79A 2KDOA 1R6RA 4XLHA 2X6WA 2JMZA 5I0AA 4E7SA 4Z1ZA 4YISA 3ONQA 4JI2H 2LH9A 4UCRA 4DV0H 4JI3H 4JOMA 1DQ3A 4DR3H 3EYYA 3HL2A 1JVAA 1G9ZA 2VBNA 3L2PA 4F93B 4BJ6C 1VDEA 1HNXH 2WY7Q 2OC6A 2KMUA 3G2BA 5E5OA 3BABA 3DU6A 4IZZA 1BR2A 3L4KA 3MWMA 1N36H 1GYFA 5IT9W 2F4IA 2LC2A 2IXSA 4NC8A 1X1DA 4ZDOA 2R4GA 1TAEA 3OYDA 2GOMA 4PUSA 3AFHA 4XM3A 2PJRA 4QPQA 1KONA 1Z21A 2M0MA 3OR1C 2VBJA 4XLFA 4DUYH 2VBNB 2X1CA 5HVQC 3OOLA 2VS7A 4ZDPA 1P8KZ 4HNUA 2RQQA 3N43B 2HHHH 1VS0A 4LOXA 3BAAA 1BR4A 4ZJZA 4J0MA 1TZLA 5AKFA 2AQFA 4U87A 4BQNA 2YCHA 4NXNH 4XOPA 3PSIA 3K4BA 2R7RA 2LREA 4CSWA 4N4OB 3RGXA 4JI8H 2CV1A 2XF6A 4E7HA 1FVIA 4CCMA 3K4CA 4Y3OA 5LD2C 1J09A 1N33H 1PYVA 4PDBA 4AABA 2Z2SB 1IBLH 4A2AA 3OS0A 1UAAA 4JV5H 4RMNA 4YHXA 2FLDA 1EA3A 2VJ5A 3MKWB 2XE0B 4C2UA 4E7IA 4CCOA 3MXBB 2R7TA 3LSKA 4RLFA 3S3OA 2KL4A 1ZD7A 3ZR8X 3W2WA 3UQ8A 4CCNA 2MCTA 4H4KC 1W36D 3FMAA 4HSTA 5A2QW 1XNRH 1A0IA 4D1QA 4LFAH 4LFBH 4XLEA 2HVRA 4XNFA 3OORA 2Q2EB 2IGMA 2KLOA 4B3XA 2RGVA 2L2OA 3U21A 4D6NA 5FPRA 5HLTA 3D5SC 4IQJA 3CP2A 3K6GA 1V5FA 4LH6A 1G8XA 4RAYA 4KITB 2IS4A 5FLXW 4GRIA 4IX7A 4J01A 1NG6A 2CH0A 3CJRB 4DUZH 4P1WA 2UXDH 1DQUA 3EPZA 3LSMA 3PNYA 4C30A 1HR0H 3NWSA 5AK9A 5JHFA 1V5EA 2IN8A 4OZ6A 4AAEA 1U0DA 3JSLA 1W36C 2ZXIA 5D1OA 4LF6H 4LF7H 4MTEA 2VQFH 2BVLA 4DV6H 4RZQA 3LMLA 4Y33A 2E1MC 4O1SA 4FETA 1Z3XA 4RM3A 1L2ZA 2JUGA 1I6UA 3OL4A 3OYNA 2LQMA 4BWSC 1N3EA 3OTOH 2RGRA 1DGSA 4I7HA 1K6YA 3OYKA 4BJTA 3DWLE 4HRIA 3CMMA 1WJDA 2OUMA 5LMNH 4DV1H 2Q2UA 3DEEA 3RCOA 4DJAA 3OYCA 4GIGA 4EFBA 2XF5A 1MI8A 2EX5A 4EATA 3S93A 5A78A 2LWYA 2VXZA 2JSPA 3K4NA 2VLAA 4MLOA 4Y4RA 4JI5H 4K0KH 4AQXA 1Z2PX 4BS9A 3PNTA 1S9HA 2LY1A 2M3AA 2P0WA 2VJJA 4FM9A 3OYHA 4Q0YA 4BUPA 3H20A 2Z16A 2A5WA 3HOTA 2AQEA 3E0JB 5FD5A 2W00A 4JI1H 4OWRB 3ZGKA 1QHHD 3CP8A 3VWBA 1WJFA 3J81W 1HNZH 1LFPA 3LL7A 3HYIA 3TBIA 2IS1A 3RSNA 2VUGA 3K4LA 5HNHA 4F92B 2VBLB 3EH8A 2DT6A 3UR3C 4HSRA 1T9JA 5FPOA 2L7KA 3HC7A 2O7MA 4B43A 2VXDA 4B3TH 1BOBA 2HQAA 3FBNB 1N77A 5A0MA 4ZC3A 4X66H 3F9KA 2K5CA 4BQOA 2MC4A 1T9IA 4LFCH 2UUAH 4UCOA 4PSWA 3MMYB 3DTIA 4IQ4A 4RLQA 2V1NA 3DKXA 5A72A 2LY2A 2ZSIB 3SZGA 4JI4H 2L8LA 4G6TB 1QU3A 1Y6IA 3EUKL 4NQWB 1ERDA 4NXMH 2LBFB 1G59A 2K3PA 2CS3A 4DOZA 4IKFA 3CVZA 1X9NA 4YEJA 2KP6A 4YELA 3SEQA 3L2VA 2HGSA 4JI0H 1Z3YA 5E5SA 1T0FC 1MOWA 1Z2NX 1MMDA 2VQLA 2VJ4A 4ETSA 4KISA 2WY8Q 4XORA 2QKLB 2X1EA 2VPSA 4E7JA 3C0WA 5E63A 2ZFUA 1P8LA 2VL8A 4AU7A 3J7AK 2L5QA 1YX5A 3W2VA 2Q1ZB 3IAS2 2M7BA 1D1BA 1D0ZA 3H0DA 3VSLA 2UV1A 3S3MA 4GKKH 1LWTA 1Z2OX 4HG2A 5D1PA 4XN3A 4DV3H 4YRVA 2E5ZA 3CZ6A 4FASD 2O5RA 2DXIA 2UUZA 1J5EH 2L9NA 3N05A 2QOJZ 1FKAH 3RPUD 1X4PA 2WYOA 1LDKB 4GLXA 1P9QC 4U7BA 4BE2A 2XAUA 1O75A 4CC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CW7 A;  3HYJ A;  5A0M B;  2VBO A;  2AB5 A;  2VBL A;  2IN9 A;  2I3Q A;  2VBJ B;  5AK9 A;  2IN8 A;  4OZ6 A;  4AAE A;  1U0D A;  1LWS A;  1EF0 A;  2IMZ A;  5AKN A;  4AQU A;  4AAF A;  4O1S A;  5K08 A;  4UN8 A;  3KO2 A;  3QQY A;  2LQM A;  1N3E A;  4O1R A;  1M5X A;  5AKM A;  4UNC A;  2I3P A;  4KL5 A;  4UN9 G;  5A74 A;  3MIP A;  3MXA A;  2JNQ A;  4GIG A;  1MI8 A;  2EX5 A;  1AM2 A;  2LWY A;  1B24 A;  5A78 A;  4E2U A;  1GPP A;  4AQX A;  1AF5 A;  2JMZ A;  4EFJ A;  5I0A A;  2VS8 A;  3MX9 A;  4Z1Z A;  4YIS A;  4Z1X A;  3R7P A;  5A77 A;  2XE0 A;  3MXB A;  1DQ3 A;  1DFA A;  1JVA A;  1G9Z A;  2IN0 A;  2VBN A;  1N3F A;  4UN7 A;  2VBO B;  3NZM A;  3HYI A;  1VDE A;  3C0X A;  2DCH X;  5E5O A;  2VBL B;  3EH8 A;  4Z20 A;  2CW8 A;  4E2T A;  1T9J A;  2O7M A;  5A0M A;  3IFJ A;  1R7M A;  1T9I A;  4D6O A;  1BP7 A;  1ZDE A;  3UVF A;  2VBJ A;  5A72 A;  2VBN B;  3OOL A;  2VS7 A;  1P8K Z;  2L8L A;  3E54 A;  4LQ0 A;  4AAD A;  4LOX A;  5AKF A;  1U0C A;  2KEQ A;  5A0W A;  4UN9 A;  3FD2 A;  5E5S A;  2LCJ A;  1MOW A;  3IGD A;  4UT0 A;  4AAG A;  3C0W A;  4YIT A;  5E63 A;  4AAB A;  4YHX A;  5E67 A;  2FLD A;  1UM2 A;  1AT0 A;  2XE0 B;  1LWT A;  3MXB B;  1ZD7 A;  4UNB A;  1G9Y A;  3MIS A;  2QOJ Z;  4UNA A;  3OOR A;  4UN8 G;  4KL6 A;  4D6N A;  4UN7 G; 
#chains in the Genus database with same CATH topology
 2W6O A;  1XX5 A;  1U0J A;  2OV7 A;  2XIG A;  5E3N A;  2LDU A;  2VBO A;  3N6X A;  1YW9 A;  3PL8 A;  2STT A;  1YE9 A;  3OIQ A;  2NYX A;  2IN9 A;  2V6E A;  5GON F;  2NS8 A;  5D5X B;  3RPU A;  3EUH A;  3F3X A;  4CZC A;  2KQR A;  5ICC A;  3AAF A;  1EF0 A;  5IP6 A;  4G7Z F;  4XRF A;  1EZ1 A;  5IYC J;  3KO2 A;  1XMA A;  2NU6 B;  2RVC A;  1Y1V J;  3R6S A;  2E60 A;  3RB4 A;  4NBQ A;  2EZI A;  4YR3 A;  3H92 A;  3VFZ A;  2I3P A;  4E6K G;  5B5E C;  4O2B F;  3FDY A;  4WXH A;  3FXJ A;  4D5F A;  3A03 A;  3LSI A;  2A07 F;  2M8G X;  1AU7 A;  1EUD B;  5IOY A;  2XAQ A;  2JPB A;  4M6X A;  1JJ8 C;  3JRX A;  1ZH5 A;  2JMW A;  3I4M G;  4XX0 B;  1TC3 C;  1K61 A;  1XMQ H;  2YX7 A;  4UCU A;  3VMM A;  2A6T A;  4ASN A;  2YR2 A;  5JVD F;  4FE7 A;  1JKR C;  4I55 F;  1BOA A;  4YR2 A;  3GTJ A;  4B47 A;  2PJP A;  3KXY T;  3V6K A;  2EJR A;  4XL9 A;  5J1Y A;  1DFA A;  4MGR A;  5BPI A;  4M3D A;  4P5O A;  2ECB A;  3BJY A;  2J6S A;  3H4D A;  2VN2 A;  4KZS A;  3PR5 B;  1GVD A;  5M5X J;  3J81 K;  1I7N A;  4OAY A;  3TO9 A;  5C1P A;  4JI6 H;  2CG4 A;  5F6F A;  5HOO A;  1Y56 A;  4A3B J;  4Z20 A;  1ZRE A;  2C2D A;  5DEQ A;  2DN0 A;  1DP3 A;  5FRN A;  1EJ9 A;  1ZN2 A;  3H0G G;  2YS9 A;  4C2T A;  3MJF A;  4DR6 H;  5CKT A;  3HGY A;  3M9M B;  5B1B H;  2MH2 A;  2R92 G;  3FXM A;  2H6B A;  3HOU G;  1CF7 B;  2FNA A;  5J2T F;  2HNH A;  3I54 A;  4BY1 G;  2JEF A;  3REO A;  3D5R C;  3WO1 A;  5KFI A;  3KAK A;  3AL0 C;  5EOY A;  1CQI B;  5KCM A;  1QPI A;  2ZO4 A;  1R1U A;  3HEF A;  4RA2 A;  3LST A;  1RR7 A;  1SAX A;  3BG6 A;  2KEQ A;  2VBW A;  4DV2 H;  3H0G A;  4ANJ A;  3TL4 X;  5DQH A;  2BYV E;  1W96 A;  4D9J A;  4OAZ A;  1FSH A;  2OJE D;  3TW7 A;  3QZ8 A;  1TWA A;  5D5U B;  2FK3 A;  3CO7 C;  3H5N A;  3A2K A;  2LKP A;  4WXD A;  4TV9 F;  5F1R A;  2E2H A;  4ME6 A;  3TMO A;  3G71 I;  5E67 A;  3OS2 A;  1VBG A;  3G3Z A;  1U5T B;  4GGG A;  5CAE B;  3W6K B;  1R00 A;  1LVK A;  3K70 C;  1UB9 A;  1IO2 A;  3FXU A;  3OS1 A;  2YS6 A;  5E1X A;  1ETY A;  1SFU A;  3BZK A;  2LOO A;  4PFO A;  3T1B A;  4AUX A;  4IWY A;  1W7P B;  4XRS G;  5I47 A;  4ZZL A;  3JSN A;  4EYI B;  5KFM A;  4AQY H;  2ZJ2 A;  3MZY A;  2M8E A;  3OYA A;  4UNA A;  4UUV A;  5HDK A;  4A3I J;  1IV6 A;  4UN7 G;  5FRO A;  1SVO A;  4OIN F;  2R85 A;  5KG7 A;  1WJE A;  3QRF F;  4CCL A;  3T5L A;  4X62 H;  2RRE A;  2WAF A;  3QPH A;  3P9C A;  1VND A;  2AHQ A;  5LHH A;  3M1E A;  1XNQ H;  3DTK A;  1ZRF A;  2V79 A;  3TO7 A;  3PIP F;  1YIT I;  4J9N A;  1OYW A;  2VAS A;  3GFJ A;  2FOW A;  2XSJ C;  4L18 B;  3KHR A;  4X1E A;  2H1L A;  2IMZ A;  2YU3 A;  1BI0 A;  4BL0 B;  3HM5 A;  4XKB A;  3JSO A;  2W8K A;  4O4L F;  4Y52 J;  1K4T A;  4A3K G;  4CHU A;  1Y1W A;  2W84 A;  2R87 A;  2WDT A;  3HSF A;  1D0Y A;  2LYC A;  4QWQ A;  5FJ8 J;  5AKM A;  4YBZ B;  4IHY A;  5BR8 H;  3VEP A;  1OLT A;  4LIV A;  5TIS C;  2X6O A;  4J00 A;  3V4G A;  4U0Y A;  1IRZ A;  1MJB A;  4G6D A;  3GV8 B;  1AM2 A;  4XOT A;  4DYC A;  1I6H J;  5K1Y A;  4XK4 A;  1CQJ B;  2Z1D A;  1GUU A;  4HYE A;  1MBK A;  2W48 A;  4BAC A;  2LF7 A;  1IJW C;  2X6X A;  1V4R A;  3CF2 A;  3KP6 A;  3MD2 A;  2L9S A;  1VQO I;  4Z1X A;  4XON A;  1U6G A;  2RDP A;  4CA0 A;  3TIG A;  5F64 A;  3GBG A;  2XRN A;  2WB1 E;  1MMS A;  2KJB A;  3HOV G;  2CRG A;  5KFQ A;  4YJ3 F;  2W70 A;  3EPI A;  3NZM A;  1Z1D A;  4F50 A;  1U9N A;  4BXF A;  1Z77 A;  1ZRC A;  5HS8 A;  5KFT A;  4AYB E;  2ZSH B;  2AGO A;  1FBU A;  3RAX A;  3KX2 A;  2NVY J;  3V8J A;  2F4L A;  4ITV A;  4XN0 A;  3BR6 A;  2EQR A;  3ABU A;  3CCJ I;  4Y8V B;  3ZQI A;  1ENH A;  4HW0 A;  1SC7 A;  1ZDE A;  2XD4 A;  3G6Y A;  2PFB A;  2GXA A;  3BG3 A;  3FIW A;  5L3F A;  5M5Y J;  1OKR A;  2L02 A;  2C00 A;  3BQY A;  2JVH A;  4IRI A;  4QW9 A;  2GOX B;  3IC7 A;  4PZJ A;  3JCU C;  2V7F A;  4YIF A;  3A1Y A;  4ZHQ F;  1WCM G;  1E4G T;  1HST A;  3X2Q H;  2DLN A;  3IUO A;  5H6R A;  2GQQ A;  3FD2 A;  1YLF A;  5DLF A;  1QPM A;  3CCY A;  3IG0 A;  3OMY A;  2YSR A;  1WQ2 A;  3E7L A;  5E1Z B;  2HPM A;  3K5H A;  3RQ4 A;  2K9L A;  5FO5 A;  1YIJ I;  3AKZ A;  5F08 A;  3QYF A;  2JUC A;  2HI3 A;  4A3J G;  2D2W A;  2PMH A;  3PO3 G;  2KIS A;  3K3V A;  1OJL A;  1MMN A;  1P2F A;  5D5V B;  4E7Z A;  5LEK A;  5CPR B;  4QW8 A;  3F8M A;  3K4J A;  1UG0 A;  2X85 A;  2ZXH A;  3DBR B;  2R5Z A;  1T95 A;  2WAE A;  4LJZ F;  2GZW A;  1QRY A;  3O6B B;  1JI8 A;  3OIP A;  3DXJ F;  4L5I A;  5E79 C;  1JIH A;  3DF7 A;  1N34 H;  1E4E A;  4IXA A;  3J80 W;  1CE8 A;  2P81 A;  5J40 A;  1E2X A;  2KPM A;  4KL6 A;  3N41 B;  3V6J A;  3GO5 A;  3M7G A;  4RB2 C;  4LSA A;  3BJ6 A;  5HBR B;  3PN1 A;  1G4D A;  1F4K A;  2DT5 A;  1SD6 A;  2G9W A;  3HSE A;  3OIO A;  3I9V 2;  4UCS A;  2M0C A;  2YU9 J;  3I5U A;  2W9C A;  4RB0 A;  3I4M J;  4ZYA A;  2RC4 A;  2JA8 G;  3HXL A;  3EET A;  3LOC A;  2M87 A;  2LRD A;  3QFF A;  1OR7 C;  2VA3 A;  5C44 G;  5F27 A;  2HYJ A;  3H5R A;  4BKX A;  3GIM A;  2I8D A;  4E7L A;  3QYB A;  5IYD G;  4OMY A;  2CYY A;  3LSG A;  5GTH C;  5LGT A;  2KDZ A;  1HW2 A;  1AKH A;  3OYG A;  3WTU C;  5BPF A;  1KU3 A;  4UUT A;  2FMA A;  2DPD A;  4UCT A;  3IAM 2;  3T1Y H;  1IW7 F;  3GTO A;  3NAU A;  2F4O B;  3OR2 C;  1Y8Q B;  3RB6 A;  3G6E I;  4Q8F A;  2K9M A;  2HVS A;  1VQ7 I;  4KL5 A;  2FQ4 A;  4P9U A;  1HLV A;  3RTX A;  3MZ8 A;  1RRJ A;  3OHA A;  4F52 A;  1BBY A;  3BQ0 A;  4UVA A;  3L4J A;  3BR3 A;  2XAJ A;  4NUB A;  4OIQ F;  3NEU A;  5L3D A;  3V7C A;  2D1V A;  5EEA A;  2TDX A;  1ZQ3 P;  5IT9 K;  5KFZ A;  1R9T J;  1K7A A;  2TCT A;  2R8J A;  1KU9 A;  5F0F A;  3ZOB A;  1E0E A;  1IGN A;  4RAG A;  3KET A;  2D1H A;  3CCM I;  3WU1 B;  2WWY A;  3RKQ A;  2FSW A;  4BY1 J;  2VQD A;  3B6C A;  4ZOL F;  2BV6 A;  4UCR A;  3MAJ A;  2PMZ E;  3PW4 A;  4JOM A;  1D8K A;  3I59 B;  3BTJ A;  3EYY A;  3HL2 A;  5E3M A;  3NGD A;  2IRF G;  2WB1 N;  2HTJ A;  2G0E A;  2OU2 A;  3Q8P B;  1J0R A;  2NVX A;  3HOY G;  4MAM A;  4Q8E A;  4BBS J;  2H8W A;  4IZZ A;  4HYK A;  1GYF A;  4HQM A;  1FYK A;  2LC2 A;  3ROU A;  5EDN A;  5KFV A;  2EFQ A;  2Z9O A;  2Q0O A;  4A3F G;  2LTP A;  2NVQ J;  2R4G A;  4ZDO A;  2MSY A;  1BA5 A;  2P5L C;  3I4N G;  2AXL A;  3I55 I;  4XLF A;  2JA7 G;  3N43 B;  5HVQ C;  2D45 A;  5JLX A;  2LMD A;  1R23 A;  1VS0 A;  2R7Z J;  1TL8 A;  2JEG A;  4J0M A;  4FHT A;  4U87 A;  4BQN A;  1EF4 A;  2DW4 A;  3MWE A;  2KIU A;  2ID3 A;  5KFB A;  1QZY A;  1ZLJ A;  4OMZ A;  2CV1 A;  4E7H A;  4RU9 A;  2K40 A;  2MW8 A;  1FVI A;  5LA6 F;  4Y3O A;  5LD2 C;  1N33 H;  1PYV A;  3FMS A;  4I4T F;  2HS5 A;  5GAH J;  4A2A A;  3OS0 A;  4YFK F;  5CVU A;  4JV5 H;  2VBZ A;  2J5O A;  3MKW B;  1W5C C;  4C2U A;  2OBP A;  1U9O A;  3MXB B;  4M6Y A;  3ABL H;  4S05 A;  3LSK A;  1NK3 P;  3S2W A;  3T8T A;  5AIQ A;  3CD6 I;  1T98 A;  3DKW A;  3ZR8 X;  3LAP A;  4ED7 A;  2NOG A;  1W5S A;  2MCT A;  1RNL A;  1WVR A;  3H1C A;  3GFI A;  1FT9 A;  4A3K J;  4HST A;  1PP7 U;  4BBR G;  5A2Q W;  4M9S A;  5KFD A;  1WH7 A;  4NHJ A;  1VI0 A;  1PK8 A;  3J80 K;  4IL6 C;  2L2O A;  1DP7 P;  3TP3 A;  4D6N A;  3HZJ A;  5FPR A;  3CP2 A;  4LH6 A;  3F72 A;  4RAY A;  4KIT B;  2MLG A;  1FTZ A;  3PVX A;  4LLN A;  2IS4 A;  3DBL B;  2XAS A;  5CJ9 A;  1FJL A;  4J19 A;  2LY9 A;  4PJ0 C;  4DUZ H;  3RJP A;  4HDU A;  4Q48 A;  4C30 A;  3VOE A;  4R1H A;  5AK9 A;  1U0D A;  2YS7 A;  2DO7 A;  2ZXI A;  1ZTR A;  2R7L A;  4J9M A;  4ON0 A;  3ZQF A;  2BVL A;  2V6C A;  2Y0S E;  5J8F A;  1S9F A;  2E1M C;  1WSC A;  4PDK A;  1CF7 A;  2ESN A;  3DF8 A;  2DWC A;  1OCO H;  1TWF J;  4BWS C;  3KLO A;  3HOV J;  3MFH A;  4P55 A;  2RGR A;  2R7K A;  4XYM B;  1DGS A;  3BTI A;  2BY1 A;  3K1N A;  2E35 A;  3OYK A;  1OWT A;  2YZN A;  1N25 A;  4V19 K;  3RCO A;  2FB9 A;  3ZQH A;  1MI8 A;  2EX5 A;  5A78 A;  2FJ1 A;  1I1S A;  2CW0 F;  3WG7 H;  1W7P D;  2F5F A;  3G4S I;  4K0K H;  4UV8 A;  2W6M A;  2DJN A;  3FMQ A;  2VJJ A;  3SXY A;  2OD5 A;  2ZCW A;  3G73 A;  3BTL A;  5B1A H;  2A5W A;  3GUD A;  1U5T A;  1P4A A;  2AQE A;  3NQO A;  1HCR A;  2EZH A;  5EZH A;  1VQM I;  3G1L A;  1Z6R A;  1GVJ A;  2H94 A;  2IS1 A;  4TV8 F;  1O57 A;  3CC4 I;  1R7J A;  1W7P A;  3K4L A;  5J8C A;  1M1E B;  2P6S A;  3LSR A;  1KYW A;  3S15 J;  1ZYR F;  3H3V K;  1MBF A;  3HC7 A;  2YRW A;  4B43 A;  5FPO A;  4GYI A;  1BOB A;  1WRJ A;  2X48 A;  4A3J J;  4X66 H;  2H8R A;  4J9L A;  2K5C A;  2MC4 A;  3PO3 J;  1S0O A;  5F0C A;  5FFX A;  1UST A;  2XGE A;  2I80 A;  4PSW A;  1X3U A;  1H89 C;  3Q8S B;  4RLQ A;  1JUM A;  2V1N A;  3IWF A;  1SD7 A;  4ECW A;  2JZY A;  3FXO A;  4JI4 H;  3ESW B;  2CGP A;  3FZV A;  2HYF A;  1TTY A;  2EFW A;  5IYC G;  1OFC X;  3F8B A;  4NQW B;  4LB6 B;  2LBF B;  4IKF A;  4DOZ A;  1DIK A;  1Y1V G;  1O3T A;  1GSH A;  3LA2 A;  2P5V A;  4YEL A;  3SEQ A;  3D0S A;  4HNV A;  3L2V A;  4EGJ A;  3LQR A;  1LFU P;  4O2A F;  1LPQ A;  1T0F C;  1Z7U A;  5GAG J;  1MOW A;  2YW2 A;  2ZBK A;  2QQB A;  1XCV A;  1V3F A;  2X1E A;  2VPS A;  1TWH J;  1ZHF A;  3GTP A;  5J1R A;  2R92 A;  3IH4 A;  2EH3 A;  2NAZ A;  1D1B A;  3H0D A;  5C44 J;  3GQC A;  4KIB A;  3PO2 J;  3KHG A;  3ABK H;  5IYD J;  3CUQ C;  3GZ5 A;  2L4A A;  4XN3 A;  2E5Z A;  4FAS D;  1WSU A;  2QEN A;  2UUZ A;  1J5E H;  2L9N A;  3ECH A;  3QP5 A;  4M3F A;  1KZH A;  5EJC A;  5A2Q K;  4U7B A;  2L9V A;  1SFO J;  2C35 B;  4WWC A;  1KA8 A;  2FBK A;  5C5J A;  4L5E A;  3RIZ A;  2ZDG A;  3F8N A;  1TW3 A;  3N40 P;  3RBE A;  1J75 A;  3VYR B;  1BJT A;  4BYY A;  3G1O A;  4MQ9 F;  5K7F A;  3TDU C;  2BQR A;  1LNW A;  4A3B G;  2PJR B;  1YS6 A;  3GME A;  3A01 B;  2QQ9 A;  3FKJ A;  3KTM A;  3K69 A;  1PJR A;  2M30 A;  2HR3 A;  4FBU A;  3J81 Z;  3PQJ A;  3ZPL A;  3EUH C;  2WB1 A;  3ASN H;  3E97 A;  1E3O C;  2VPL A;  4L9T A;  5IYZ F;  2W7P A;  1RKT A;  3SYT A;  3A4C A;  3I64 A;  1ZR4 A;  2VBY A;  4JX4 A;  2Y0S N;  1S29 A;  1WH5 A;  4MFE A;  4DZJ A;  5LHI A;  1MW7 A;  4XRS A;  1T39 A;  3P9K A;  2R6F A;  3AG3 H;  4AYB A;  3RGZ A;  4L9V A;  4A0Y A;  4O4I F;  2R8I A;  4BE1 A;  5GPC A;  4RB3 C;  4JQF A;  4DBQ A;  4UN9 G;  2R7M A;  3SI8 A;  3LFK A;  2FLL A;  3GTK A;  2R7N A;  1BM9 A;  1NTC A;  3MXA A;  4CO8 A;  3RIR A;  2PG4 A;  1JDE A;  2E2I A;  1SFK A;  4AVZ A;  1JKQ C;  4FQG A;  4X0G A;  4EGZ A;  2RV8 A;  1B24 A;  4A3F J;  3G6X A;  1WGX A;  2NUA B;  3Q8Q B;  1B9M A;  1LDJ A;  3AYH B;  4J9Q A;  4UV9 A;  2Y9Z A;  1M0W A;  2HOS A;  1MJ9 A;  2JA6 A;  2JA7 J;  3TDZ C;  1LB2 A;  5A77 A;  1QGP A;  4NC7 A;  3K9T A;  4DW6 A;  2P5K A;  1QVT A;  3LP8 A;  3HGG A;  2KIQ A;  3DQV C;  3BCB A;  2IN0 A;  2K9S A;  1HA8 A;  1X1C A;  3PJR A;  2IJL A;  4A5M A;  3SJM A;  2JEJ A;  3H35 A;  3CCE I;  4YY3 H;  2HQ5 A;  4A3I G;  4HZF A;  4UB6 C;  2ZXW H;  2R7O A;  3MR3 A;  4P9F A;  3HG9 A;  3JRF A;  2MD0 A;  2DTZ A;  3WGH A;  2G7U A;  3OOU A;  3TKY A;  2DMQ A;  4M72 A;  5K5Q A;  3IFJ A;  5D1O B;  1OCP A;  5KG6 A;  4HDV A;  3LFU A;  1MNM C;  4PSX A;  2E34 A;  5KK1 A;  5C4J J;  5LGU A;  2OTL I;  3R5X A;  3ELK A;  5KG1 A;  1KQ0 A;  3E6B A;  2DFF A;  4GKJ H;  4LIT A;  2EA4 A;  3E54 A;  4X65 H;  3ASO H;  4C5B A;  4TQR A;  3R5F A;  4BY7 G;  4BBR J;  2E7X A;  4RUA A;  1MZB A;  2JA5 A;  1U0C A;  2ZM6 H;  5A0W A;  3CDI A;  4YAJ B;  3U9G A;  2A69 F;  3D1N I;  2W57 A;  1K78 B;  4A3C G;  2LP0 A;  4MFD A;  1VKZ A;  4AAG A;  3RZD J;  2B63 J;  3QU3 A;  2UXB H;  1S7A A;  2EFO A;  2L9R A;  3PUB A;  5ICG A;  4YIT A;  1S68 A;  1M0T A;  1RET A;  3E6M A;  2CMP A;  1AA7 A;  2PVP A;  3C1D A;  4U0W A;  4NDL A;  1RJR A;  4ECT A;  4KNY A;  2EWN A;  5LRR A;  4ECS A;  2FK1 A;  4LSX A;  3KE2 A;  4UVB A;  3IL2 A;  2V5A A;  1MKM A;  3DBH B;  1GDT A;  2FJZ A;  3GIQ A;  3O8H A;  2O8X A;  3OYI A;  1WCM A;  4G7H F;  1G9Y A;  4MV7 A;  3FM3 A;  2FLP A;  5ILS A;  1H88 C;  4HPQ A;  3BZ6 A;  2DPJ A;  5KFO A;  4UN8 G;  4BAY A;  1NK2 P;  4BXX G;  3I59 A;  4I76 A;  1L0O C;  1T0F A;  3SZT A;  1WH2 A;  3KAL A;  2GIV A;  5A0M B;  1IN6 A;  4PJL A;  4DL5 A;  2ESH A;  2BZT A;  3N44 B;  2DU9 A;  2HDD A;  3JRD A;  3H3V H;  5EDW A;  2R5Y B;  3CC2 I;  1T3N A;  3BJA A;  4HEA 2;  5E1W A;  2FQ3 A;  2I3Q A;  2W8L A;  5KT3 A;  1P6R A;  4LD5 A;  2PMZ A;  3BR0 A;  3ZCO A;  3K3P A;  1VQ6 I;  1RC9 A;  2J5P A;  3QYE A;  1IV8 A;  2O6G E;  4EEQ A;  1FWZ A;  2VQG A;  2A68 F;  1K83 J;  3NWT A;  3H4B A;  4LF4 H;  4BDY A;  2OCE A;  5BPD A;  4IHV A;  4KYW A;  3GIL A;  2C2E A;  2PLY A;  3HRU A;  3VOD A;  4GXO A;  4Q45 A;  3GEZ A;  2E2J J;  1ZK8 A;  2VJI A;  1M5X A;  5CVR A;  1GSO A;  3LSH A;  3CCL I;  1AN7 A;  1JTY A;  3M4I A;  5ICF A;  1ACI A;  4IHW A;  3ZMT A;  2XF7 A;  1FP1 D;  2BBY A;  2FBH A;  4LG3 A;  1MDM B;  2BVM A;  4BGD A;  2WTE A;  3H9G A;  1ITY A;  1X1B A;  2CV0 A;  3N42 B;  1USS A;  5GTI C;  4E7K A;  2NS0 A;  1NH3 A;  2HZD A;  2UUB H;  1ULY A;  2VKD A;  4HV5 A;  5ILV A;  1BGW A;  3I56 I;  3Q9S A;  4EFJ A;  1B6S A;  3D5L A;  4LH7 A;  4I01 A;  5EEG A;  3MX9 A;  3R7P A;  5C1O A;  3GTQ A;  1UHS A;  2VUM A;  1R1V A;  3MXB A;  2HU9 A;  5CA0 F;  1PX2 A;  4BJ5 C;  2NS7 A;  4RGR A;  1ZEL A;  2VE9 A;  2R7Q A;  2XGC A;  4PJN A;  2W9B B;  3FXR A;  4KUM A;  2BHZ A;  3P9I A;  4KN4 X;  4RGU A;  3ZQ7 A;  3WTW C;  4EJT A;  3RF2 A;  5KT2 A;  4DR4 H;  3KP7 A;  2C22 A;  4PK4 A;  4IZO A;  2WTF A;  1FZP B;  2VOB A;  1V4Y A;  1Y8R B;  2BQU A;  2HOA A;  2CUJ A;  3CQZ A;  1I3Q J;  3K4M A;  1R7M A;  3VYU B;  3BCA A;  3CLO A;  1STZ A;  4C3J J;  1Y0N A;  2OAZ A;  4BEH A;  4DR2 H;  4DR7 H;  1UEL B;  5LEJ A;  3KZZ A;  4HR7 A;  4ECU A;  1E3P A;  3KEQ A;  2MAB A;  3GTM J;  1A36 A;  1S72 I;  5DLG A;  3CMA I;  3I12 A;  1BNC A;  2LK2 A;  4AAD A;  2ID6 A;  5D6E A;  2E71 A;  1IG7 A;  3T8R A;  3LMM A;  4CUG A;  3AG1 H;  3DEU A;  3TOB A;  2KFD A;  2FP4 B;  4WK8 F;  1YHQ I;  3JRA A;  3ZRG A;  4B09 A;  1I50 A;  2F4M B;  1R5H A;  2KSW A;  3QOE A;  3V6H A;  4A69 C;  2K7L A;  4OX9 H;  3BLY A;  4PFP A;  2DA4 A;  1V9P A;  1LKX A;  2XV4 S;  1FBQ A;  2Y0S A;  3IH3 A;  4EJU A;  1U78 A;  1IOV A;  4XRM A;  1VF9 A;  2MFZ A;  1QZE A;  3KYD B;  4ECZ A;  4BQQ A;  4EQQ A;  1PUE E;  2AS5 F;  1TWC J;  1JXS A;  2P7C B;  1K1Q A;  4MV3 A;  2Z99 A;  2BW3 B;  2FPI B;  2HKO A;  5IY5 H;  1HKQ A;  4RNM A;  3KCC A;  2OH2 A;  4DV5 H;  3FHN A;  3L2R A;  1D1A A;  2X9D A;  1HF0 A;  5F0H A;  4HAM A;  1UJ8 A;  4L0Z B;  1XMO H;  3OYB A;  4MIM A;  5JQW A;  5LOV F;  2F4V H;  1X3W B;  2E19 A;  2CV2 A;  4LLG F;  2CQK A;  1VFC A;  1MBE A;  4BBS G;  3RB0 A;  2V9W A;  3WU2 C;  3SE7 A;  5E3O A;  1D1C A;  1EV7 A;  1Z67 A;  2VE8 A;  5HV6 A;  2OWO A;  4R7R A;  1EH7 A;  2CFO A;  4I99 C;  2IGO A;  3C2B A;  3JTG A;  1WHU A;  1RES A;  2C2R A;  1FBS A;  3J7A Y;  4ED2 A;  4EEY A;  3FK7 A;  3WOD F;  4WBN F;  2WAD A;  2V59 A;  2Z33 A;  4AQU A;  4QPO A;  4LFU A;  3GTL A;  2VON A;  2L54 A;  3I3L A;  1MSE C;  3VPD A;  2W6Q A;  4KHP H;  4KIC A;  2V1X A;  1MMA A;  3O2P E;  1XPX A;  2UXN A;  4F3Q A;  4NQW A;  2LBF A;  5A74 A;  2AQ4 A;  2DPI A;  3C3W A;  2WC2 A;  3HOS A;  1MD0 A;  2QBY B;  4WCG A;  2V1D A;  3KHL A;  4JX6 A;  5M5W J;  4E2U A;  1FJG H;  3PQK A;  2DI3 A;  1ZET A;  4XLH A;  1EYZ A;  4BXU A;  1V51 A;  4ESJ A;  2GXB A;  4E7S A;  4IRC A;  2W85 A;  2DOE A;  4Y13 A;  4YIS A;  5CB4 F;  4JI2 H;  5L3E A;  2YL2 A;  4DV0 H;  3KHH A;  2VC1 A;  2ZB9 A;  3QQA A;  5D6F A;  4BY7 J;  1YJ9 I;  5IPA A;  1TQM A;  4F4Y A;  1YIO A;  3I4P A;  4YFX F;  4FX4 A;  2IMW P;  4M3E A;  1QA6 A;  3R60 A;  4QLC U;  1UZC A;  2KMU A;  2QGU A;  5E5O A;  3BAB A;  4A3C J;  3PW0 A;  1IAW A;  3DU6 A;  1VQL I;  1BR2 A;  2KIM A;  5IT9 W;  3ORR A;  4NC8 A;  5HDN A;  1G2H A;  2J9G A;  1D8J A;  4O6J A;  3OYD A;  1TWG J;  2GOM A;  4HQE A;  4ENK A;  2PJR A;  4XM3 A;  2P8T A;  3J80 Z;  4C5C A;  4FT8 A;  3A01 A;  2M0M A;  2XHK A;  3FKI A;  3VPC A;  3J7A O;  4DUY H;  2VBN B;  2X1C A;  5KT4 A;  2VS7 A;  4ZDP A;  1IRF A;  4HNU A;  1AOY A;  3BQZ A;  3KEO A;  3TQT A;  4ECV A;  2O3F A;  1MH4 A;  5E8G A;  4ZJZ A;  1KGS A;  4BXX J;  1HXD A;  3GZN B;  5DYM A;  1B59 A;  4EMS A;  4HQ6 A;  3TGN A;  2W9A A;  4NXN H;  4XOP A;  1G3T A;  3CTA A;  3K4B A;  1OPC A;  2LRE A;  1D3Y A;  2F2E A;  3R4K A;  4PGG A;  2R7R A;  4JI8 H;  2C6Y A;  3M9O B;  5KG3 A;  1I39 A;  5M3F J;  4G94 A;  3K4C A;  4A3E G;  2OQG A;  2KIF A;  4MV6 A;  1MBG A;  2Z2S B;  4YII A;  4YHX A;  1M6V A;  1EA3 A;  3BG9 A;  4E7I A;  4CCO A;  1J7K A;  2ISZ A;  2R7T A;  1FIA A;  2EIK H;  2OCC H;  3S3O A;  1ZD7 A;  3UQ8 A;  1U2W A;  1Y1V A;  2R86 A;  4CCN A;  4XIC A;  4H4K C;  1AUX A;  1Z05 A;  4RS8 A;  4IJA A;  3ZN0 A;  2CJJ A;  2F5C A;  4D1Q A;  2R84 A;  3OOR A;  1SAN A;  2RGV A;  2K02 A;  2QF7 A;  3L9F A;  2MD5 A;  4XID A;  3U21 A;  1VQN I;  5KG5 A;  4EYH B;  5T14 A;  2ZC2 A;  3D5S C;  4IQJ A;  4RUC A;  1G8X A;  4XLP F;  5C3E G;  4Y7N J;  3TQN A;  4GRI A;  5KFY A;  5FKM A;  2CH0 A;  4AM3 A;  2K86 A;  2ZFW A;  1PDN C;  2IP2 A;  3EPZ A;  4L0Y B;  3SDG A;  3GID A;  2ZJP F;  1V5E A;  1G6N A;  2IN8 A;  1LDD A;  1GV5 A;  4IHS A;  5D1O A;  4IRG A;  4LF6 H;  2DA3 A;  4IR1 A;  2JWT A;  4PGH A;  4DV6 H;  2LKS A;  3LML A;  3Q9V A;  1VQ5 I;  3S1N J;  1S97 A;  5JLW A;  1RKW A;  3M07 A;  4MV4 A;  3U2R A;  2JUG A;  4GC6 A;  1LQ1 A;  2DYS H;  1V55 H;  2XPU A;  1N3E A;  3OTO H;  2ECC A;  4BJT A;  5KAI C;  4HRI A;  3CMM A;  2AO9 A;  5CVJ A;  3VPR A;  1Q1V A;  3MR5 A;  4DV1 H;  2DA7 A;  2STW A;  3OYC A;  4EFB A;  2KKO A;  2DFE A;  5D8L B;  2ZNY A;  3CDL A;  1IN5 A;  1K78 A;  3W6V A;  1YYV A;  3F8C A;  1QZZ A;  2L4M A;  3S1Q J;  1T08 B;  3K4N A;  1K1S A;  2DFH A;  5JVG F;  1PUF B;  4F4W A;  1GXP A;  4AQX A;  2UVU A;  5KKN B;  3Q3S A;  4BS9 A;  1RUN A;  1S9H A;  5KFH A;  2IA1 A;  5EWG A;  4AID A;  4Q0Y A;  4KDP A;  3PO2 G;  3H20 A;  3OSP A;  5DG8 A;  3E0J B;  4YP3 A;  5H20 A;  2O8K A;  3GTG J;  1U5T C;  1QHH D;  4GFB A;  1APL C;  2R82 A;  1J2X A;  1YG2 A;  3CP8 A;  1WJF A;  5C4X J;  4ESF A;  1EH6 A;  1QQI A;  3FMR A;  4LK0 F;  3MZH A;  3FF5 A;  3TBI A;  4LG0 B;  2VUG A;  3S16 J;  4DQ2 A;  3SHF A;  2VBL B;  4IEJ A;  2DT6 A;  3NRV A;  1JJ6 C;  2O7M A;  2HQA A;  3A02 A;  3FBN B;  2O61 A;  5A0M A;  2XUB A;  3RFC A;  4UHT A;  1XGS A;  4QFQ A;  5A2Q Z;  5KX5 F;  2R5Y A;  4LFC H;  4UCO A;  3TOA A;  3MMY B;  3TED A;  3DTI A;  4IQ4 A;  2BHY A;  3DKX A;  2K4J A;  5KG4 A;  2ZXJ A;  2ZSI B;  3K7A J;  2AU0 A;  1T56 A;  5DGB A;  4JV2 A;  4CYD A;  3E5N A;  3ML6 A;  4G6T B;  2OA4 A;  2HWV A;  5AON A;  1Y6I A;  1Z0X A;  5J6X A;  4YIR X;  2XKO A;  1FSE A;  1ERD A;  4NXM H;  3CVZ A;  4DL7 A;  4YEJ A;  2KP6 A;  5ILU A;  3GF2 A;  2EZL A;  2XKP A;  2H1K A;  3F8F A;  1XCB A;  5E20 A;  5E5S A;  3AG2 H;  2V58 A;  1MMD A;  2VQL A;  3C18 A;  2EIM H;  2EPF A;  1YI2 I;  2WY8 Q;  3K0L A;  4Z6Y A;  4E7J A;  3C0W A;  4O3Q A;  4AYB N;  1P8L A;  3HDD A;  4YFN F;  3GCM A;  4XZ3 B;  1YX5 A;  2E1O A;  1V54 H;  2NNY A;  1MDM A;  2RDJ A;  2Q1Z B;  4IR9 A;  2WV1 A;  1QBJ A;  5FFZ A;  2UV1 A;  3S3M A;  3QP6 A;  3BOQ A;  3J7Y J;  1Z6T A;  4O3O A;  1XSX A;  2CUE A;  4WF2 A;  4GKK H;  2Y0M A;  2DFI A;  4Q4Z F;  1UNN C;  2VKV A;  4DV3 H;  1SVL A;  3CZ6 A;  4OIP F;  2DXI A;  2P7V B;  1FKA H;  1YQA A;  1LDK B;  2CQN A;  4GLX A;  5DUI A;  5E17 F;  4BE2 A;  2XAU A;  1X3Z B;  3GIP A;  4CC5 A;  2DBB A;  5CA1 F;  2W9B A;  3EQL F;  1RJP A;  2KRF A;  3WE2 A;  4QIW E;  2XPV A;  5IP7 J;  4A6E A;  1W0T A;  4IHJ F;  2QVO A;  1HDP A;  2JRT A;  4RM2 A;  1LE8 B;  1QHG A;  3QPL A;  4II2 A;  4LGW A;  3ERE D;  2EIN H;  5KFG A;  2VBJ B;  3PNV A;  1LFB A;  3PR4 A;  2XAG A;  3HPH A;  3SFZ A;  4FS1 A;  2ZJT A;  2L7F P;  3Q5F A;  2ZJR F;  1BW6 A;  1R58 A;  4XBF A;  4MA0 A;  3A0H C;  4FX0 A;  1S10 A;  2VQC A;  2CSO A;  4UN8 A;  2FML A;  1NG7 A;  4PJM A;  1IBK H;  4DV4 H;  1K6O A;  3C7J A;  4HF2 A;  4D7N A;  4O1R A;  2IGK A;  3KAJ A;  1EH8 A;  1TT0 A;  1A35 A;  3HUG B;  4ENN A;  3MIP A;  2V9P A;  1ZHS A;  4RGX A;  4EJW A;  4UUS B;  2NVY A;  4N4N B;  4IPA A;  1MSF C;  3M9N B;  2B63 G;  2COM A;  5CVI A;  3OWT A;  3H5A A;  4B1R A;  3JRE A;  2A61 A;  2XRO A;  5E18 F;  4LF9 H;  2F5E A;  2R93 J;  3N4M A;  3KP3 A;  2HQN A;  1AF5 A;  4O5V A;  4CYC B;  4EGQ A;  1RYR A;  5KFR A;  5HLG A;  2W82 A;  3K1P A;  4HBL A;  2A6H F;  2XDV A;  1K4S A;  1DPU A;  3FDS A;  2RQP A;  3FBI B;  2IW5 A;  3DPT A;  4H0E A;  2FPP B;  2BW3 A;  1FPQ A;  3O3K A;  1KU7 A;  3TO6 A;  3K2A A;  5IOZ A;  2QSF X;  2ZKZ A;  1IUY A;  1GO3 E;  3C0X A;  9ANT A;  2DCH X;  3GLX A;  2X6Y A;  1IXR C;  4U7D A;  4ENM A;  5F9N A;  3BQ1 A;  4QWA A;  1ETK A;  1IN8 A;  1HW5 A;  4M9X A;  4A3E J;  3GIK A;  5FKK A;  3TQ1 A;  2BY0 A;  1HKT A;  4DV7 H;  2HVQ A;  3DTE A;  1UC8 A;  2KZV A;  1ZG3 A;  1JT0 A;  4ED8 A;  1ZRD A;  1HW1 A;  2JK3 A;  3GFL A;  1XGN A;  3E5U A;  2PMU A;  2W7N A;  1FYM A;  4CGZ A;  5JHU A;  2ASL A;  1S8N A;  2VT2 A;  2DT7 B;  1SAU A;  1IDZ A;  2YX4 A;  4M73 A;  2O03 A;  5FKN A;  2JQ7 A;  1O3S A;  4AIJ A;  5HDG A;  1JKJ B;  2X0S A;  4EG0 A;  4A2B A;  1ZAR A;  2K3F A;  5KG0 A;  1BJA A;  1BR1 A;  2PMZ N;  4TUY F;  2JA5 J;  1Y1W G;  2F48 A;  3M1C A;  1KYZ A;  2L7Z A;  1IXC A;  2QM3 A;  3WTX C;  4DNC A;  1B04 A;  1QVU A;  2LCJ A;  2QLZ A;  2VI6 A;  1V5G A;  2M5W A;  2XB0 X;  3EUA A;  3L2U A;  1D5V A;  3RB3 A;  5C3E J;  5DG9 A;  1N75 A;  2LG4 A;  2OPT A;  4RDU A;  2YU9 A;  2ELJ A;  2J6U A;  3HIF A;  1BC8 C;  3OL3 A;  1U8B A;  3T5K A;  5L1L A;  4IF4 A;  1UMQ A;  1MMG A;  1YOV B;  2QBY A;  2ZDQ A;  3KFW X;  3VSK A;  3K10 A;  2M4K A;  4B3S H;  5FKL A;  3JAM W;  3S2H J;  4MHG A;  3ZXS A;  4J9R A;  3FX3 A;  3K1M A;  3DU5 A;  3GV7 B;  2R8G A;  3IH2 A;  2M9H A;  2CQY A;  3SEZ A;  2Y48 A;  1S03 G;  2UWM A;  3VPB A;  2HOE A;  2NU7 B;  3LQQ A;  1POG A;  5K5O A;  1XGO A;  4C2M J;  3M8E A;  5GAD J;  3BR1 A;  4NB5 A;  4U88 A;  4JI7 H;  4B3R H;  2RKH A;  1I27 A;  2YUS A;  1A9X A;  3S1R J;  1FEX A;  2AB5 A;  1XMK A;  2FUG 2;  2JA2 A;  5ERI A;  1RI7 A;  1Y39 A;  3RV3 A;  1R9T A;  3IV5 A;  3RJ0 A;  4I50 F;  5DM7 F;  1P7J A;  3FK6 A;  1X1A A;  1YJN I;  4LX3 A;  2PBI A;  3ABT A;  4E4T A;  1VQP I;  2ZME B;  5EYR A;  4ZYG A;  1JT6 A;  1N78 A;  2NU9 B;  5HS7 A;  3TII A;  3OYF A;  2QA4 I;  4EEF G;  2OLS A;  3PIO F;  2AGP A;  4S0H B;  2PX9 A;  2VR1 A;  2P4W A;  4JP0 A;  1BL0 A;  2ELH A;  3IP4 B;  1HBX G;  3QQY A;  5EG0 B;  2KRH A;  3GIJ A;  1Z91 A;  4XR6 A;  3RZO J;  3N8D A;  3GLK A;  3RDI A;  3OYE A;  3OYJ A;  1S0M A;  5DCF A;  2VKH A;  5F1J A;  3Q1K A;  4ECR A;  4K2E A;  4KMF A;  3R23 A;  2IPQ X;  5L1I A;  1VQ9 I;  2DDB A;  5AIP A;  4DYQ A;  5J4Y A;  4DYR A;  3I0T A;  2C28 A;  4G6Q A;  4RBO A;  3JZI A;  4R8U B;  1W4M A;  3WGG A;  1XDN A;  1JGS A;  1YS7 A;  3TP0 A;  4WD3 A;  1KU2 A;  2VS8 A;  2E1N A;  5EZY F;  3RI4 A;  2XAH A;  3CMY A;  5LL6 b;  5C8Y F;  2R7Z A;  4A2U A;  3HHH A;  3HPG A;  3HJE A;  3HOX G;  2QZ8 A;  1C0W A;  1N3F A;  4O3N A;  1RJQ A;  4BHC A;  3CC7 I;  4UN7 A;  3FXK A;  3RYR A;  3ZQL A;  4Z2Y A;  4DBR A;  2Z3Y A;  1WFX A;  3DLA A;  3I53 A;  4HNT A;  4DIQ A;  1QNT A;  4LFA H;  1MNE A;  2BXY A;  3BA9 A;  1DGW Y;  3EYI A;  2NOJ B;  2W6N A;  4II3 A;  4D7M A;  3VYT B;  1VBH A;  3PW7 A;  3RKX A;  2BR0 A;  2TRT A;  2HPI A;  3M8F A;  3H3Z A;  1NHA A;  5E3L A;  1BP7 A;  1X19 A;  1VTN C;  3DPL C;  5FRM A;  3G8C A;  3LNQ A;  4V2F A;  1XN7 A;  2HXO A;  4X64 H;  2AXT C;  2I10 A;  1OCC H;  4PWQ A;  4IHX A;  1ZKG A;  3GTJ J;  2R7U A;  1EKE A;  3JR9 A;  4M9U A;  4RAZ A;  1DGR M;  4EFE A;  2F5V A;  1A6Q A;  5J47 A;  2XGX A;  4DR1 H;  1SVM A;  4CXF A;  1YFH A;  2A3S A;  1AHD P;  1ZG5 A;  3L09 A;  3JRG A;  4U0V A;  3IGD A;  4UT0 A;  1SEI A;  2HOT A;  1IBM H;  1I50 J;  4I98 B;  4P96 A;  2IGN A;  4XLA A;  4XKV A;  2M4G A;  5GP9 A;  3W2A A;  4OOI A;  4QWE A;  3U9T A;  3ISP A;  5L1J A;  1Y0U A;  1D0X A;  2QQ8 A;  5K7Z A;  2YYA A;  2UU9 H;  1HNW H;  3CCQ I;  4LOC A;  2HQR A;  2ZNZ A;  1AT0 A;  3ZMU A;  1ZHQ A;  4F4X A;  4IRK A;  4A3G G;  4O3R A;  1SD5 A;  2EFN A;  5TJJ A;  3TW6 A;  4CH7 A;  1PUF A;  3JAM K;  5EWF A;  3E3V A;  3S32 A;  3BDD A;  4N9I A;  1FMW A;  2HJW A;  1EUC B;  1JLL B;  1TWF A;  5JI6 A;  2UUC H;  1ZG1 A;  2X0L A;  3CES A;  3QOP A;  2A05 A;  1BC7 C;  2GM4 A;  3PFY A;  4RAF A;  5FLM G;  2CW7 A;  3H0G J;  2PI0 A;  5F04 A;  4APM A;  4LG0 A;  4D5C A;  2AGQ A;  4HLY A;  2VBL A;  2F5D A;  1PP8 F;  5FD6 A;  1TWA J;  2VOD A;  2V4J C;  4FU0 A;  3V8L A;  2M2E A;  3C2H A;  1WI3 A;  3GVA A;  4UFZ A;  1UFM A;  1JX4 A;  5LBQ A;  1ETV A;  3AL0 B;  2E2H J;  5HS9 A;  4IAJ A;  1KBL A;  4DGW B;  2M05 A;  3BY6 A;  5LLQ A;  1WZ2 A;  2W25 A;  3ULQ B;  1WKM A;  2F6C A;  3VDX A;  2GPW A;  2ASJ A;  2ALZ A;  3M4O J;  1P4X A;  2EB7 A;  2M7A A;  3RPQ A;  5JUM A;  2FPG B;  3U1D A;  1ETQ A;  4M71 A;  3ZMV A;  1E3H A;  1JGG A;  4YQW A;  1VAJ A;  1UHW A;  4A3M G;  3VB2 A;  4BDZ A;  4KJZ A;  1OYI A;  1O7L A;  1TNT A;  5KG2 A;  4R8H A;  2CUZ A;  5KFJ A;  3G1M A;  3PW2 A;  2BXZ A;  4ZZD A;  2WV0 A;  2V9V A;  4BH9 A;  3ETJ A;  1YW8 A;  2DOA A;  1FY7 A;  2KDO A;  1R6R A;  4TQS A;  3BR2 A;  3JRW A;  1VQ4 I;  5KFK A;  5I0A A;  1XDU A;  1YO5 C;  4Z1Z A;  3LA7 A;  2OQR A;  2LNB A;  2DK8 A;  3ONQ A;  3JTH A;  1P7I A;  1QO0 D;  1JE8 A;  3HOZ G;  2XB5 A;  3HRS A;  2OF7 A;  5GPA A;  1Y1W J;  4YAK B;  3L2P A;  2FF4 A;  1TLH B;  3KLN A;  4BJ6 C;  1VDE A;  3JRH A;  4G12 A;  1HNX H;  4G3I A;  3G2B A;  3SFI A;  5KT7 A;  4ZYH A;  1TWH A;  5DS9 A;  2F4I A;  1JKP C;  1IN7 A;  2IXS A;  4XYL B;  1TAE A;  2DQR A;  5IYB J;  1LE8 A;  5D8D A;  4PUS A;  3AFH A;  3ETH A;  3KYC B;  1Z21 A;  3MR6 A;  3OR1 C;  2VBJ A;  4FS2 A;  1KEE A;  2Z5U A;  2ADU A;  3S1M J;  2HHH H;  4JYK A;  2DAO A;  2Y9Y A;  3RQI A;  2ACJ A;  3K5I A;  3LSJ A;  4QIW A;  1GHC A;  5KFU A;  1SFO A;  3CCU I;  1YW7 A;  4ED3 A;  4CIC A;  2AQF A;  5AKF A;  2YCH A;  2ATL A;  1R1T A;  3H36 A;  3HKZ E;  4EBE A;  2LD5 A;  3LWF A;  3PSI A;  3Q2O A;  4CSW A;  4FTH A;  4N4O B;  4IWX A;  1XDS A;  5DV5 A;  2R7D A;  3QPS A;  2GAU A;  2JRM A;  3HUG A;  2YPR A;  1BIA A;  1J09 A;  4UUS A;  5CYV A;  2ZDH A;  3KZI C;  4KFC A;  4AAB A;  4B3A A;  2R8H A;  1UAA A;  2QYZ A;  2FLD A;  2VJ5 A;  3R5H A;  2DQL A;  2XE0 B;  4MQV A;  3P7N A;  3PFI A;  2W24 A;  3NAR A;  3GX4 X;  1ZGW A;  4W1U A;  2KL4 A;  4CYC A;  5FGM A;  3W2W A;  1T6S A;  1W36 D;  3FMA A;  2Y69 H;  1FOW A;  1RIO H;  3WGI A;  3F6V A;  3OHB A;  2Q2E B;  1IRG A;  2IGM A;  2KLO A;  4G8X A;  5C4X G;  2IT0 A;  5HLT A;  1HQC A;  4V2G A;  5H6Q A;  4DLK A;  5FLX W;  4J9K A;  5KFA A;  4BNC A;  5KT6 A;  3OSF A;  2RDI A;  1NG6 A;  3GXO A;  4OU0 A;  3TIN A;  2K85 A;  4I6Z A;  3LSM A;  3V4Z A;  1HR0 H;  2CFX A;  1RYS A;  3NWS A;  1IBL H;  4GC7 A;  4AAE A;  2EV5 A;  3JSL A;  3HBL A;  3OV8 A;  2JA7 A;  1XD7 A;  4LF7 H;  4ED1 A;  3BZC A;  2DMT A;  3HRM A;  4O1S A;  4FET A;  2HKX A;  4D0P A;  3JRI A;  4CDG A;  1L2Z A;  1W5T A;  1IF1 A;  2EV0 A;  5IT9 Z;  3HOX J;  3BRO A;  3OL4 A;  1A5J A;  2LQM A;  2RAE A;  5ICE A;  3LA3 A;  4I7H A;  1K6Y A;  3WTS C;  1RZ4 A;  3F21 A;  2DA1 A;  3M9A A;  1R71 A;  4QJF A;  4G9Y A;  3FXQ A;  2DK5 A;  3DEE A;  4GIG A;  3IRR A;  5EF6 A;  2XF5 A;  2RN7 A;  4WXC A;  4EAT A;  3S93 A;  2L01 A;  1B1B A;  2V1U A;  2VXZ A;  3V7R A;  3PW5 A;  1HKS A;  3FHZ A;  2K9N A;  3UFX B;  4Y4R A;  4JI5 H;  1C3O A;  2N8G A;  2LY1 A;  5DD4 A;  2P0W A;  2XPW A;  3CJN A;  4ESB A;  4IOA F;  3HRT A;  2A5Y B;  1I3A A;  3ABM H;  1OIS A;  2Z16 A;  4C3H J;  5FD5 A;  3HOT A;  2W00 A;  5BOX A;  2GLT A;  1IZ1 A;  1RUO A;  4MNU A;  1ON1 A;  5IP9 G;  3GTO J;  4J9P A;  1LFP A;  4RNO A;  4ECX A;  2GA1 A;  3BTC A;  1HC8 A;  4M9Z A;  5IT3 A;  4F92 B;  4O3M A;  4GYG A;  2B63 A;  5DM6 F;  3UR3 C;  4HSR A;  1T9J A;  2L7K A;  5IP7 G;  1N77 A;  2FLN A;  3F9K A;  3Q0V A;  3WU0 A;  5DG7 A;  3MWD A;  3P5J A;  3QU6 A;  1YTY A;  5GAE J;  1E17 A;  1T9I A;  1WPK A;  2ICW G;  2DA5 A;  2HZT A;  2WAQ E;  1ZQ7 A;  2YZM A;  4A3G J;  2ETH A;  3IWZ A;  1IN4 A;  3GW2 A;  5H2F C;  5A72 A;  5BMZ A;  2ZME A;  3SZG A;  3HB9 A;  4CZZ A;  2NXN B;  1WWX A;  1G59 A;  1DU6 A;  3WE3 A;  2GLO A;  2O0Y A;  1EHI A;  3T5H A;  3FM5 A;  4DL3 A;  4JI0 H;  2GPS A;  4ED0 A;  1Z3Y A;  5EG0 A;  5FLM J;  1P92 A;  2CUF A;  4JK1 X;  2NVX J;  1GXQ A;  4UVC A;  1Z2N X;  1ORK A;  2CU7 A;  2R7F A;  3HKZ N;  4ETS A;  5JFR A;  5JR3 A;  1A31 A;  4KIS A;  5JH7 F;  5L1K A;  2MH9 A;  2ISY A;  2VL8 A;  2ELK A;  3W2V A;  1GLV A;  3IAS 2;  5CVV A;  1H9G A;  4M6V A;  3IRQ A;  3VSL A;  5KFE A;  2EK5 A;  2R93 G;  4FIS A;  1JHF A;  1Z2O X;  4YB8 B;  2UVR A;  5D1P A;  1K83 A;  4R8U A;  2JA6 G;  5LXT F;  1BN5 A;  4EGY A;  5LRS A;  2QSH X;  3N05 A;  2WYO A;  4QWB A;  2JTV A;  2PN6 A;  4S04 A;  1BI2 A;  4U7C A;  2VT3 A;  3HOW J;  2XCL A;  3ZQG A;  1DUX C;  1ULZ A;  1WR2 A;  1B6A A;  2MGQ A;  3RTR A;  3HYJ A;  2HGC A;  2R7X A;  4A3M J;  2CKZ B;  2CZG A;  2CQ7 A;  4A6D A;  3CME I;  1P4W A;  1FC3 A;  1BXR A;  4A12 A;  4O3P A;  2V4R A;  5FLX K;  1FP2 A;  3C2G A;  1Q1H A;  3T5J A;  3K4K A;  4MTD A;  4UNO A;  2FX0 A;  2WBM A;  4W97 A;  1I94 H;  2IP4 A;  4L1K A;  2VB6 A;  4JV1 A;  3LAJ A;  4BHB A;  2FMY A;  1LWS A;  5HOD A;  4NLG A;  4KN7 X;  1MBJ A;  3IKV A;  2UXC H;  5LMU H;  2EZK A;  4B44 A;  5CQG A;  4EM0 B;  2DJI A;  3ZMZ A;  1TQI A;  3HOZ J;  2E7W A;  2I87 A;  2XC9 A;  1WJB A;  3DKY A;  5CQE A;  3MKY B;  2DIK A;  2UVV A;  4KIG A;  1F43 A;  4C3I J;  1MND A;  4CCK A;  4ENJ A;  2H6C A;  1YRN B;  4M7E A;  2R7V A;  2JA5 G;  3GII A;  4O4H F;  1FOK A;  1SFX A;  4N9H A;  5HNF A;  4XKC A;  4DR5 H;  2OTJ I;  2WA0 A;  3F22 A;  1BJZ A;  1I3Q A;  4AC0 A;  1VQ8 I;  4A0X A;  5IWA H;  2W4S A;  2D5V A;  2UVW A;  1SFE A;  4JX5 A;  4ECY A;  3S14 J;  2QCO A;  2CQX A;  4KIF A;  3L2W A;  3OUU A;  4HV6 A;  3GTM A;  2EFP A;  4F91 B;  5LHG A;  1TT5 B;  2B0L A;  2QK4 A;  3S17 J;  2MA3 A;  3L00 A;  5DCM B;  1DV1 A;  3MEX A;  4A3L J;  3E1S A;  2LF8 A;  1JTX A;  4I0B A;  3CCV I;  1S6L A;  4XLC A;  4MV1 A;  3S8P A;  2YZG A;  2DPU A;  5LFA A;  5L9X A;  3U9S A;  5K2M A;  3GFM A;  3H40 A;  4E2T A;  1OYY A;  3DPU A;  3I58 A;  5HLH A;  3LSP A;  1B6R A;  4RB1 A;  4ZH4 F;  3CCR I;  3S3N A;  1GT0 C;  5BPH A;  4PJJ A;  4CCJ A;  4RZR A;  1X58 A;  4RGS A;  4D6O A;  2E5L H;  2KRC A;  1T2K A;  1X4O A;  2E1M B;  1ONV A;  2EV6 A;  3FWE A;  1UCR A;  5BNG A;  1PVE A;  2ZJQ F;  1ZR2 A;  2XGD A;  2B9S A;  1FNN A;  1TWC A;  2WAQ N;  4B48 A;  5KVR A;  2K27 A;  3KP2 A;  2EIL H;  1J59 A;  3L7W A;  2FE3 A;  3OUZ A;  4LQ0 A;  4HLX A;  1T33 A;  1RPW A;  2XGP A;  1YX3 A;  4G7O F;  3K70 D;  1C30 A;  4QWD A;  2KT0 A;  3RYP A;  4ED6 A;  2R7W A;  4UN9 A;  3BA8 A;  4EBC A;  1SD4 A;  2ASD A;  3CJT B;  3CO6 C;  1A04 A;  3RKY A;  4FCY A;  5BMV F;  1IRX A;  5L3C A;  1B8I B;  2Q2T A;  4E4H A;  1G3W A;  5B66 C;  4XLN F;  2JT1 A;  2HXI A;  4JV0 A;  5E8I A;  3GYH X;  3H3U A;  1ODD A;  3S2D J;  4C9Y A;  4L9N A;  4XSZ F;  2PBZ A;  1SCU B;  1DDN A;  3KP5 A;  1REP C;  2X1D A;  1UM2 A;  1N32 H;  2FU4 A;  3OYL A;  4A93 G;  2WE6 A;  2V4Q A;  2GBY A;  2W6P A;  5K7H A;  5KAF C;  5HLI A;  4IHT A;  5JVL A;  3V42 A;  2L3D A;  3HTS B;  5H80 A;  2VUM G;  2NVT J;  3MIS A;  1TA8 A;  3N97 A;  5J4V A;  2DOD A;  4KT5 C;  2QKM B;  4LLL A;  2HEO A;  1MGT A;  2KHM A;  3AG4 H;  2JEI A;  2DDA A;  1KJQ A;  1Z9C A;  4QTR A;  1KJJ A;  4DL4 A;  2HFH A;  5DDG A;  4AVP A;  1E4F T;  3R0J A;  3T1H H;  2HTS A;  5ED4 A;  3WTY C;  1MIJ A;  3T0Y A;  2NNN A;  2DMU A;  2LKX A;  2JVG A;  1IXS B;  3PM1 A;  3GTP J;  4J9S A;  2PQ8 A;  2IVM A;  2R92 J;  1TBX A;  2XSD C;  4ZTJ A;  2O9L A;  3HOU J;  4JUZ A;  5D4S A;  1CQT A;  3VYS B;  5AKN A;  4F7Z A;  5DGA A;  1F5T A;  3L2Q A;  4O3S A;  1FOY A;  2E5N A;  1U3E M;  1VQK I;  1O3R A;  4ZDL A;  3RAQ A;  2CO5 A;  4DL2 A;  5IP9 J;  4UNC A;  3CF5 F;  3JRC A;  2DZD A;  3V4S A;  4LF8 H;  5EGO B;  2MBF A;  2VC0 A;  4TV7 A;  2R8K A;  5TRD A;  1X2N A;  3SZP A;  3KYL A;  4JYA H;  2V26 A;  1F36 A;  2MC3 A;  2RNG A;  3MFI A;  1B72 B;  4LK1 F;  1TWG A;  4Q44 A;  1U8R A;  3CUQ B;  1WJC A;  1I1G A;  2PN1 A;  4ECQ A;  3BJO A;  1I5Z A;  1GPP A;  3G6V A;  3U1K A;  4HX7 A;  3OSN A;  3RUP A;  3QWL A;  5TGT A;  1FTT A;  1S3J A;  2BOL A;  2VBX A;  2HYG D;  1KJ8 A;  3SDB A;  3F6O A;  1W0U A;  2XE0 A;  4BHP A;  2GXG A;  1S0N A;  2IBD A;  3HKZ A;  2VIX A;  3H9J A;  3RGX A;  3GLL A;  4CC6 A;  4UCV A;  4XMY A;  1JKO C;  3GV5 B;  1AWC A;  2VBO B;  3DCF A;  3FIS A;  5KFX A;  1JXL A;  1WJA A;  2W1O A;  2UZK A;  1H9T A;  2FKL A;  4A0Z A;  2DLL A;  2Q2E A;  2BE5 F;  3JAM Z;  2ME0 A;  2H27 A;  3BG7 A;  3WTZ A;  2CW8 A;  3GTK J;  3H9Q A;  2X51 A;  4HF0 A;  5J1U A;  2OZU A;  4KT6 A;  3OY9 A;  4ZTF A;  5KFC A;  4L9J A;  2E2I J;  4DZP A;  2R7S A;  2Q8K A;  1WI9 A;  2EA2 A;  1SYX B;  1GLN A;  2DCE A;  3ZN1 A;  4OIO F;  3E5Q A;  3MKZ A;  3WTV C;  1TNS A;  4YHH H;  1LUJ B;  2GIZ A;  3UVF A;  1IC8 A;  5KFS A;  3WNZ A;  4XKW A;  4MA5 A;  3ZMD A;  5D4R A;  2JA6 J;  2PEX A;  3QOD A;  1ETW A;  1R4M B;  2FA5 A;  2BY2 A;  2QYO A;  4YG2 F;  2RF4 A;  3BR5 A;  1T36 A;  2XCA A;  1WJ5 A;  2BY3 A;  3UNG C;  5JVT A;  3BQ2 A;  2E36 A;  3UKG A;  5BS6 A;  3CJQ B;  3W6J B;  2VPR A;  4KMU X;  4MV9 A;  2W7O A;  2YRX A;  3CUO A;  4DL6 A;  4MV8 A;  1TP4 A;  4EM2 A;  4BEH B;  5EEH A;  3BPV A;  2A6E F;  1B4A A;  1F9N A;  3WG9 A;  3ZQQ A;  1TW2 A;  2CWE A;  2QUF A;  3OYM A;  4Q47 A;  5KFN A;  4RNN A;  1H0M A;  2CQQ A;  3B73 A;  4M3G A;  3V7S A;  3PSF A;  2QWW A;  3GZ6 A;  1UG2 A;  1CS0 A;  4F55 A;  4NNJ A;  4HA8 A;  4UNB A;  2IEK A;  2Y31 A;  4BE0 A;  4A3D G;  3HHG A;  3BC8 A;  5D5W B;  3L2C A;  4BU2 A;  1TQP A;  2O7O A;  1IDY A;  2Y30 A;  1X2M A;  2DTR A;  2DA6 A;  2VQH A;  1MBH A;  1FMV A;  1N56 A;  1R36 A;  1XG1 A;  5KHD A;  4EBD A;  1RK5 A;  3A0B C;  2IS2 A;  3T5X A;  2DMN A;  5KFF A;  3KEY A;  1BI1 A;  4LMY A;  1LEB A;  1HOM A;  1OR7 A;  4FBT A;  4GDF A;  2HDW A;  3M8J A;  3HSR A;  5IYB G;  3MVP A;  2FBI A;  2IBK A;  4LF5 H;  1A6I A;  3FKI G;  5CLS A;  4AAF A;  3GTG A;  2P0A A;  2XC7 A;  2DA2 A;  5K08 A;  3B02 A;  3MQ0 A;  3RV4 A;  2LFB A;  3W3C A;  1DPR A;  1LJ9 A;  1ON2 A;  1WCM J;  2FXA A;  4LIU A;  4N0B A;  1XC5 A;  3SQN A;  3E5X A;  5FLV A;  2VQE H;  3ERM A;  4B3M H;  1HDD C;  3K2Z A;  1IOW A;  4M3B A;  2VOO A;  4OIR F;  2XRL A;  1Z7L A;  4XQF A;  4U6P A;  2M45 A;  1VZ0 A;  2JNQ A;  1N48 A;  1FLI A;  2IA2 A;  2JN6 A;  2WAQ A;  3MN2 A;  3KP4 A;  2NVU B;  4Y15 A;  4QIW N;  5KNL A;  1K79 A;  2IS6 A;  4WX9 A;  3B6A A;  2MYS A;  3C0F B;  1Y14 B;  2V9K A;  4R79 A;  4MEY F;  1FOX A;  2JPC A;  1O3Q A;  1OCZ H;  2X6W A;  2JMZ A;  1T94 A;  1S7O A;  1T8I A;  1B9N A;  2IAI A;  5DUK A;  5F9L A;  5DQG A;  1RR8 C;  4EJV A;  3E6C C;  2LH9 A;  2MG4 A;  3ZQC A;  4JI3 H;  5KFP A;  1L3L A;  1DQ3 A;  1W93 A;  1DU0 A;  4DR3 H;  3OOP A;  1JVA A;  1G9Z A;  1KJI A;  2VBN A;  5LYJ F;  3GWZ A;  4F93 B;  4ZI7 F;  2WY7 Q;  2OC6 A;  3ECO A;  3L1P A;  2XVC A;  1S7E A;  1R5I D;  3L4K A;  4IO9 F;  1KQ9 A;  3MWM A;  3PZP A;  2M34 A;  1N36 H;  4PCQ A;  4HOB A;  4MO7 A;  2BEO A;  4Q5S F;  1X1D A;  2JA8 J;  1YJW I;  4UXN A;  3ORQ A;  2KJC A;  3FXL A;  1KON A;  4QPQ A;  2VOP A;  2KZG A;  3MFK A;  1KQ8 A;  4AIK A;  2R0Q C;  4A93 J;  3F0C A;  1HSJ A;  4XSX F;  2L7M P;  5FKO A;  2BGC A;  3DP7 A;  3OOL A;  1MJA A;  1P8K Z;  3CCS I;  2RQQ A;  2I8C A;  2EBI A;  2EIJ H;  3GTQ J;  4EM1 A;  2VUM J;  3M3Y J;  3BP8 A;  4LOX A;  4I09 A;  1BR4 A;  3BAA A;  2I5U A;  1TZL A;  3HTU A;  4J9O A;  1SMT A;  3IN5 A;  2G7H A;  1R5G A;  3ZMS A;  4AD9 A;  3BWG A;  1B33 N;  1FYL A;  5DD8 A;  3OSG A;  3QZ7 A;  4I0A A;  1JUP A;  1YRN A;  3RBD A;  5BQT A;  2P6T A;  1I6X A;  2XF6 A;  3BG5 A;  2VKE A;  1R49 A;  1S5L C;  3JW4 A;  2QSG X;  4CCM A;  1FIP A;  4A5N A;  1ETO A;  3MR2 A;  4PDB A;  3QPT A;  3CQZ J;  3Q0W A;  4GO1 A;  5D8K B;  2W71 A;  1MH3 A;  3R61 A;  4RMN A;  1XTA A;  4ABZ A;  4ZYD A;  1XMX A;  4UB8 C;  2FD5 A;  3BPX A;  4EJO A;  2HDC A;  4B4C A;  1KJ9 A;  1BI3 A;  4RLF A;  3QAH A;  4L5J A;  1H8A C;  3E6D A;  1I7L A;  2XGQ A;  1KC7 A;  1ETX A;  4ZQI A;  3I71 A;  1A0I A;  1XNR H;  1G3S A;  4LFB H;  4XLE A;  2QEX I;  4XNF A;  2HVR A;  4IVN A;  5DCM A;  3HOY J;  4B3X A;  1F1Z A;  4AWX B;  4E70 A;  3EPG A;  2L0K A;  2LSO A;  4F4Z A;  2X4H A;  1G3Y A;  2XAF A;  3K6G A;  1V5F A;  3JSP A;  4GCV A;  1OCT C;  1M7J A;  5M3M J;  1CGP A;  1ZAO A;  1OCR H;  4IX7 A;  3O8G A;  3CDH A;  2ME6 A;  4J01 A;  1XSD A;  1X1P A;  3CJR B;  3DFG A;  4P1W A;  2UXD H;  1DQU A;  2R3S A;  3PNY A;  5LGN A;  4X6A J;  2IA6 A;  2R93 A;  4LB5 A;  1R4N B;  2LR8 A;  5JHF A;  4MEX F;  4OZ6 A;  4Y17 A;  3I4N J;  3IHU A;  4EVI A;  1W36 C;  4IRH A;  4QWC A;  2NU8 B;  4MTE A;  2QQA A;  2IA0 A;  2VQF H;  4RZQ A;  4Y33 A;  1ZGA A;  4IOC F;  1Z3X A;  4RM3 A;  1JDB B;  1W1W E;  2M1B A;  5L3G A;  5L3B A;  5KFL A;  3BT9 A;  3OYN A;  1I6U A;  1GV2 A;  2FK2 A;  3IKT A;  2H09 A;  3DV8 A;  4BQA A;  3DWL E;  1WJD A;  2OUM A;  4HX8 A;  1T38 A;  5LMN H;  1UHM A;  3EDP A;  2Q2U A;  1AUV A;  1LVA A;  3KIO A;  4DJA A;  4UY8 I;  3F23 A;  2B7E A;  1ZGJ A;  3KPH A;  3KZY A;  3DLL F;  1XS9 A;  2FEZ A;  1B8I A;  2LWY A;  1XSV A;  4HX4 A;  2JSP A;  2VLA A;  1O7F A;  4MLO A;  1Z2P X;  3PNT A;  3WTT C;  2R5Z B;  2M3A A;  3WHC A;  1OQY A;  4B8X A;  3OYH A;  4Q43 A;  4FM9 A;  4BUP A;  2RNJ A;  5J2U F;  2FRH A;  1IUF A;  1XB4 A;  2FOK A;  1E4E B;  5K5R A;  2LLK A;  4JI1 H;  4OWR B;  3ZGK A;  3GTL J;  4NC6 A;  3VWB A;  1XGM A;  2K9Q A;  3J81 W;  1HNZ H;  5FJ8 G;  1R22 A;  2OZ6 A;  2Y2Z A;  3HYI A;  3LL7 A;  3PUF A;  3Q0U A;  3RSN A;  2DOF A;  5DTD A;  2E1C A;  1OMI A;  5HNH A;  3JRB A;  4YJ2 F;  3HOW G;  4EV0 A;  5B3S H;  3EH8 A;  4QSH A;  2W6Z A;  2W9C B;  4B3T H;  2VXD A;  2VA2 A;  4ZC3 A;  2GA2 A;  4BQO A;  3COA C;  1SMY F;  4FE4 A;  2UUA H;  2COB A;  4M74 A;  1AKH B;  1RK6 A;  2SCU B;  5J3L A;  1GGO A;  2VPQ A;  3R0A A;  5LP6 F;  2JJ7 A;  2LY2 A;  2MLK A;  3ZP5 A;  3LWB A;  4HF1 A;  1JUS A;  2ZME C;  2L8L A;  1QU3 A;  4I2O A;  5FLX Z;  3EUK L;  3RKW A;  4A3D J;  3WO0 A;  2DYR H;  1X9N A;  2K3P A;  2CS3 A;  2Y75 A;  1GSA A;  4C2M A;  2JSC A;  1D5Y A;  2GWR A;  3WHB A;  1BIB A;  2HGS A;  3DEW A;  1J9I A;  2UXX A;  4ZYE A;  2VJ4 A;  2R7Z G;  4XOR A;  2QKL B;  5EGO A;  1O4X A;  1JHH A;  5E63 A;  2ZFU A;  3J7Z I;  1DV2 A;  4AU7 A;  1ZLK A;  5DQI A;  3J7A K;  2L5Q A;  5EZG A;  1LEA A;  5FB2 A;  4I02 A;  2M7B A;  3MCZ A;  1SEU A;  5KFW A;  4YR0 A;  1D0Z A;  1FX7 A;  2DMP A;  1B72 A;  3Q8R B;  3CUQ A;  1LWT A;  4HG2 A;  3FKI J;  1BW5 A;  5EWE A;  4IRD A;  2XCP A;  1J5Y A;  4YRV A;  4C5A A;  2O5R A;  2BQ3 A;  6PAX A;  2J6T A;  4JBA A;  4AIH A;  2K4B A;  3CLQ A;  2QOJ Z;  3RPU D;  1X4P A;  2FNP A;  4A3L G;  3V8K A;  1P9Q C;  2LVS A;  1O75 A;  1UC9 A;  3MKL A;  4KA4 A;  2NRA C;  5KT5 A; 
#chains in the Genus database with same CATH homology
 3RIZ A;  3RTR A;  1U0J A;  2OV7 A;  3HYJ A;  2R7X A;  2XIG A;  2VBO A;  3F8N A;  3N40 P;  3N6X A;  1BJT A;  3VYR B;  3PL8 A;  4RM2 A;  2PJR B;  1YE9 A;  1QHG A;  3OIQ A;  3FKJ A;  4II2 A;  2IN9 A;  3C2G A;  2V6E A;  1PJR A;  3K4K A;  4MTD A;  2WBM A;  2VBJ B;  1I94 H;  3PNV A;  2VB6 A;  3HPH A;  1LWS A;  4CZC A;  2KQR A;  3EUH C;  2WB1 A;  1EF0 A;  2ZJT A;  2VPL A;  3L4J A;  5LMU H;  4B44 A;  2UXC H;  5CQG A;  3SYT A;  3A4C A;  2DJI A;  2VQC A;  1WJB A;  3DKY A;  5CQE A;  3MKY B;  1MW7 A;  4UN8 A;  1NG7 A;  3KO2 A;  4PJM A;  2E60 A;  4CCK A;  1MND A;  1IBK H;  4AYB A;  3RGZ A;  4DV4 H;  4M7E A;  4O1R A;  2R7V A;  4E6K G;  2I3P A;  2IGK A;  3FDY A;  4BE1 A;  3KAJ A;  4RB3 C;  1TT0 A;  4JQF A;  4DBQ A;  4UN9 G;  1ZHS A;  3HUG B;  5HNF A;  4XKC A;  3MXA A;  3MIP A;  3LSI A;  4DR5 H;  4N4N B;  2WA0 A;  1SFK A;  4AVZ A;  1B24 A;  4X0G A;  3OWT A;  3H5A A;  5IWA H;  2W4S A;  4LF9 H;  1XMQ H;  4UCU A;  1M0W A;  1AF5 A;  2A6T A;  3L2W A;  4F91 B;  2W82 A;  5A77 A;  4NC7 A;  2XDV A;  4B47 A;  3KXY T;  3DQV C;  3BCB A;  3FBI B;  4XL9 A;  1DFA A;  3E1S A;  3DPT A;  4XLC A;  4P5O A;  2IN0 A;  1HA8 A;  2BW3 A;  3S8P A;  1X1C A;  3PJR A;  5LFA A;  3H35 A;  3C0X A;  4OAY A;  4YY3 H;  4JI6 H;  2DCH X;  2X6Y A;  5HOO A;  4Z20 A;  1Y56 A;  2R7O A;  4E2T A;  3DPU A;  3HG9 A;  1DP3 A;  4RB1 A;  5FRN A;  3S3N A;  2MD0 A;  4PJJ A;  4CCJ A;  3IFJ A;  3OOU A;  2HVQ A;  3DTE A;  5D1O B;  2KZV A;  4C2T A;  4D6O A;  2KRC A;  4DV7 H;  1X4O A;  2E1M B;  5CKT A;  2E5L H;  4DR6 H;  3LFU A;  2W7N A;  4PSX A;  2HNH A;  4GKJ H;  2DT7 B;  1SAU A;  4B48 A;  3D5R C;  4LIT A;  3KAK A;  3AL0 C;  2FE3 A;  3E54 A;  2O03 A;  4LQ0 A;  5EOY A;  4X65 H;  5KCM A;  1YX3 A;  4A2B A;  3K70 D;  1MZB A;  1BR1 A;  2R7W A;  1U0C A;  3BG6 A;  3M1C A;  2KEQ A;  5A0W A;  4UN9 A;  1B04 A;  3BA8 A;  2ZM6 H;  4DV2 H;  4ANJ A;  2LCJ A;  1V5G A;  3L2U A;  1IRX A;  3EUA A;  2Q2T A;  3TL4 X;  4E4H A;  2W57 A;  4D9J A;  1N75 A;  2LG4 A;  4OAZ A;  4AAG A;  2UXB H;  4YIT A;  2ELJ A;  3PUB A;  1S68 A;  1M0T A;  3OL3 A;  2CMP A;  1AA7 A;  4C9Y A;  3H5N A;  3A2K A;  1MMG A;  3TMO A;  3VSK A;  3K10 A;  2M4K A;  2X1D A;  3OS2 A;  1UM2 A;  5E67 A;  3JAM W;  4B3S H;  3OYL A;  1N32 H;  3ZXS A;  4LSX A;  3DU5 A;  1LVK A;  3K70 C;  2WE6 A;  1S03 G;  3SEZ A;  3OS1 A;  3OYI A;  2UWM A;  3V42 A;  1G9Y A;  4MV7 A;  3MIS A;  2LOO A;  4HPQ A;  4PFO A;  1TA8 A;  4UN8 G;  2QKM B;  3JSN A;  4AQY H;  2KHM A;  3OYA A;  4UNA A;  4UN7 G;  4B3R H;  5FRO A;  1WH2 A;  3KAL A;  4JI7 H;  5A0M B;  4PJL A;  1WJE A;  4CCL A;  2AB5 A;  2FUG 2;  2JA2 A;  3N44 B;  1E4F T;  4X62 H;  2RRE A;  3RJ0 A;  2WAF A;  3T1H H;  1X1A A;  4HEA 2;  3DTK A;  2I3Q A;  2JVG A;  1XNQ H;  2VAS A;  4ZTJ A;  2PMZ A;  2XSJ C;  3ZCO A;  3QYE A;  3VYS B;  1N78 A;  2IMZ A;  5AKN A;  4EEQ A;  2VQG A;  4BL0 B;  4XKB A;  3OYF A;  3L2Q A;  3NWT A;  4LF4 H;  2E5N A;  4BDY A;  3IP4 B;  4ZDL A;  3QQY A;  2WDT A;  1D0Y A;  2KRH A;  4XR6 A;  2LYC A;  2VJI A;  1M5X A;  5AKM A;  4UNC A;  3OYE A;  5BR8 H;  3OYJ A;  1OLT A;  4LF8 H;  4LIV A;  3LSH A;  2VKH A;  1AN7 A;  3M4I A;  4J00 A;  3KYL A;  4JYA H;  2XF7 A;  4LG3 A;  2V26 A;  2BVM A;  4BGD A;  2RNG A;  1AM2 A;  3H9G A;  4XOT A;  1X1B A;  2CV0 A;  3N42 B;  1WJC A;  4E7K A;  2UUB H;  2HZD A;  2Z1D A;  1GPP A;  2VKD A;  1BGW A;  4BAC A;  5TGT A;  1XDN A;  4EFJ A;  2BOL A;  2X6X A;  4LH7 A;  3CF2 A;  3D5L A;  3MD2 A;  2VS8 A;  2L9S A;  3MX9 A;  4Z1X A;  3R7P A;  4XON A;  3SDB A;  2XE0 A;  4CA0 A;  5LL6 b;  3MXB A;  3HPG A;  2HU9 A;  3GBG A;  3HKZ A;  2VIX A;  3H9J A;  4BJ5 C;  4CC6 A;  4UCV A;  1ZEL A;  4XMY A;  2R7Q A;  4PJN A;  1N3F A;  4UN7 A;  2VBO B;  3NZM A;  4BXF A;  1WJA A;  2W1O A;  4DBR A;  3RF2 A;  4DR4 H;  1WFX A;  2ZSH B;  3DLA A;  4HNT A;  4DIQ A;  3BG7 A;  2CW8 A;  3KX2 A;  3H9Q A;  2X51 A;  1MNE A;  4PK4 A;  4KT6 A;  3OY9 A;  4ZTF A;  2VOB A;  1DGW Y;  3BA9 A;  2NOJ B;  2R7S A;  4II3 A;  2CUJ A;  4ITV A;  3K4M A;  4XN0 A;  3VYT B;  1R7M A;  3VYU B;  2HPI A;  1SYX B;  1GLN A;  2DCE A;  3BCA A;  3MKZ A;  4BEH A;  1BP7 A;  1X19 A;  4YHH H;  3DPL C;  4DR2 H;  1ZDE A;  5FRM A;  3UVF A;  4DR7 H;  1UEL B;  4XKW A;  2MAB A;  4X64 H;  2JVH A;  3QOD A;  2GOX B;  2R7U A;  4AAD A;  2V7F A;  4RAZ A;  3A1Y A;  1DGR M;  4EFE A;  2F5V A;  1WJ5 A;  3LMM A;  3UNG C;  1E4G T;  4CUG A;  4DR1 H;  3IUO A;  3FD2 A;  3CJQ B;  3IG0 A;  3OMY A;  3IGD A;  4MV9 A;  2HPM A;  4UT0 A;  1SEI A;  3RQ4 A;  2K9L A;  3ZRG A;  1IBM H;  3AKZ A;  4XLA A;  4XKV A;  2IGN A;  3W2A A;  2KSW A;  2M4G A;  3QYF A;  4BEH B;  3QOE A;  1D0X A;  4OX9 H;  3BLY A;  4PFP A;  3ZQQ A;  1V9P A;  1LKX A;  2Y0S A;  3OYM A;  3K3V A;  2UU9 H;  1HNW H;  1MMN A;  1AT0 A;  2MFZ A;  1ZHQ A;  4E7Z A;  4BQQ A;  5CPR B;  4CH7 A;  3K4J A;  3PSF A;  1UG0 A;  2X85 A;  3S32 A;  2ZXH A;  1T95 A;  4F55 A;  2BW3 B;  1FMW A;  2WAE A;  4NNJ A;  4UNB A;  1JI8 A;  3OIP A;  3DF7 A;  4BE0 A;  3BC8 A;  2UUC H;  1N34 H;  3J80 W;  4BU2 A;  4DV5 H;  3FHN A;  3L2R A;  3CES A;  1D1A A;  4KL6 A;  2KPM A;  1XMO H;  3N41 B;  3OYB A;  3PFY A;  4RB2 C;  2F4V H;  2VQH A;  2CW7 A;  4LSA A;  2CV2 A;  3PN1 A;  4APM A;  1FMV A;  3I9V 2;  5KHD A;  2VBL A;  4UCS A;  1D1C A;  5FD6 A;  2OWO A;  2IS2 A;  4R7R A;  4RB0 A;  3KEY A;  2CFO A;  2V4J C;  2IGO A;  4ZYA A;  4LMY A;  3C2H A;  3HXL A;  4UFZ A;  2HDW A;  3M8J A;  2LRD A;  1OR7 C;  3AL0 B;  3J7A Y;  3H5R A;  4IAJ A;  2I8D A;  4DGW B;  3QYB A;  4E7L A;  2WAD A;  4LF5 H;  3LSG A;  4AQU A;  4AAF A;  4QPO A;  2XC7 A;  3OYG A;  5K08 A;  2F6C A;  3VDX A;  3W3C A;  3I3L A;  4UCT A;  3T1Y H;  3IAM 2;  4KHP H;  4LIU A;  1MMA A;  2VQE H;  4B3M H;  3OR2 C;  2M7A A;  4F3Q A;  2K9M A;  2HVS A;  4KL5 A;  2LBF A;  3RTX A;  5A74 A;  1Z7L A;  4XQF A;  4F52 A;  1VZ0 A;  2JNQ A;  4BDZ A;  4KJZ A;  4NUB A;  3HOS A;  2CUZ A;  2WAQ A;  5KNL A;  2IS6 A;  2MYS A;  4E2U A;  3C0F B;  1E0E A;  1FJG H;  2DOA A;  2V9K A;  4R79 A;  2KDO A;  1R6R A;  4XLH A;  2X6W A;  2JMZ A;  5I0A A;  4E7S A;  4Z1Z A;  4YIS A;  3ONQ A;  4JI2 H;  2LH9 A;  4UCR A;  4DV0 H;  4JI3 H;  4JOM A;  1DQ3 A;  4DR3 H;  3EYY A;  3HL2 A;  1JVA A;  1G9Z A;  2VBN A;  3L2P A;  4F93 B;  4BJ6 C;  1VDE A;  1HNX H;  2WY7 Q;  2OC6 A;  2KMU A;  3G2B A;  5E5O A;  3BAB A;  3DU6 A;  4IZZ A;  1BR2 A;  3L4K A;  3MWM A;  1N36 H;  1GYF A;  5IT9 W;  2F4I A;  2LC2 A;  2IXS A;  4NC8 A;  1X1D A;  4ZDO A;  2R4G A;  1TAE A;  3OYD A;  2GOM A;  4PUS A;  3AFH A;  4XM3 A;  2PJR A;  4QPQ A;  1KON A;  1Z21 A;  2M0M A;  3OR1 C;  2VBJ A;  4XLF A;  4DUY H;  2VBN B;  2X1C A;  5HVQ C;  3OOL A;  2VS7 A;  4ZDP A;  1P8K Z;  4HNU A;  2RQQ A;  3N43 B;  2HHH H;  1VS0 A;  4LOX A;  3BAA A;  1BR4 A;  4ZJZ A;  4J0M A;  1TZL A;  5AKF A;  2AQF A;  4U87 A;  4BQN A;  2YCH A;  4NXN H;  4XOP A;  3PSI A;  3K4B A;  2R7R A;  2LRE A;  4CSW A;  4N4O B;  3RGX A;  4JI8 H;  2CV1 A;  2XF6 A;  4E7H A;  1FVI A;  4CCM A;  3K4C A;  4Y3O A;  5LD2 C;  1J09 A;  1N33 H;  1PYV A;  4PDB A;  4AAB A;  2Z2S B;  1IBL H;  4A2A A;  3OS0 A;  1UAA A;  4JV5 H;  4RMN A;  4YHX A;  2FLD A;  1EA3 A;  2VJ5 A;  3MKW B;  2XE0 B;  4C2U A;  4E7I A;  4CCO A;  3MXB B;  2R7T A;  3LSK A;  4RLF A;  3S3O A;  2KL4 A;  1ZD7 A;  3ZR8 X;  3W2W A;  3UQ8 A;  4CCN A;  2MCT A;  4H4K C;  1W36 D;  3FMA A;  4HST A;  5A2Q W;  1XNR H;  1A0I A;  4D1Q A;  4LFA H;  4LFB H;  4XLE A;  2HVR A;  4XNF A;  3OOR A;  2Q2E B;  2IGM A;  2KLO A;  4B3X A;  2RGV A;  2L2O A;  3U21 A;  4D6N A;  5FPR A;  5HLT A;  3D5S C;  4IQJ A;  3CP2 A;  3K6G A;  1V5F A;  4LH6 A;  1G8X A;  4RAY A;  4KIT B;  2IS4 A;  5FLX W;  4GRI A;  4IX7 A;  4J01 A;  1NG6 A;  2CH0 A;  3CJR B;  4DUZ H;  4P1W A;  2UXD H;  1DQU A;  3EPZ A;  3LSM A;  3PNY A;  4C30 A;  1HR0 H;  3NWS A;  5AK9 A;  5JHF A;  1V5E A;  2IN8 A;  4OZ6 A;  4AAE A;  1U0D A;  3JSL A;  1W36 C;  2ZXI A;  5D1O A;  4LF6 H;  4LF7 H;  4MTE A;  2VQF H;  2BVL A;  4DV6 H;  4RZQ A;  3LML A;  4Y33 A;  2E1M C;  4O1S A;  4FET A;  1Z3X A;  4RM3 A;  1L2Z A;  2JUG A;  1I6U A;  3OL4 A;  3OYN A;  2LQM A;  4BWS C;  1N3E A;  3OTO H;  2RGR A;  1DGS A;  4I7H A;  1K6Y A;  3OYK A;  4BJT A;  3DWL E;  4HRI A;  3CMM A;  1WJD A;  2OUM A;  5LMN H;  4DV1 H;  2Q2U A;  3DEE A;  3RCO A;  4DJA A;  3OYC A;  4GIG A;  4EFB A;  2XF5 A;  1MI8 A;  2EX5 A;  4EAT A;  3S93 A;  5A78 A;  2LWY A;  2VXZ A;  2JSP A;  3K4N A;  2VLA A;  4MLO A;  4Y4R A;  4JI5 H;  4K0K H;  4AQX A;  1Z2P X;  4BS9 A;  3PNT A;  1S9H A;  2LY1 A;  2M3A A;  2P0W A;  2VJJ A;  4FM9 A;  3OYH A;  4Q0Y A;  4BUP A;  3H20 A;  2Z16 A;  2A5W A;  3HOT A;  2AQE A;  3E0J B;  5FD5 A;  2W00 A;  4JI1 H;  4OWR B;  3ZGK A;  1QHH D;  3CP8 A;  3VWB A;  1WJF A;  3J81 W;  1HNZ H;  1LFP A;  3LL7 A;  3HYI A;  3TBI A;  2IS1 A;  3RSN A;  2VUG A;  3K4L A;  5HNH A;  4F92 B;  2VBL B;  3EH8 A;  2DT6 A;  3UR3 C;  4HSR A;  1T9J A;  5FPO A;  2L7K A;  3HC7 A;  2O7M A;  4B43 A;  2VXD A;  4B3T H;  1BOB A;  2HQA A;  3FBN B;  1N77 A;  5A0M A;  4ZC3 A;  4X66 H;  3F9K A;  2K5C A;  4BQO A;  2MC4 A;  1T9I A;  4LFC H;  2UUA H;  4UCO A;  4PSW A;  3MMY B;  3DTI A;  4IQ4 A;  4RLQ A;  2V1N A;  3DKX A;  5A72 A;  2LY2 A;  2ZSI B;  3SZG A;  4JI4 H;  2L8L A;  4G6T B;  1QU3 A;  1Y6I A;  3EUK L;  4NQW B;  1ERD A;  4NXM H;  2LBF B;  1G59 A;  2K3P A;  2CS3 A;  4DOZ A;  4IKF A;  3CVZ A;  1X9N A;  4YEJ A;  2KP6 A;  4YEL A;  3SEQ A;  3L2V A;  2HGS A;  4JI0 H;  1Z3Y A;  5E5S A;  1T0F C;  1MOW A;  1Z2N X;  1MMD A;  2VQL A;  2VJ4 A;  4ETS A;  4KIS A;  2WY8 Q;  4XOR A;  2QKL B;  2X1E A;  2VPS A;  4E7J A;  3C0W A;  5E63 A;  2ZFU A;  1P8L A;  2VL8 A;  4AU7 A;  3J7A K;  2L5Q A;  1YX5 A;  3W2V A;  2Q1Z B;  3IAS 2;  2M7B A;  1D1B A;  1D0Z A;  3H0D A;  3VSL A;  2UV1 A;  3S3M A;  4GKK H;  1LWT A;  1Z2O X;  4HG2 A;  5D1P A;  4XN3 A;  4DV3 H;  4YRV A;  2E5Z A;  3CZ6 A;  4FAS D;  2O5R A;  2DXI A;  2UUZ A;  1J5E H;  2L9N A;  3N05 A;  2QOJ Z;  1FKA H;  3RPU D;  1X4P A;  2WYO A;  1LDK B;  4GLX A;  1P9Q C;  4U7B A;  4BE2 A;  2XAU A;  1O75 A;  4CC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...