1DQ3A

Crystal structure of an archaeal intein-encoded homing endonuclease pi-pfui
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
454
structure length
454
Chain Sequence
CIDGKAKIIFENEGEEHLTTMEEMYERYKHLGEFYDEEYNRWGIDVSNVPIYVKSFDPESKRVVKGKVNVIWKYELGKDVTKYEIITNKGTKILTSPWHPFFVLTPDFKIVEKRADELKEGDILIGGMPDGEDYKFIFDYWLAGFIAGDGCFDKYHSHVKGHEYIYDRLRIYDYRIETFEIINDYLEKTFGRKYSIQKDRNIYYIDIKARNITSHYLKLLEGIDNGIPPQILKEGKNAVLSFIAGLFDAEGHVSNKPGIELGMVNKRLIEDVTHYLNALGIKARIREKLRKDGIDYVLHVEEYSSLLRFYELIGKNLQNEEKREKLEKVLSNHKGGNFGLPLNFNAFKEWASEYGVEFKTNGSQTIAIINDERISLGQWHTRNRVSKAVLVKMLRKLYEATKDEEVKRMLHLIEGLEVVRHITTTNEPRTFYDLTVENYQNYLAGENGMIFVHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDONUCLEASE
publication title Crystal structure of an archaeal intein-encoded homing endonuclease PI-PfuI.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 138
structure length 454
sequence length 454
ec nomenclature ec 1.17.4.1: Ribonucleoside-diphosphate reductase.
pdb deposition date 1999-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09061 Stirrup Stirrup
A PF09062 Endonuc_subdom PI-PfuI Endonuclease subdomain
A PF14528 LAGLIDADG_3 LAGLIDADG-like domain
A PF14890 Intein_splicing Intein splicing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.16.10 Mainly Beta Beta Complex Endonuclease - Pi-scei; Chain A, domain 1 Hedgehog/Intein (Hint) domain 1dq3A01
3.10.28.10 Alpha Beta Roll Endonuclease I-creI Homing endonucleases 1dq3A04
3.10.28.10 Alpha Beta Roll Endonuclease I-creI Homing endonucleases 1dq3A03
3.30.160.90 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1dq3A02
4UN8G 3MXBA 2IMZA 1ZD7A 2IN9A 1VDEA 4AAEA 1T9JA 1EF0A 1B24A 3IFJA 2VS8A 2O7MA 2IN0A 1G9YA 4D6OA 4UN9G 2FLDA 3C0WA 1AM2A 4KL5A 4OZ6A 2LCJA 1ZDEA 2KEQA 4E2UA 5AK9A 3UVFA 4YITA 3E54A 5E5SA 4D6NA 2I3PA 1DFAA 4AABA 2VBOB 5A78A 2L8LA 3MX9A 4UNBA 5A0WA 5A77A 4KL6A 4E2TA 2VBOA 5AKMA 2VBNB 2XE0B 3QQYA 1DQ3A 2CW7A 5A0MB 2XE0A 1BP7A 1P8KZ 4GIGA 2JMZA 1UM2A 1G9ZA 5A74A 1MI8A 3MISA 2VS7A 1AF5A 1MOWA 4O1SA 3OORA 3C0XA 3HYIA 5E67A 1M5XA 3MIPA 4UNAA 1LWSA 4UN7A 2VBNA 1N3EA 5A0MA 3NZMA 2AB5A 4AADA 3FD2A 4EFJA 1T9IA 4AQXA 1AT0A 5AKNA 2LQMA 2VBLB 2EX5A 3HYJA 2LWYA 1JVAA 5I0AA 3R7PA 4AQUA 1GPPA 5K08A 3OOLA 2DCHX 4UN8A 4O1RA 2QOJZ 4Z20A 4Z1ZA 1U0DA 2JNQA 4UT0A 5A72A 4YHXA 4UN9A 3IGDA 4UNCA 4AAFA 5E63A 2I3QA 4AAGA 4UN7G 1R7MA 1U0CA 5AKFA 2VBJB 1LWTA 2CW8A 2IN8A 4YISA 4Z1XA 1N3FA 4LQ0A 2VBJA 3KO2A 2VBLA 3MXBB 3MXAA 3EH8A 5E5OA 4LOXA
chains in the Genus database with same CATH superfamily
2V89A 2RSIA 2IN9A 3MHHC 2CSHA 1T9JA 2EMCA 1B24A 3BGHA 2BB8A 4BC9A 1G9YA 4UN9G 2DLKA 3T1HE 2R76A 2GHFA 1YUJA 4OZ6A 4HEIA 3IWBA 2LCJA 2EM9A 4DV1E 1KJKA 2YTOA 1A1JA 4DV7E 3MHSC 3RMPA 5E5SA 4D6NA 2L3CA 4NXNE 4R2PA 1UILA 2WZOA 4UNBA 5A77A 5KL4A 2KHXA 2LJUA 2EM0A 2EMIA 2EN4A 1YFHA 1DQ3A 1G2FC 1XNQE 3DF6A 2EP3A 2MDGA 2XE0A 4ZYGA 1BP7A 1X5WA 1PDAA 1UM2A 3EQ1A 1MI8A 3J81C 4X65E 1ZR9A 2KONA 1IBKE 2M4IA 2HGHA 3J7AG 4RH8A 2V86A 5E67A 2I9IA 1I94E 1M5XA 3MIPA 1IQOA 2JR1A 4FK5C 4F9AB 5AC4A 1N34E 2CTDA 2WCC3 4IS1C 3NZMA 1T39A 1WRJA 1XMOE 3C6MA 2EOIA 2JOBA 4JI8E 4JI0E 1T9IA 4AQXA 4P78A 2EM3A 2N3HA 1LLMC 2FTXB 2ODRC 3L00A 2BBGA 4LFCE 2EM8A 4AQUA 5LMUE 1T4LB 5K08A 2VRDA 4BMJA 2FGGA 1FJGE 4LF4E 1DI2A 4UN8A 2ODRD 3HPZA 4Z20A 3ADGA 2E5LE 2HC5A 3IWDA 2YWQA 2EN2A 1AAYA 1BBGA 2YTQA 3AV0A 3HXLA 4WSGA 2IHR1 5E63A 2I3QA 4O5GA 2EOYA 2YSOA 4OX9E 1HNXE 2DRPA 2LTSA 5AE1A 4DV6E 1XMQE 4Q35B 4BHBA 1TN9A 1RQ0A 2IN8A 2YSPA 4X64E 3LMLA 1N3FA 2E1MA 1L4SA 3P1XA 2YPNA 2VBJA 4X66E 4JI5E 1X6HA 2ENAA 2VBLA 2LTRA 4R2EA 5E5OA 4LOXA 2YTDA 2UXDE 1G2DC 4UN8G 4B3TE 3MXBA 2IMZA 2RTXA 2M9AA 1ZD7A 1GQEA 2JOXA 3IFJA 2O7MA 2EL5A 3M99B 1IQSA 2EPNA 4GKJE 3UVFA 1ZDEA 2KEQA 2LE2A 1MEYC 3KZYA 5IXMB 4YITA 4QFQA 5KL6A 2RQLA 1DFAA 5A69A 1BB8A 1YYOA 5LL6R 1IBME 5A78A 2L8LA 2JY9A 3JTZA 4BC7A 2DLQA 3J80C 3C4TA 2DGCA 4KL6A 4E2TA 2EOEA 1UHZA 5TSEA 4KHPE 2VBOA 5AKMA 2L2MA 2PRTA 3JU0A 5T6JA 2D9HA 2EPPA 2LT7A 3J7Yp 1P8KZ 4I8OA 4F9CB 4GIGA 4WX9A 2CT1A 2DSYA 1WHNA 2YT4A 4HTGA 4BS9A 4L5NC 3MISA 4LF9E 1YSAC 2YTEA 2B7TA 4WXCA 2EOHA 1IBLE 1X6FA 2EZ6A 2EM6A 2VQFE 1A1IA 4WPYA 5FLXC 2EPLX 2L8TA 1PKPA 5F3WA 4R2QA 1LWSA 3HPSA 4O43A 4DKKA 1X3CA 2EMKA 4R2CA 1BBOA 4DR2E 1HNWE 2MKDA 2EMAA 5A0MA 2MC6A 4AADA 2YTIA 2EOSA 5A6JA 2JYAA 4GKKE 1DGCA 2ADRA 1AT0A 2VBLB 2EX5A 3KWRA 2R1FA 2LWYA 1JVAA 5I0AA 2K7IA 3R7PA 1TF3A 1GPPA 3EPKA 2DCHX 2EPXA 1UN6B 4R2DA 2UU9E 4Z1ZA 1U0DA 3ADIA 1P47A 2EMWA 2EM7A 3F6GA 2EM2A 4UT0A 4J8ZA 5A72A 2LRSA 1FKAE 4JYAE 4LF8E 4DR4E 4YHHE 2EPMX 2WBUA 3EPLA 2EM5A 2EN8A 1J26A 1PJTA 2UXCE 2YRMA 2EMHA 4YISA 4Z1XA 5KL3A 4LQ0A 1IMUA 4K0KE 4B3ME 1ZAAC 2EL6A 2EQ0A 4BHCA 2EPOA 2EN3A 1VDEA 1EF0A 2IN0A 1RMDA 2EOXA 2YTNA 2LUQA 3C0WA 1ZBTA 4KL5A 3QG5C 4E2UA 1SR9A 1QNTA 5AK9A 2UUCE 4WFTA 3E54A 4R2AA 2I3PA 2EPAA 3BBGA 1J5EE 1EKZA 2L3JA 3C4BA 4M0VA 1X48A 2L92A 5A0WA 4JI6E 2EMXA 2EOFA 2H36X 4F2JC 2LVHA 1KYQA 2EMLA 2GLIA 2XE0B 2EMFA 2EQ3A 4P7DA 2CW7A 5A0MB 5CFFE 5A6AA 4LF5E 3BF2A 2B7VA 3VK6A 1YYKA 1QU6A 2EPUA 4OOGC 4DR6E 2I13A 2JMZA 2EL4A 5A74A 2VS7A 1WJPA 4M9VC 1AF5A 2ZM6E 1MOWA 4WSPA 2HHHE 4R03A 4O1SA 3OORA 2L2KB 1SFEA 2G7HA 1A1KA 2ELYA 2FV4B 4DR1E 3ECRA 4LFAE 4JV5E 4UNAA 4YY3E 1B69A 4MLQA 1YPNA 2EPZA 5BR8E 3EPJA 4LF6E 2DIXA 4KZSA 3H09A 2VQEE 4DR7E 2VBNA 2EE8A 2AB5A 1EH7A 2MDRA 1N32E 3VYYA 1YUIA 5A2QC 3FD2A 5AE2A 2YU8A 1NEIA 2LQMA 2EJ4A 3BIDA 4DR3E 4F9BB 4X62E 2NA2A 5AASA 2ENHA 5IWAE 2NUEA 3OOLA 1WHQA 2QOJZ 3LLHA 2V88A 2EOQA 4M2ZA 4Q28A 2F4VE 2JNQA 2YRKA 1TF6A 2YTFA 4AQYE 2EOJA 4RHBB 5KL5A 1X49A 3OTOE 4AAFA 2M1SA 3T1YE 4AAGA 2RPCA 1X6EA 4DR5E 2JPAA 2EM4A 1F2IG 2EPKX 1R7MA 4B3SE 2RSMA 4LFBE 4NHRA 2VBJB 1N33E 3VHTB 2B3TB 4O24A 4F6NA 1LWTA 2CW8A 2F4LA 3ADJA 1Z1BA 1A1LA 5IV8B 1ZU1A 3ZOQB 1NCSA 3KO2A 2DMIA 4F54A 2EOMA 3MXBB 3MXAA 2N3GA 2YU5A 5A6KA 4B3RE 4N4RB 2EORA 4TUGA 4IJDA 2LO3A 4TUIA 4DUZE 4AAEA 2EN7A 4M30A 1MGTA 1T38A 2VS8A 4O4KA 4DV3E 2LUPB 2E72A 4D6OA 2FLDA 2NABA 3HTXA 1T4OA 2WBTA 1AM2A 1STUA 4DMIA 2JP9A 4GZNC 1XNRE 2EQ1A 5A6BA 1YYWA 3ADLA 2CPNA 2EMYA 2V83A 2UXBE 2YZTA 2M7QA 5LMNE 4AABA 4R2RA 2VBOB 3MSWA 2EWLA 3MX9A 2ENCA 2EMGA 1WXRA 1JK2A 4JI2E 5IT9C 4LF7E 2VE7C 2VBNB 2KOUA 4MLVA 1A1FA 3QQYA 2EPRA 2EPCA 3KZZA 5A6BD 2LBSB 2K4VA 1HR0E 4DV0E 1ZBQA 3UK3C 2A25A 1X47A 2F8BA 1JK1A 1G9ZA 4ZYHA 3DJWA 5AE3A 2WBSA 3F6HA 2LV2A 1A1GA 4LU9A 4L8NA 2J7JA 2B9DA 1PJQA 2EN1A 2EOOA 2JVAA 3K6QA 4R2SA 3C0XA 4BBYA 3HYIA 2LMZA 2V85A 4X9JA 2Q8UA 1AH5A 2MKNA 4NXME 2YTPA 4DV2E 4ZYEA 4DV5E 5AC5A 2HJJA 5LLQA 3THOB 4JI1E 2MC5A 4X8WA 3AUZA 3IWCA 2RS7A 4UN7A 2L2NA 4KWYA 1GZ6A 1O0WA 5DNYA 1N3EA 4WYQB 2LJHA 1HNZE 5KL2A 2YRHA 4JI7E 1YZ9A 2NUFA 4EFJA 1RC7A 2L6MA 1EH8A 5AKNA 3HYJA 2ELZA 2L33A 2LCEA 4ZYDA 1T4NA 4NZVA 4R8OA 1GTKA 2NUGA 4LTYA 1UBDC 2YTGA 2GPIA 4GEQB 3TQMA 4O1RA 2VF1A 3FIGA 2JWOA 2N8XA 4LX3A 4YHXA 4UN9A 1N3GA 3IGDA 4UNCA 1EH6A 2DMYA 5ADZA 4F6MA 3JAMC 2V87A 5KL7A 4UN7G 4JI3E 4BCAA 2V8QB 1U0CA 4JI4E 5AKFA 2EOZA 3EPHA 4WXDA 2YTJA 1PJSA 4DUYE 3OMLA 2JXPA 2UUBE 2RS6A 2EMZA 1A1HA 2UUAE 3EH8A 2EMBA 2EN6A 3C6KA 3HQ1A 3THNA 4DV4E 3VYXA 1N36E 2DB2A
chains in the Genus database with same CATH topology
2V89A 2IN9A 1T9JA 1B24A 4BC9A 1G9YA 4UN9G 3T1HE 4OZ6A 3IWBA 2LCJA 4DV1E 4DV7E 3RMPA 5E5SA 4D6NA 2L3CA 4NXNE 1UILA 2WZOA 4UNBA 5A77A 2KHXA 1DQ3A 1XNQE 3DF6A 2XE0A 1BP7A 1UM2A 1MI8A 3J81C 4X65E 2KONA 1IBKE 2M4IA 3J7AG 2V86A 5E67A 1I94E 1M5XA 3MIPA 2JR1A 4F9AB 1N34E 3NZMA 1XMOE 2JOBA 4JI8E 4JI0E 1T9IA 4AQXA 4P78A 2N3HA 2FTXB 2ODRC 4LFCE 4AQUA 5LMUE 1T4LB 5K08A 4BMJA 2FGGA 1FJGE 4LF4E 1DI2A 4UN8A 2ODRD 3HPZA 4Z20A 3ADGA 2E5LE 3IWDA 3AV0A 3HXLA 2IHR1 5E63A 2I3QA 4OX9E 1HNXE 2LTSA 5AE1A 4DV6E 1XMQE 1RQ0A 2IN8A 4X64E 3LMLA 1N3FA 2E1MA 3P1XA 2VBJA 4X66E 4JI5E 2VBLA 2LTRA 5E5OA 4LOXA 2UXDE 4UN8G 4B3TE 3MXBA 2IMZA 2RTXA 1ZD7A 1GQEA 2JOXA 3IFJA 2O7MA 4GKJE 3UVFA 1ZDEA 2KEQA 2LE2A 4YITA 1DFAA 1YYOA 5LL6R 1IBME 5A78A 2L8LA 2JY9A 3JTZA 4BC7A 3J80C 3C4TA 4KL6A 4E2TA 1UHZA 4KHPE 2VBOA 5AKMA 2L2MA 3JU0A 5T6JA 3J7Yp 1P8KZ 4I8OA 4F9CB 4GIGA 2DSYA 1WHNA 2YT4A 4BS9A 4L5NC 3MISA 4LF9E 2B7TA 1IBLE 2EZ6A 2VQFE 4WPYA 5FLXC 2L8TA 1PKPA 5F3WA 1LWSA 3HPSA 4DKKA 4DR2E 1HNWE 5A0MA 2MC6A 4AADA 4GKKE 1AT0A 2VBLB 2EX5A 3KWRA 2LWYA 1JVAA 5I0AA 3R7PA 1GPPA 2DCHX 2UU9E 4Z1ZA 1U0DA 3ADIA 3F6GA 4UT0A 4J8ZA 5A72A 2LRSA 1FKAE 4JYAE 4LF8E 4DR4E 4YHHE 1J26A 2UXCE 4YISA 4Z1XA 4LQ0A 4K0KE 4B3ME 1VDEA 1EF0A 2IN0A 2LUQA 3C0WA 1ZBTA 4KL5A 4E2UA 1SR9A 5AK9A 2UUCE 4WFTA 3E54A 2I3PA 1J5EE 1EKZA 2L3JA 3C4BA 4M0VA 1X48A 2L92A 5A0WA 4JI6E 2H36X 2XE0B 4P7DA 2CW7A 5A0MB 5CFFE 4LF5E 2B7VA 3VK6A 1QU6A 4OOGC 4DR6E 2JMZA 5A74A 2VS7A 1AF5A 2ZM6E 1MOWA 4WSPA 2HHHE 4R03A 4O1SA 3OORA 2L2KB 2G7HA 2FV4B 4DR1E 4LFAE 4JV5E 4UNAA 4YY3E 4LF6E 5BR8E 2DIXA 3H09A 4KZSA 2VQEE 4DR7E 2VBNA 2AB5A 2MDRA 1N32E 3VYYA 5A2QC 3FD2A 5AE2A 2LQMA 4DR3E 4F9BB 4X62E 2NA2A 5AASA 5IWAE 2NUEA 3OOLA 1WHQA 2QOJZ 3LLHA 2V88A 4M2ZA 4Q28A 2F4VE 2JNQA 4AQYE 1X49A 3OTOE 4AAFA 2M1SA 3T1YE 4AAGA 4DR5E 4B3SE 1R7MA 2RSMA 4LFBE 2VBJB 1N33E 1YYKA 2B3TB 1LWTA 2CW8A 3ADJA 3ZOQB 3KO2A 4F54A 3MXBB 3MXAA 2N3GA 4B3RE 4TUGA 4TUIA 4DUZE 4AAEA 4M30A 2VS8A 2LUPB 4DV3E 4D6OA 2FLDA 3HTXA 1T4OA 1AM2A 1STUA 4DMIA 1XNRE 1YYWA 3ADLA 2CPNA 2V83A 2UXBE 2YZTA 2M7QA 5LMNE 4AABA 2VBOB 3MSWA 2EWLA 3MX9A 1WXRA 4JI2E 5IT9C 4LF7E 2VE7C 2VBNB 2KOUA 3QQYA 2LBSB 1HR0E 2K4VA 4DV0E 1ZBQA 1X47A 2F8BA 1G9ZA 3DJWA 5AE3A 3F6HA 4LU9A 4L8NA 2B9DA 2JVAA 3K6QA 3C0XA 4BBYA 3HYIA 2LMZA 2V85A 4NXME 4DV2E 4DV5E 4JI1E 2MC5A 4X8WA 3AUZA 3IWCA 2RS7A 4UN7A 2L2NA 1GZ6A 1O0WA 5DNYA 1N3EA 4WYQB 2LJHA 1HNZE 4JI7E 1YZ9A 2NUFA 4EFJA 1RC7A 2L6MA 5AKNA 3HYJA 2L33A 2NUGA 1T4NA 4R8OA 4LTYA 4GEQB 4O1RA 2VF1A 3FIGA 2JWOA 4YHXA 4UN9A 3IGDA 4UNCA 2DMYA 5ADZA 3JAMC 2V87A 4UN7G 4JI3E 4BCAA 2V8QB 1U0CA 4JI4E 5AKFA 4DUYE 3OMLA 2UUBE 2RS6A 2UUAE 3EH8A 3HQ1A 4DV4E 3VYXA 1N36E 2DB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UN8 G;  3MXB A;  2IMZ A;  1ZD7 A;  2IN9 A;  1VDE A;  4AAE A;  1T9J A;  1EF0 A;  1B24 A;  3IFJ A;  2VS8 A;  2O7M A;  2IN0 A;  1G9Y A;  4D6O A;  4UN9 G;  2FLD A;  3C0W A;  1AM2 A;  4KL5 A;  4OZ6 A;  2LCJ A;  1ZDE A;  2KEQ A;  4E2U A;  5AK9 A;  3UVF A;  4YIT A;  3E54 A;  5E5S A;  4D6N A;  2I3P A;  1DFA A;  4AAB A;  2VBO B;  5A78 A;  2L8L A;  3MX9 A;  4UNB A;  5A0W A;  5A77 A;  4KL6 A;  4E2T A;  2VBO A;  5AKM A;  2VBN B;  2XE0 B;  3QQY A;  1DQ3 A;  2CW7 A;  5A0M B;  2XE0 A;  1BP7 A;  1P8K Z;  4GIG A;  2JMZ A;  1UM2 A;  1G9Z A;  5A74 A;  1MI8 A;  3MIS A;  2VS7 A;  1AF5 A;  1MOW A;  4O1S A;  3OOR A;  3C0X A;  3HYI A;  5E67 A;  1M5X A;  3MIP A;  4UNA A;  1LWS A;  4UN7 A;  2VBN A;  1N3E A;  5A0M A;  3NZM A;  2AB5 A;  4AAD A;  3FD2 A;  4EFJ A;  1T9I A;  4AQX A;  1AT0 A;  5AKN A;  2LQM A;  2VBL B;  2EX5 A;  3HYJ A;  2LWY A;  1JVA A;  5I0A A;  3R7P A;  4AQU A;  1GPP A;  5K08 A;  3OOL A;  2DCH X;  4UN8 A;  4O1R A;  2QOJ Z;  4Z20 A;  4Z1Z A;  1U0D A;  2JNQ A;  4UT0 A;  5A72 A;  4YHX A;  4UN9 A;  3IGD A;  4UNC A;  4AAF A;  5E63 A;  2I3Q A;  4AAG A;  4UN7 G;  1R7M A;  1U0C A;  5AKF A;  2VBJ B;  1LWT A;  2CW8 A;  2IN8 A;  4YIS A;  4Z1X A;  1N3F A;  4LQ0 A;  2VBJ A;  3KO2 A;  2VBL A;  3MXB B;  3MXA A;  3EH8 A;  5E5O A;  4LOX A; 
#chains in the Genus database with same CATH topology
 2V89 A;  2RSI A;  2IN9 A;  3MHH C;  2CSH A;  1T9J A;  2EMC A;  1B24 A;  3BGH A;  2BB8 A;  4BC9 A;  1G9Y A;  4UN9 G;  2DLK A;  3T1H E;  2R76 A;  2GHF A;  1YUJ A;  4OZ6 A;  4HEI A;  3IWB A;  2LCJ A;  2EM9 A;  4DV1 E;  1KJK A;  2YTO A;  1A1J A;  4DV7 E;  3MHS C;  3RMP A;  5E5S A;  4D6N A;  2L3C A;  4NXN E;  4R2P A;  1UIL A;  2WZO A;  4UNB A;  5A77 A;  5KL4 A;  2KHX A;  2LJU A;  2EM0 A;  2EMI A;  2EN4 A;  1YFH A;  1DQ3 A;  1G2F C;  1XNQ E;  3DF6 A;  2EP3 A;  2MDG A;  2XE0 A;  4ZYG A;  1BP7 A;  1X5W A;  1PDA A;  1UM2 A;  3EQ1 A;  1MI8 A;  3J81 C;  4X65 E;  1ZR9 A;  2KON A;  1IBK E;  2M4I A;  2HGH A;  3J7A G;  4RH8 A;  2V86 A;  5E67 A;  2I9I A;  1I94 E;  1M5X A;  3MIP A;  1IQO A;  2JR1 A;  4FK5 C;  4F9A B;  5AC4 A;  1N34 E;  2CTD A;  2WCC 3;  4IS1 C;  3NZM A;  1T39 A;  1WRJ A;  1XMO E;  3C6M A;  2EOI A;  2JOB A;  4JI8 E;  4JI0 E;  1T9I A;  4AQX A;  4P78 A;  2EM3 A;  2N3H A;  1LLM C;  2FTX B;  2ODR C;  3L00 A;  2BBG A;  4LFC E;  2EM8 A;  4AQU A;  5LMU E;  1T4L B;  5K08 A;  2VRD A;  4BMJ A;  2FGG A;  1FJG E;  4LF4 E;  1DI2 A;  4UN8 A;  2ODR D;  3HPZ A;  4Z20 A;  3ADG A;  2E5L E;  2HC5 A;  3IWD A;  2YWQ A;  2EN2 A;  1AAY A;  1BBG A;  2YTQ A;  3AV0 A;  3HXL A;  4WSG A;  2IHR 1;  5E63 A;  2I3Q A;  4O5G A;  2EOY A;  2YSO A;  4OX9 E;  1HNX E;  2DRP A;  2LTS A;  5AE1 A;  4DV6 E;  1XMQ E;  4Q35 B;  4BHB A;  1TN9 A;  1RQ0 A;  2IN8 A;  2YSP A;  4X64 E;  3LML A;  1N3F A;  2E1M A;  1L4S A;  3P1X A;  2YPN A;  2VBJ A;  4X66 E;  4JI5 E;  1X6H A;  2ENA A;  2VBL A;  2LTR A;  4R2E A;  5E5O A;  4LOX A;  2YTD A;  2UXD E;  1G2D C;  4UN8 G;  4B3T E;  3MXB A;  2IMZ A;  2RTX A;  2M9A A;  1ZD7 A;  1GQE A;  2JOX A;  3IFJ A;  2O7M A;  2EL5 A;  3M99 B;  1IQS A;  2EPN A;  4GKJ E;  3UVF A;  1ZDE A;  2KEQ A;  2LE2 A;  1MEY C;  3KZY A;  5IXM B;  4YIT A;  4QFQ A;  5KL6 A;  2RQL A;  1DFA A;  5A69 A;  1BB8 A;  1YYO A;  5LL6 R;  1IBM E;  5A78 A;  2L8L A;  2JY9 A;  3JTZ A;  4BC7 A;  2DLQ A;  3J80 C;  3C4T A;  2DGC A;  4KL6 A;  4E2T A;  2EOE A;  1UHZ A;  5TSE A;  4KHP E;  2VBO A;  5AKM A;  2L2M A;  2PRT A;  3JU0 A;  5T6J A;  2D9H A;  2EPP A;  2LT7 A;  3J7Y p;  1P8K Z;  4I8O A;  4F9C B;  4GIG A;  4WX9 A;  2CT1 A;  2DSY A;  1WHN A;  2YT4 A;  4HTG A;  4BS9 A;  4L5N C;  3MIS A;  4LF9 E;  1YSA C;  2YTE A;  2B7T A;  4WXC A;  2EOH A;  1IBL E;  1X6F A;  2EZ6 A;  2EM6 A;  2VQF E;  1A1I A;  4WPY A;  5FLX C;  2EPL X;  2L8T A;  1PKP A;  5F3W A;  4R2Q A;  1LWS A;  3HPS A;  4O43 A;  4DKK A;  1X3C A;  2EMK A;  4R2C A;  1BBO A;  4DR2 E;  1HNW E;  2MKD A;  2EMA A;  5A0M A;  2MC6 A;  4AAD A;  2YTI A;  2EOS A;  5A6J A;  2JYA A;  4GKK E;  1DGC A;  2ADR A;  1AT0 A;  2VBL B;  2EX5 A;  3KWR A;  2R1F A;  2LWY A;  1JVA A;  5I0A A;  2K7I A;  3R7P A;  1TF3 A;  1GPP A;  3EPK A;  2DCH X;  2EPX A;  1UN6 B;  4R2D A;  2UU9 E;  4Z1Z A;  1U0D A;  3ADI A;  1P47 A;  2EMW A;  2EM7 A;  3F6G A;  2EM2 A;  4UT0 A;  4J8Z A;  5A72 A;  2LRS A;  1FKA E;  4JYA E;  4LF8 E;  4DR4 E;  4YHH E;  2EPM X;  2WBU A;  3EPL A;  2EM5 A;  2EN8 A;  1J26 A;  1PJT A;  2UXC E;  2YRM A;  2EMH A;  4YIS A;  4Z1X A;  5KL3 A;  4LQ0 A;  1IMU A;  4K0K E;  4B3M E;  1ZAA C;  2EL6 A;  2EQ0 A;  4BHC A;  2EPO A;  2EN3 A;  1VDE A;  1EF0 A;  2IN0 A;  1RMD A;  2EOX A;  2YTN A;  2LUQ A;  3C0W A;  1ZBT A;  4KL5 A;  3QG5 C;  4E2U A;  1SR9 A;  1QNT A;  5AK9 A;  2UUC E;  4WFT A;  3E54 A;  4R2A A;  2I3P A;  2EPA A;  3BBG A;  1J5E E;  1EKZ A;  2L3J A;  3C4B A;  4M0V A;  1X48 A;  2L92 A;  5A0W A;  4JI6 E;  2EMX A;  2EOF A;  2H36 X;  4F2J C;  2LVH A;  1KYQ A;  2EML A;  2GLI A;  2XE0 B;  2EMF A;  2EQ3 A;  4P7D A;  2CW7 A;  5A0M B;  5CFF E;  5A6A A;  4LF5 E;  3BF2 A;  2B7V A;  3VK6 A;  1YYK A;  1QU6 A;  2EPU A;  4OOG C;  4DR6 E;  2I13 A;  2JMZ A;  2EL4 A;  5A74 A;  2VS7 A;  1WJP A;  4M9V C;  1AF5 A;  2ZM6 E;  1MOW A;  4WSP A;  2HHH E;  4R03 A;  4O1S A;  3OOR A;  2L2K B;  1SFE A;  2G7H A;  1A1K A;  2ELY A;  2FV4 B;  4DR1 E;  3ECR A;  4LFA E;  4JV5 E;  4UNA A;  4YY3 E;  1B69 A;  4MLQ A;  1YPN A;  2EPZ A;  5BR8 E;  3EPJ A;  4LF6 E;  2DIX A;  4KZS A;  3H09 A;  2VQE E;  4DR7 E;  2VBN A;  2EE8 A;  2AB5 A;  1EH7 A;  2MDR A;  1N32 E;  3VYY A;  1YUI A;  5A2Q C;  3FD2 A;  5AE2 A;  2YU8 A;  1NEI A;  2LQM A;  2EJ4 A;  3BID A;  4DR3 E;  4F9B B;  4X62 E;  2NA2 A;  5AAS A;  2ENH A;  5IWA E;  2NUE A;  3OOL A;  1WHQ A;  2QOJ Z;  3LLH A;  2V88 A;  2EOQ A;  4M2Z A;  4Q28 A;  2F4V E;  2JNQ A;  2YRK A;  1TF6 A;  2YTF A;  4AQY E;  2EOJ A;  4RHB B;  5KL5 A;  1X49 A;  3OTO E;  4AAF A;  2M1S A;  3T1Y E;  4AAG A;  2RPC A;  1X6E A;  4DR5 E;  2JPA A;  2EM4 A;  1F2I G;  2EPK X;  1R7M A;  4B3S E;  2RSM A;  4LFB E;  4NHR A;  2VBJ B;  1N33 E;  3VHT B;  2B3T B;  4O24 A;  4F6N A;  1LWT A;  2CW8 A;  2F4L A;  3ADJ A;  1Z1B A;  1A1L A;  5IV8 B;  1ZU1 A;  3ZOQ B;  1NCS A;  3KO2 A;  2DMI A;  4F54 A;  2EOM A;  3MXB B;  3MXA A;  2N3G A;  2YU5 A;  5A6K A;  4B3R E;  4N4R B;  2EOR A;  4TUG A;  4IJD A;  2LO3 A;  4TUI A;  4DUZ E;  4AAE A;  2EN7 A;  4M30 A;  1MGT A;  1T38 A;  2VS8 A;  4O4K A;  4DV3 E;  2LUP B;  2E72 A;  4D6O A;  2FLD A;  2NAB A;  3HTX A;  1T4O A;  2WBT A;  1AM2 A;  1STU A;  4DMI A;  2JP9 A;  4GZN C;  1XNR E;  2EQ1 A;  5A6B A;  1YYW A;  3ADL A;  2CPN A;  2EMY A;  2V83 A;  2UXB E;  2YZT A;  2M7Q A;  5LMN E;  4AAB A;  4R2R A;  2VBO B;  3MSW A;  2EWL A;  3MX9 A;  2ENC A;  2EMG A;  1WXR A;  1JK2 A;  4JI2 E;  5IT9 C;  4LF7 E;  2VE7 C;  2VBN B;  2KOU A;  4MLV A;  1A1F A;  3QQY A;  2EPR A;  2EPC A;  3KZZ A;  5A6B D;  2LBS B;  2K4V A;  1HR0 E;  4DV0 E;  1ZBQ A;  3UK3 C;  2A25 A;  1X47 A;  2F8B A;  1JK1 A;  1G9Z A;  4ZYH A;  3DJW A;  5AE3 A;  2WBS A;  3F6H A;  2LV2 A;  1A1G A;  4LU9 A;  4L8N A;  2J7J A;  2B9D A;  1PJQ A;  2EN1 A;  2EOO A;  2JVA A;  3K6Q A;  4R2S A;  3C0X A;  4BBY A;  3HYI A;  2LMZ A;  2V85 A;  4X9J A;  2Q8U A;  1AH5 A;  2MKN A;  4NXM E;  2YTP A;  4DV2 E;  4ZYE A;  4DV5 E;  5AC5 A;  2HJJ A;  5LLQ A;  3THO B;  4JI1 E;  2MC5 A;  4X8W A;  3AUZ A;  3IWC A;  2RS7 A;  4UN7 A;  2L2N A;  4KWY A;  1GZ6 A;  1O0W A;  5DNY A;  1N3E A;  4WYQ B;  2LJH A;  1HNZ E;  5KL2 A;  2YRH A;  4JI7 E;  1YZ9 A;  2NUF A;  4EFJ A;  1RC7 A;  2L6M A;  1EH8 A;  5AKN A;  3HYJ A;  2ELZ A;  2L33 A;  2LCE A;  4ZYD A;  1T4N A;  4NZV A;  4R8O A;  1GTK A;  2NUG A;  4LTY A;  1UBD C;  2YTG A;  2GPI A;  4GEQ B;  3TQM A;  4O1R A;  2VF1 A;  3FIG A;  2JWO A;  2N8X A;  4LX3 A;  4YHX A;  4UN9 A;  1N3G A;  3IGD A;  4UNC A;  1EH6 A;  2DMY A;  5ADZ A;  4F6M A;  3JAM C;  2V87 A;  5KL7 A;  4UN7 G;  4JI3 E;  4BCA A;  2V8Q B;  1U0C A;  4JI4 E;  5AKF A;  2EOZ A;  3EPH A;  4WXD A;  2YTJ A;  1PJS A;  4DUY E;  3OML A;  2JXP A;  2UUB E;  2RS6 A;  2EMZ A;  1A1H A;  2UUA E;  3EH8 A;  2EMB A;  2EN6 A;  3C6K A;  3HQ1 A;  3THN A;  4DV4 E;  3VYX A;  1N36 E;  2DB2 A; 
#chains in the Genus database with same CATH homology
 2V89 A;  2IN9 A;  1T9J A;  1B24 A;  4BC9 A;  1G9Y A;  4UN9 G;  3T1H E;  4OZ6 A;  3IWB A;  2LCJ A;  4DV1 E;  4DV7 E;  3RMP A;  5E5S A;  4D6N A;  2L3C A;  4NXN E;  1UIL A;  2WZO A;  4UNB A;  5A77 A;  2KHX A;  1DQ3 A;  1XNQ E;  3DF6 A;  2XE0 A;  1BP7 A;  1UM2 A;  1MI8 A;  3J81 C;  4X65 E;  2KON A;  1IBK E;  2M4I A;  3J7A G;  2V86 A;  5E67 A;  1I94 E;  1M5X A;  3MIP A;  2JR1 A;  4F9A B;  1N34 E;  3NZM A;  1XMO E;  2JOB A;  4JI8 E;  4JI0 E;  1T9I A;  4AQX A;  4P78 A;  2N3H A;  2FTX B;  2ODR C;  4LFC E;  4AQU A;  5LMU E;  1T4L B;  5K08 A;  4BMJ A;  2FGG A;  1FJG E;  4LF4 E;  1DI2 A;  4UN8 A;  2ODR D;  3HPZ A;  4Z20 A;  3ADG A;  2E5L E;  3IWD A;  3AV0 A;  3HXL A;  2IHR 1;  5E63 A;  2I3Q A;  4OX9 E;  1HNX E;  2LTS A;  5AE1 A;  4DV6 E;  1XMQ E;  1RQ0 A;  2IN8 A;  4X64 E;  3LML A;  1N3F A;  2E1M A;  3P1X A;  2VBJ A;  4X66 E;  4JI5 E;  2VBL A;  2LTR A;  5E5O A;  4LOX A;  2UXD E;  4UN8 G;  4B3T E;  3MXB A;  2IMZ A;  2RTX A;  1ZD7 A;  1GQE A;  2JOX A;  3IFJ A;  2O7M A;  4GKJ E;  3UVF A;  1ZDE A;  2KEQ A;  2LE2 A;  4YIT A;  1DFA A;  1YYO A;  5LL6 R;  1IBM E;  5A78 A;  2L8L A;  2JY9 A;  3JTZ A;  4BC7 A;  3J80 C;  3C4T A;  4KL6 A;  4E2T A;  1UHZ A;  4KHP E;  2VBO A;  5AKM A;  2L2M A;  3JU0 A;  5T6J A;  3J7Y p;  1P8K Z;  4I8O A;  4F9C B;  4GIG A;  2DSY A;  1WHN A;  2YT4 A;  4BS9 A;  4L5N C;  3MIS A;  4LF9 E;  2B7T A;  1IBL E;  2EZ6 A;  2VQF E;  4WPY A;  5FLX C;  2L8T A;  1PKP A;  5F3W A;  1LWS A;  3HPS A;  4DKK A;  4DR2 E;  1HNW E;  5A0M A;  2MC6 A;  4AAD A;  4GKK E;  1AT0 A;  2VBL B;  2EX5 A;  3KWR A;  2LWY A;  1JVA A;  5I0A A;  3R7P A;  1GPP A;  2DCH X;  2UU9 E;  4Z1Z A;  1U0D A;  3ADI A;  3F6G A;  4UT0 A;  4J8Z A;  5A72 A;  2LRS A;  1FKA E;  4JYA E;  4LF8 E;  4DR4 E;  4YHH E;  1J26 A;  2UXC E;  4YIS A;  4Z1X A;  4LQ0 A;  4K0K E;  4B3M E;  1VDE A;  1EF0 A;  2IN0 A;  2LUQ A;  3C0W A;  1ZBT A;  4KL5 A;  4E2U A;  1SR9 A;  5AK9 A;  2UUC E;  4WFT A;  3E54 A;  2I3P A;  1J5E E;  1EKZ A;  2L3J A;  3C4B A;  4M0V A;  1X48 A;  2L92 A;  5A0W A;  4JI6 E;  2H36 X;  2XE0 B;  4P7D A;  2CW7 A;  5A0M B;  5CFF E;  4LF5 E;  2B7V A;  3VK6 A;  1QU6 A;  4OOG C;  4DR6 E;  2JMZ A;  5A74 A;  2VS7 A;  1AF5 A;  2ZM6 E;  1MOW A;  4WSP A;  2HHH E;  4R03 A;  4O1S A;  3OOR A;  2L2K B;  2G7H A;  2FV4 B;  4DR1 E;  4LFA E;  4JV5 E;  4UNA A;  4YY3 E;  4LF6 E;  5BR8 E;  2DIX A;  3H09 A;  4KZS A;  2VQE E;  4DR7 E;  2VBN A;  2AB5 A;  2MDR A;  1N32 E;  3VYY A;  5A2Q C;  3FD2 A;  5AE2 A;  2LQM A;  4DR3 E;  4F9B B;  4X62 E;  2NA2 A;  5AAS A;  5IWA E;  2NUE A;  3OOL A;  1WHQ A;  2QOJ Z;  3LLH A;  2V88 A;  4M2Z A;  4Q28 A;  2F4V E;  2JNQ A;  4AQY E;  1X49 A;  3OTO E;  4AAF A;  2M1S A;  3T1Y E;  4AAG A;  4DR5 E;  4B3S E;  1R7M A;  2RSM A;  4LFB E;  2VBJ B;  1N33 E;  1YYK A;  2B3T B;  1LWT A;  2CW8 A;  3ADJ A;  3ZOQ B;  3KO2 A;  4F54 A;  3MXB B;  3MXA A;  2N3G A;  4B3R E;  4TUG A;  4TUI A;  4DUZ E;  4AAE A;  4M30 A;  2VS8 A;  2LUP B;  4DV3 E;  4D6O A;  2FLD A;  3HTX A;  1T4O A;  1AM2 A;  1STU A;  4DMI A;  1XNR E;  1YYW A;  3ADL A;  2CPN A;  2V83 A;  2UXB E;  2YZT A;  2M7Q A;  5LMN E;  4AAB A;  2VBO B;  3MSW A;  2EWL A;  3MX9 A;  1WXR A;  4JI2 E;  5IT9 C;  4LF7 E;  2VE7 C;  2VBN B;  2KOU A;  3QQY A;  2LBS B;  1HR0 E;  2K4V A;  4DV0 E;  1ZBQ A;  1X47 A;  2F8B A;  1G9Z A;  3DJW A;  5AE3 A;  3F6H A;  4LU9 A;  4L8N A;  2B9D A;  2JVA A;  3K6Q A;  3C0X A;  4BBY A;  3HYI A;  2LMZ A;  2V85 A;  4NXM E;  4DV2 E;  4DV5 E;  4JI1 E;  2MC5 A;  4X8W A;  3AUZ A;  3IWC A;  2RS7 A;  4UN7 A;  2L2N A;  1GZ6 A;  1O0W A;  5DNY A;  1N3E A;  4WYQ B;  2LJH A;  1HNZ E;  4JI7 E;  1YZ9 A;  2NUF A;  4EFJ A;  1RC7 A;  2L6M A;  5AKN A;  3HYJ A;  2L33 A;  2NUG A;  1T4N A;  4R8O A;  4LTY A;  4GEQ B;  4O1R A;  2VF1 A;  3FIG A;  2JWO A;  4YHX A;  4UN9 A;  3IGD A;  4UNC A;  2DMY A;  5ADZ A;  3JAM C;  2V87 A;  4UN7 G;  4JI3 E;  4BCA A;  2V8Q B;  1U0C A;  4JI4 E;  5AKF A;  4DUY E;  3OML A;  2UUB E;  2RS6 A;  2UUA E;  3EH8 A;  3HQ1 A;  4DV4 E;  3VYX A;  1N36 E;  2DB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...