1DQ3A

Crystal structure of an archaeal intein-encoded homing endonuclease pi-pfui
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
454
structure length
454
Chain Sequence
CIDGKAKIIFENEGEEHLTTMEEMYERYKHLGEFYDEEYNRWGIDVSNVPIYVKSFDPESKRVVKGKVNVIWKYELGKDVTKYEIITNKGTKILTSPWHPFFVLTPDFKIVEKRADELKEGDILIGGMPDGEDYKFIFDYWLAGFIAGDGCFDKYHSHVKGHEYIYDRLRIYDYRIETFEIINDYLEKTFGRKYSIQKDRNIYYIDIKARNITSHYLKLLEGIDNGIPPQILKEGKNAVLSFIAGLFDAEGHVSNKPGIELGMVNKRLIEDVTHYLNALGIKARIREKLRKDGIDYVLHVEEYSSLLRFYELIGKNLQNEEKREKLEKVLSNHKGGNFGLPLNFNAFKEWASEYGVEFKTNGSQTIAIINDERISLGQWHTRNRVSKAVLVKMLRKLYEATKDEEVKRMLHLIEGLEVVRHITTTNEPRTFYDLTVENYQNYLAGENGMIFVHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an archaeal intein-encoded homing endonuclease PI-PfuI.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
molecule keywords ENDONUCLEASE
total genus 138
structure length 454
sequence length 454
ec nomenclature ec 1.17.4.1: Ribonucleoside-diphosphate reductase.
pdb deposition date 1999-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09061 Stirrup Stirrup
A PF09062 Endonuc_subdom PI-PfuI Endonuclease subdomain
A PF14528 LAGLIDADG_3 LAGLIDADG-like domain
A PF14890 Intein_splicing Intein splicing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.16.10 Mainly Beta Beta Complex Endonuclease - Pi-scei; Chain A, domain 1 Hedgehog/Intein (Hint) domain 1dq3A01
3.10.28.10 Alpha Beta Roll Endonuclease I-creI Homing endonucleases 1dq3A04
3.10.28.10 Alpha Beta Roll Endonuclease I-creI Homing endonucleases 1dq3A03
3.30.160.90 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1dq3A02
3R7PA 4Z1ZA 4O1SA 2XE0B 2VBNB 3C0WA 4AAFA 2I3PA 5A0MA 5AKFA 2IN0A 4OZ6A 3OOLA 4UN8G 4UN9G 2VS7A 1AT0A 5A78A 3QQYA 3IFJA 2QOJZ 4AADA 2VBOB 3MISA 2KEQA 1N3FA 2LQMA 2O7MA 4AQUA 4UT0A 5E67A 5E63A 2VBLB 4Z1XA 4YISA 3C0XA 2L8LA 4GIGA 4E2UA 3HYJA 5A77A 2VBJB 1ZDEA 2IN8A 5A0MB 2VBNA 2AB5A 3FD2A 4UN8A 2VBLA 1B24A 4UN7G 2LWYA 5A74A 5K08A 2I3QA 2DCHX 4UN9A 4EFJA 2CW8A 2VS8A 4AABA 1U0DA 4E2TA 1G9YA 4KL6A 1JVAA 4UNAA 5AKMA 1MOWA 3NZMA 2FLDA 2JMZA 1U0CA 3HYIA 1M5XA 5I0AA 4LOXA 5E5SA 1MI8A 4D6OA 3KO2A 4D6NA 4YITA 4O1RA 4AAGA 2EX5A 4AQXA 3MXBB 2VBJA 3MIPA 3MX9A 3MXAA 1VDEA 3IGDA 2JNQA 3E54A 4UNBA 1DQ3A 5E5OA 2VBOA 5AK9A 4AAEA 1N3EA 4UNCA 1T9JA 5AKNA 4UN7A 1AF5A 5A0WA 1G9ZA 1P8KZ 3EH8A 5A72A 1R7MA 2IN9A 4KL5A 1GPPA 1LWSA 4YHXA 3OORA 1DFAA 4LQ0A 3MXBA 1AM2A 1ZD7A 2CW7A 3UVFA 1EF0A 2IMZA 2LCJA 1BP7A 4Z20A 1T9IA 2XE0A 1UM2A 1LWTA
chains in the Genus database with same CATH superfamily
3R7PA 4O1SA 1X3CA 2VBNB 3C0WA 1WHQA 3DJWA 1AH5A 2EQ0A 5A6BD 5AASA 4DR1E 1RC7A 5AC5A 2MC6A 1YFHA 1XMOE 1N33E 2L33A 1KJKA 5AC4A 4WX9A 1EKZA 2DRPA 4LF6E 5A78A 1YPNA 2VQEE 1BB8A 3IFJA 1ZR9A 2QOJZ 2EM3A 1WXRA 2ENAA 2VBOB 1IQSA 1IBLE 1WRJA 3ADIA 2LQMA 2DLQA 2EN6A 2L92A 2L2NA 4JI7E 4JI2E 4WXDA 1ZAAC 2V86A 2M7QA 4KWYA 2EPKX 4N4RB 4JI0E 1YSAC 2L8LA 1QU6A 5A77A 2YU5A 4WSGA 4I8OA 2NUGA 3IWDA 2JXPA 2AB5A 3FD2A 1DI2A 4BMJA 1X6EA 2EPPA 2YTEA 2YTDA 4WSPA 2LWYA 4IJDA 4WPYA 1N32E 1N36E 4O24A 1YZ9A 2LTRA 2K7IA 2VE7C 2YTGA 2UUCE 3OTOE 4MLVA 2CW8A 2VS8A 4YHHE 2L3JA 3J7AG 1JVAA 4UNAA 4B3ME 1MOWA 2EN4A 1X48A 4RH8A 4L8NA 2EPAA 1UBDC 2EMKA 2EM6A 5LMNE 2EOQA 3EQ1A 2JMZA 2ELYA 4X65E 2LV2A 2JR1A 4WFTA 2RSMA 4LOXA 5E5SA 1XMQE 4BHBA 2DIXA 4B3RE 2LMZA 4D6NA 4LF4E 4O1RA 3F6HA 2B7VA 4AAGA 2EX5A 1EH7A 3BBGA 1XNRE 4AQXA 4R2RA 4DMIA 2VQFE 5A6KA 3C6KA 2LUQA 2EMIA 3J81C 2EPNA 2N8XA 1YUJA 2EZ6A 2R76A 2NUEA 4HEIA 2HHHE 4LF9E 2I13A 2JNQA 1WJPA 2YTPA 5KL2A 5TSEA 2YWQA 2DSYA 2M9AA 2EOJA 5KL6A 5KL5A 2VBOA 5FLXC 2E72A 2K4VA 2EM0A 2V88A 1IQOA 1T9JA 5AKNA 1X5WA 1AF5A 2FGGA 1P8KZ 2EPZA 3RMPA 4LX3A 2EOHA 2L6MA 1YYKA 5A6AA 1GPPA 1LWSA 3T1YE 3J80C 1HNZE 2EM4A 4YHXA 3MXBA 4GKJE 2EQ1A 2EM7A 4OOGC 3UVFA 2ENHA 4X9JA 1N34E 2XE0A 2CT1A 2YTIA 3KZYA 5A6JA 4OX9E 1YYOA 4AAFA 1QNTA 2JYAA 5IT9C 5A0MA 5AKFA 4MLQA 5LLQA 1X49A 2GLIA 2EMBA 2V8QB 1GQEA 2YPNA 2WBSA 1UILA 2FV4B 3AV0A 4DR7E 3QQYA 2LT7A 3JU0A 4X66E 1TF3A 3MISA 1N3FA 5KL4A 1RQ0A 3MHHC 2LO3A 1FJGE 4AQUA 1A1HA 4X64E 4LTYA 3C6MA 2NA2A 2VBLB 2VRDA 4AQYE 4DV4E 2EPOA 2F8BA 2NABA 3HXLA 4E2UA 4M9VC 2VBJB 2YTOA 5A2QC 4DV7E 1LLMC 1XNQE 3VYYA 4ZYDA 2CSHA 2ODRD 2L2MA 1ZBQA 2YRMA 5A74A 2JOBA 2EMLA 2YU8A 2H36X 2CTDA 3LMLA 4QFQA 1X6HA 5CFFE 1YYWA 3BIDA 1I94E 3ZOQB 5AE3A 2UXCE 1G9YA 4KL6A 4LU9A 3J7Yp 1DGCA 3K6QA 2EE8A 4JI6E 1YUIA 1MEYC 3NZMA 1U0CA 2EPUA 2EMYA 2M1SA 3BGHA 4BCAA 1T4OA 5IV8B 2YSOA 4D6OA 3KO2A 1IBKE 2EOIA 4LFCE 2LRSA 3MIPA 2HC5A 4R2AA 2RS6A 2RQLA 2MKDA 4DUYE 4DKKA 1L4SA 3P1XA 1VDEA 2EM8A 2YTFA 2EORA 2RSIA 4IS1C 3EPHA 2EMHA 4J8ZA 4UNBA 2EOSA 2A25A 2V87A 1PKPA 5KL7A 1N3EA 2MDGA 1ZBTA 2EJ4A 2Q8UA 5A6BA 1G9ZA 1R7MA 2N3HA 4R03A 1FKAE 2EN2A 1A1GA 4LF8E 2IN9A 4F6MA 2I9IA 2F4LA 2D9HA 2ADRA 2ELZA 3H09A 4R2SA 1SR9A 1J5EE 2EPMX 4TUGA 1ZD7A 2EOZA 2LJHA 1EF0A 2EP3A 1P47A 1UM2A 2JWOA 2EMCA 4BC9A 2XE0B 1NEIA 1SFEA 1STUA 2HGHA 2LCEA 2I3PA 4ZYEA 1MGTA 2VF1A 2DGCA 4JI4E 4JI8E 2V89A 4OZ6A 4P78A 3HPZA 3OOLA 1GTKA 4UN9G 2EWLA 3M99B 5BR8E 4GZNC 2UU9E 4JYAE 2EQ3A 2M4IA 4NZVA 4ZYGA 4LFBE 1AT0A 1PDAA 2V83A 4X62E 4AADA 2YSPA 4WXCA 2MDRA 1PJSA 1A1FA 2KEQA 1G2FC 2O7MA 2JPAA 1T39A 3VYXA 1KYQA 4UT0A 4GEQB 4JI3E 4Z1XA 2G7HA 4YISA 2EL4A 2NUFA 2UUBE 4GIGA 3HYJA 1ZU1A 2MKNA 2EPCA 1ZDEA 2EN8A 2IN8A 2ODRC 2EMFA 2VBNA 3FIGA 2E1MA 2PRTA 2DLKA 2VBLA 4UN7G 3HTXA 1PJQA 5K08A 2EMZA 4NXME 5ADZA 2UUAE 4GKKE 4F9AB 2BBGA 1TN9A 1J26A 4EFJA 1A1LA 2L2KB 4P7DA 2RS7A 2V85A 1PJTA 1IMUA 1BBGA 5AKMA 2YTQA 4R2QA 4L5NC 1G2DC 2GPIA 2EMWA 1M5XA 5A69A 4NXNE 2MC5A 2HJJA 4BBYA 1F2IG 1MI8A 1JK2A 4YITA 2B3TB 3QG5C 3T1HE 4O43A 3IWBA 1BBOA 3MXBB 2LBSB 2EN7A 4YY3E 1N3GA 2E5LE 3C4TA 2FTXB 2WCC3 2KONA 3C4BA 2EPRA 3VHTB 4F2JC 3IWCA 4F6NA 4DR4E 2KOUA 1DQ3A 5E5OA 4LF5E 5AK9A 4AAEA 4HTGA 2BB8A 4M2ZA 4UN7A 4RHBB 2EOYA 2IHR1 4DV0E 4DV3E 3EH8A 5A72A 2RPCA 3JTZA 5IXMB 5LMUE 2EM5A 4KL5A 2L8TA 2LTSA 2EN3A 4LFAE 1WHNA 4X8WA 3TQMA 3HQ1A 3OORA 2J7JA 3LLHA 4LF7E 2F4VE 2EOOA 4LQ0A 4DR2E 2YTNA 4DV6E 4K0KE 1AM2A 2EOEA 2CW7A 1BP7A 2LCJA 4NHRA 4Z20A 4JI1E 2YRHA 4UNCA 1LWTA 4Z1ZA 3AUZA 4BS9A 3HPSA 1JK1A 2RTXA 4O4KA 2IN0A 3BF2A 2EMGA 2JY9A 4UN8G 2VS7A 1EH6A 4DV5E 1A1IA 3KZZA 1T4NA 4B3TE 3THOB 2GHFA 2EM9A 1Z1BA 4F9BB 1B69A 2R1FA 4KHPE 2UXDE 5LL6R 1T38A 5E67A 5E63A 1NCSA 3ADJA 2KHXA 3F6GA 5T6JA 4DR5E 2JP9A 3C0XA 3L00A 2LJUA 4BC7A 4F54A 2L3CA 4DV1E 4O5GA 1UN6B 2JVAA 4Q35B 5A0MB 4UN8A 1UHZA 1B24A 2DMYA 5F3WA 4DV2E 2I3QA 2LE2A 2N3GA 2DMIA 4R8OA 3EPLA 2YRKA 2LVHA 2DCHX 4UN9A 1GZ6A 4M0VA 1X47A 4AABA 1HNXE 1U0DA 4E2TA 2EN1A 3EPKA 2YT4A 2DB2A 5AE2A 1T4LB 3DF6A 4FK5C 2EM2A 2FLDA 1A1JA 4R2EA 2WZOA 3THNA 3UK3C 2LUPB 3HYIA 4R2CA 2WBUA 5I0AA 4DUZE 2EMXA 5DNYA 3ADGA 4TUIA 1IBME 3JAMC 4ZYHA 2CPNA 3MSWA 2UXBE 3ECRA 2VBJA 2EPXA 3MX9A 3MXAA 4R2DA 1HNWE 2EPLX 4DR3E 2ENCA 4R2PA 2B7TA 2EL5A 1EH8A 1X6FA 3VK6A 2EL6A 4WYQB 2YTJA 4JI5E 2B9DA 3E54A 4F9CB 5IWAE 3OMLA 3ADLA 2EOFA 4B3SE 4BHCA 4Q28A 5AE1A 3EPJA 1HR0E 5A0WA 1O0WA 4KZSA 2WBTA 3MHSC 2EOMA 1A1KA 1RMDA 4M30A 3KWRA 1TF6A 1DFAA 5KL3A 4JV5E 1AAYA 2EOXA 2YZTA 2EMAA 2IMZA 2ZM6E 1T9IA 2JOXA 4DR6E 3IGDA
chains in the Genus database with same CATH topology
3R7PA 4O1SA 2VBNB 3C0WA 1WHQA 3DJWA 4DR1E 5AASA 1RC7A 2MC6A 1XMOE 1N33E 2L33A 1EKZA 4LF6E 5A78A 2VQEE 3IFJA 2QOJZ 1WXRA 2VBOB 1IBLE 3ADIA 2LQMA 2L92A 2L2NA 4JI7E 4JI2E 2V86A 2M7QA 4JI0E 2L8LA 1QU6A 5A77A 4I8OA 2NUGA 3IWDA 2AB5A 3FD2A 1DI2A 4BMJA 4WSPA 2LWYA 4WPYA 1N32E 1N36E 1YZ9A 2LTRA 2VE7C 2UUCE 3OTOE 2CW8A 2VS8A 4YHHE 2L3JA 3J7AG 1JVAA 4UNAA 4B3ME 1MOWA 1X48A 4L8NA 5LMNE 2JMZA 4X65E 2JR1A 4WFTA 2RSMA 4LOXA 5E5SA 1XMQE 2DIXA 4B3RE 2LMZA 4D6NA 4LF4E 4O1RA 3F6HA 2B7VA 4AAGA 2EX5A 1XNRE 4AQXA 4DMIA 2VQFE 2LUQA 3J81C 2EZ6A 2NUEA 2HHHE 4LF9E 2JNQA 2DSYA 2VBOA 5FLXC 2K4VA 2V88A 1T9JA 5AKNA 1AF5A 2FGGA 1P8KZ 3RMPA 1YYKA 2L6MA 1GPPA 1LWSA 3T1YE 3J80C 1HNZE 4YHXA 3MXBA 4GKJE 4OOGC 3UVFA 1N34E 2XE0A 4OX9E 1YYOA 4AAFA 5IT9C 5A0MA 5AKFA 1X49A 2V8QB 1GQEA 1UILA 2FV4B 3AV0A 4DR7E 3QQYA 3JU0A 4X66E 3MISA 1N3FA 1RQ0A 1FJGE 4AQUA 4X64E 4LTYA 2NA2A 2VBLB 4AQYE 4DV4E 2F8BA 3HXLA 4E2UA 2VBJB 5A2QC 4DV7E 1XNQE 3VYYA 2ODRD 2L2MA 1ZBQA 5A74A 2JOBA 2H36X 3LMLA 5CFFE 1YYWA 1I94E 3ZOQB 5AE3A 2UXCE 1G9YA 4KL6A 4LU9A 3J7Yp 3K6QA 4JI6E 3NZMA 1U0CA 2M1SA 4BCAA 1T4OA 4D6OA 3KO2A 1IBKE 4LFCE 2LRSA 3MIPA 2RS6A 4DUYE 4DKKA 3P1XA 1VDEA 4J8ZA 4UNBA 2V87A 1PKPA 1N3EA 1ZBTA 1G9ZA 1R7MA 2N3HA 4R03A 1FKAE 4LF8E 2IN9A 3H09A 1SR9A 1J5EE 4TUGA 1ZD7A 2LJHA 1EF0A 1UM2A 2JWOA 4BC9A 2XE0B 1STUA 2I3PA 2VF1A 4JI4E 4JI8E 2V89A 4OZ6A 4P78A 3HPZA 3OOLA 4UN9G 2EWLA 5BR8E 2UU9E 4JYAE 2M4IA 4LFBE 1AT0A 2V83A 4X62E 4AADA 2MDRA 2KEQA 2O7MA 3VYXA 4UT0A 4GEQB 4JI3E 4Z1XA 2G7HA 4YISA 2NUFA 2UUBE 4GIGA 3HYJA 1ZDEA 2IN8A 2ODRC 2VBNA 3FIGA 2E1MA 2VBLA 4UN7G 3HTXA 4NXME 5K08A 5ADZA 2UUAE 4GKKE 4F9AB 1J26A 4EFJA 2L2KB 4P7DA 2RS7A 2V85A 5AKMA 4L5NC 1M5XA 4NXNE 2MC5A 4BBYA 1MI8A 4YITA 2B3TB 3T1HE 3IWBA 3MXBB 2LBSB 4YY3E 2E5LE 3C4TA 2FTXB 2KONA 3C4BA 3IWCA 4DR4E 2KOUA 1DQ3A 5E5OA 4LF5E 5AK9A 4AAEA 4M2ZA 4UN7A 2IHR1 4DV0E 4DV3E 3EH8A 5A72A 3JTZA 5LMUE 4KL5A 2L8TA 2LTSA 4LFAE 1WHNA 4X8WA 3HQ1A 3OORA 3LLHA 4LF7E 2F4VE 4DR2E 4LQ0A 4DV6E 4K0KE 1AM2A 2CW7A 1BP7A 2LCJA 4Z20A 4JI1E 4UNCA 1LWTA 4Z1ZA 3AUZA 4BS9A 3HPSA 2RTXA 2IN0A 2JY9A 4UN8G 2VS7A 4DV5E 1T4NA 4B3TE 4F9BB 4KHPE 2UXDE 5LL6R 5E67A 5E63A 3F6GA 3ADJA 2KHXA 5T6JA 4DR5E 3C0XA 4BC7A 4F54A 2L3CA 4DV1E 2JVAA 5A0MB 4UN8A 1UHZA 1B24A 2DMYA 5F3WA 4DV2E 2I3QA 2LE2A 2N3GA 4R8OA 2DCHX 4UN9A 1GZ6A 4M0VA 1X47A 4AABA 1HNXE 1U0DA 4E2TA 2YT4A 2DB2A 5AE2A 1T4LB 3DF6A 2FLDA 2WZOA 2LUPB 3HYIA 5I0AA 4DUZE 5DNYA 3ADGA 4TUIA 1IBME 3JAMC 2CPNA 3MSWA 2UXBE 2VBJA 3MX9A 3MXAA 1HNWE 4DR3E 2B7TA 3VK6A 4WYQB 4JI5E 2B9DA 3E54A 4F9CB 5IWAE 3OMLA 3ADLA 4B3SE 4Q28A 5AE1A 1HR0E 5A0WA 1O0WA 4KZSA 4M30A 3KWRA 1DFAA 4JV5E 2YZTA 2IMZA 2ZM6E 1T9IA 2JOXA 4DR6E 3IGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R7P A;  4Z1Z A;  4O1S A;  2XE0 B;  2VBN B;  3C0W A;  4AAF A;  2I3P A;  5A0M A;  5AKF A;  2IN0 A;  4OZ6 A;  3OOL A;  4UN8 G;  4UN9 G;  2VS7 A;  1AT0 A;  5A78 A;  3QQY A;  3IFJ A;  2QOJ Z;  4AAD A;  2VBO B;  3MIS A;  2KEQ A;  1N3F A;  2LQM A;  2O7M A;  4AQU A;  4UT0 A;  5E67 A;  5E63 A;  2VBL B;  4Z1X A;  4YIS A;  3C0X A;  2L8L A;  4GIG A;  4E2U A;  3HYJ A;  5A77 A;  2VBJ B;  1ZDE A;  2IN8 A;  5A0M B;  2VBN A;  2AB5 A;  3FD2 A;  4UN8 A;  2VBL A;  1B24 A;  4UN7 G;  2LWY A;  5A74 A;  5K08 A;  2I3Q A;  2DCH X;  4UN9 A;  4EFJ A;  2CW8 A;  2VS8 A;  4AAB A;  1U0D A;  4E2T A;  1G9Y A;  4KL6 A;  1JVA A;  4UNA A;  5AKM A;  1MOW A;  3NZM A;  2FLD A;  2JMZ A;  1U0C A;  3HYI A;  1M5X A;  5I0A A;  4LOX A;  5E5S A;  1MI8 A;  4D6O A;  3KO2 A;  4D6N A;  4YIT A;  4O1R A;  4AAG A;  2EX5 A;  4AQX A;  3MXB B;  2VBJ A;  3MIP A;  3MX9 A;  3MXA A;  1VDE A;  3IGD A;  2JNQ A;  3E54 A;  4UNB A;  1DQ3 A;  5E5O A;  2VBO A;  5AK9 A;  4AAE A;  1N3E A;  4UNC A;  1T9J A;  5AKN A;  4UN7 A;  1AF5 A;  5A0W A;  1G9Z A;  1P8K Z;  3EH8 A;  5A72 A;  1R7M A;  2IN9 A;  4KL5 A;  1GPP A;  1LWS A;  4YHX A;  3OOR A;  1DFA A;  4LQ0 A;  3MXB A;  1AM2 A;  1ZD7 A;  2CW7 A;  3UVF A;  1EF0 A;  2IMZ A;  2LCJ A;  1BP7 A;  4Z20 A;  1T9I A;  2XE0 A;  1UM2 A;  1LWT A; 
#chains in the Genus database with same CATH topology
 3R7P A;  4O1S A;  1X3C A;  2VBN B;  3C0W A;  1WHQ A;  3DJW A;  1AH5 A;  2EQ0 A;  5A6B D;  5AAS A;  4DR1 E;  1RC7 A;  5AC5 A;  2MC6 A;  1YFH A;  1XMO E;  1N33 E;  2L33 A;  1KJK A;  5AC4 A;  4WX9 A;  1EKZ A;  2DRP A;  4LF6 E;  5A78 A;  1YPN A;  2VQE E;  1BB8 A;  3IFJ A;  1ZR9 A;  2QOJ Z;  2EM3 A;  1WXR A;  2ENA A;  2VBO B;  1IQS A;  1IBL E;  1WRJ A;  3ADI A;  2LQM A;  2DLQ A;  2EN6 A;  2L92 A;  2L2N A;  4JI7 E;  4JI2 E;  4WXD A;  1ZAA C;  2V86 A;  2M7Q A;  4KWY A;  2EPK X;  4N4R B;  4JI0 E;  1YSA C;  2L8L A;  1QU6 A;  5A77 A;  2YU5 A;  4WSG A;  4I8O A;  2NUG A;  3IWD A;  2JXP A;  2AB5 A;  3FD2 A;  1DI2 A;  4BMJ A;  1X6E A;  2EPP A;  2YTE A;  2YTD A;  4WSP A;  2LWY A;  4IJD A;  4WPY A;  1N32 E;  1N36 E;  4O24 A;  1YZ9 A;  2LTR A;  2K7I A;  2VE7 C;  2YTG A;  2UUC E;  3OTO E;  4MLV A;  2CW8 A;  2VS8 A;  4YHH E;  2L3J A;  3J7A G;  1JVA A;  4UNA A;  4B3M E;  1MOW A;  2EN4 A;  1X48 A;  4RH8 A;  4L8N A;  2EPA A;  1UBD C;  2EMK A;  2EM6 A;  5LMN E;  2EOQ A;  3EQ1 A;  2JMZ A;  2ELY A;  4X65 E;  2LV2 A;  2JR1 A;  4WFT A;  2RSM A;  4LOX A;  5E5S A;  1XMQ E;  4BHB A;  2DIX A;  4B3R E;  2LMZ A;  4D6N A;  4LF4 E;  4O1R A;  3F6H A;  2B7V A;  4AAG A;  2EX5 A;  1EH7 A;  3BBG A;  1XNR E;  4AQX A;  4R2R A;  4DMI A;  2VQF E;  5A6K A;  3C6K A;  2LUQ A;  2EMI A;  3J81 C;  2EPN A;  2N8X A;  1YUJ A;  2EZ6 A;  2R76 A;  2NUE A;  4HEI A;  2HHH E;  4LF9 E;  2I13 A;  2JNQ A;  1WJP A;  2YTP A;  5KL2 A;  5TSE A;  2YWQ A;  2DSY A;  2M9A A;  2EOJ A;  5KL6 A;  5KL5 A;  2VBO A;  5FLX C;  2E72 A;  2K4V A;  2EM0 A;  2V88 A;  1IQO A;  1T9J A;  5AKN A;  1X5W A;  1AF5 A;  2FGG A;  1P8K Z;  2EPZ A;  3RMP A;  4LX3 A;  2EOH A;  2L6M A;  1YYK A;  5A6A A;  1GPP A;  1LWS A;  3T1Y E;  3J80 C;  1HNZ E;  2EM4 A;  4YHX A;  3MXB A;  4GKJ E;  2EQ1 A;  2EM7 A;  4OOG C;  3UVF A;  2ENH A;  4X9J A;  1N34 E;  2XE0 A;  2CT1 A;  2YTI A;  3KZY A;  5A6J A;  4OX9 E;  1YYO A;  4AAF A;  1QNT A;  2JYA A;  5IT9 C;  5A0M A;  5AKF A;  4MLQ A;  5LLQ A;  1X49 A;  2GLI A;  2EMB A;  2V8Q B;  1GQE A;  2YPN A;  2WBS A;  1UIL A;  2FV4 B;  3AV0 A;  4DR7 E;  3QQY A;  2LT7 A;  3JU0 A;  4X66 E;  1TF3 A;  3MIS A;  1N3F A;  5KL4 A;  1RQ0 A;  3MHH C;  2LO3 A;  1FJG E;  4AQU A;  1A1H A;  4X64 E;  4LTY A;  3C6M A;  2NA2 A;  2VBL B;  2VRD A;  4AQY E;  4DV4 E;  2EPO A;  2F8B A;  2NAB A;  3HXL A;  4E2U A;  4M9V C;  2VBJ B;  2YTO A;  5A2Q C;  4DV7 E;  1LLM C;  1XNQ E;  3VYY A;  4ZYD A;  2CSH A;  2ODR D;  2L2M A;  1ZBQ A;  2YRM A;  5A74 A;  2JOB A;  2EML A;  2YU8 A;  2H36 X;  2CTD A;  3LML A;  4QFQ A;  1X6H A;  5CFF E;  1YYW A;  3BID A;  1I94 E;  3ZOQ B;  5AE3 A;  2UXC E;  1G9Y A;  4KL6 A;  4LU9 A;  3J7Y p;  1DGC A;  3K6Q A;  2EE8 A;  4JI6 E;  1YUI A;  1MEY C;  3NZM A;  1U0C A;  2EPU A;  2EMY A;  2M1S A;  3BGH A;  4BCA A;  1T4O A;  5IV8 B;  2YSO A;  4D6O A;  3KO2 A;  1IBK E;  2EOI A;  4LFC E;  2LRS A;  3MIP A;  2HC5 A;  4R2A A;  2RS6 A;  2RQL A;  2MKD A;  4DUY E;  4DKK A;  1L4S A;  3P1X A;  1VDE A;  2EM8 A;  2YTF A;  2EOR A;  2RSI A;  4IS1 C;  3EPH A;  2EMH A;  4J8Z A;  4UNB A;  2EOS A;  2A25 A;  2V87 A;  1PKP A;  5KL7 A;  1N3E A;  2MDG A;  1ZBT A;  2EJ4 A;  2Q8U A;  5A6B A;  1G9Z A;  1R7M A;  2N3H A;  4R03 A;  1FKA E;  2EN2 A;  1A1G A;  4LF8 E;  2IN9 A;  4F6M A;  2I9I A;  2F4L A;  2D9H A;  2ADR A;  2ELZ A;  3H09 A;  4R2S A;  1SR9 A;  1J5E E;  2EPM X;  4TUG A;  1ZD7 A;  2EOZ A;  2LJH A;  1EF0 A;  2EP3 A;  1P47 A;  1UM2 A;  2JWO A;  2EMC A;  4BC9 A;  2XE0 B;  1NEI A;  1SFE A;  1STU A;  2HGH A;  2LCE A;  2I3P A;  4ZYE A;  1MGT A;  2VF1 A;  2DGC A;  4JI4 E;  4JI8 E;  2V89 A;  4OZ6 A;  4P78 A;  3HPZ A;  3OOL A;  1GTK A;  4UN9 G;  2EWL A;  3M99 B;  5BR8 E;  4GZN C;  2UU9 E;  4JYA E;  2EQ3 A;  2M4I A;  4NZV A;  4ZYG A;  4LFB E;  1AT0 A;  1PDA A;  2V83 A;  4X62 E;  4AAD A;  2YSP A;  4WXC A;  2MDR A;  1PJS A;  1A1F A;  2KEQ A;  1G2F C;  2O7M A;  2JPA A;  1T39 A;  3VYX A;  1KYQ A;  4UT0 A;  4GEQ B;  4JI3 E;  4Z1X A;  2G7H A;  4YIS A;  2EL4 A;  2NUF A;  2UUB E;  4GIG A;  3HYJ A;  1ZU1 A;  2MKN A;  2EPC A;  1ZDE A;  2EN8 A;  2IN8 A;  2ODR C;  2EMF A;  2VBN A;  3FIG A;  2E1M A;  2PRT A;  2DLK A;  2VBL A;  4UN7 G;  3HTX A;  1PJQ A;  5K08 A;  2EMZ A;  4NXM E;  5ADZ A;  2UUA E;  4GKK E;  4F9A B;  2BBG A;  1TN9 A;  1J26 A;  4EFJ A;  1A1L A;  2L2K B;  4P7D A;  2RS7 A;  2V85 A;  1PJT A;  1IMU A;  1BBG A;  5AKM A;  2YTQ A;  4R2Q A;  4L5N C;  1G2D C;  2GPI A;  2EMW A;  1M5X A;  5A69 A;  4NXN E;  2MC5 A;  2HJJ A;  4BBY A;  1F2I G;  1MI8 A;  1JK2 A;  4YIT A;  2B3T B;  3QG5 C;  3T1H E;  4O43 A;  3IWB A;  1BBO A;  3MXB B;  2LBS B;  2EN7 A;  4YY3 E;  1N3G A;  2E5L E;  3C4T A;  2FTX B;  2WCC 3;  2KON A;  3C4B A;  2EPR A;  3VHT B;  4F2J C;  3IWC A;  4F6N A;  4DR4 E;  2KOU A;  1DQ3 A;  5E5O A;  4LF5 E;  5AK9 A;  4AAE A;  4HTG A;  2BB8 A;  4M2Z A;  4UN7 A;  4RHB B;  2EOY A;  2IHR 1;  4DV0 E;  4DV3 E;  3EH8 A;  5A72 A;  2RPC A;  3JTZ A;  5IXM B;  5LMU E;  2EM5 A;  4KL5 A;  2L8T A;  2LTS A;  2EN3 A;  4LFA E;  1WHN A;  4X8W A;  3TQM A;  3HQ1 A;  3OOR A;  2J7J A;  3LLH A;  4LF7 E;  2F4V E;  2EOO A;  4LQ0 A;  4DR2 E;  2YTN A;  4DV6 E;  4K0K E;  1AM2 A;  2EOE A;  2CW7 A;  1BP7 A;  2LCJ A;  4NHR A;  4Z20 A;  4JI1 E;  2YRH A;  4UNC A;  1LWT A;  4Z1Z A;  3AUZ A;  4BS9 A;  3HPS A;  1JK1 A;  2RTX A;  4O4K A;  2IN0 A;  3BF2 A;  2EMG A;  2JY9 A;  4UN8 G;  2VS7 A;  1EH6 A;  4DV5 E;  1A1I A;  3KZZ A;  1T4N A;  4B3T E;  3THO B;  2GHF A;  2EM9 A;  1Z1B A;  4F9B B;  1B69 A;  2R1F A;  4KHP E;  2UXD E;  5LL6 R;  1T38 A;  5E67 A;  5E63 A;  1NCS A;  3ADJ A;  2KHX A;  3F6G A;  5T6J A;  4DR5 E;  2JP9 A;  3C0X A;  3L00 A;  2LJU A;  4BC7 A;  4F54 A;  2L3C A;  4DV1 E;  4O5G A;  1UN6 B;  2JVA A;  4Q35 B;  5A0M B;  4UN8 A;  1UHZ A;  1B24 A;  2DMY A;  5F3W A;  4DV2 E;  2I3Q A;  2LE2 A;  2N3G A;  2DMI A;  4R8O A;  3EPL A;  2YRK A;  2LVH A;  2DCH X;  4UN9 A;  1GZ6 A;  4M0V A;  1X47 A;  4AAB A;  1HNX E;  1U0D A;  4E2T A;  2EN1 A;  3EPK A;  2YT4 A;  2DB2 A;  5AE2 A;  1T4L B;  3DF6 A;  4FK5 C;  2EM2 A;  2FLD A;  1A1J A;  4R2E A;  2WZO A;  3THN A;  3UK3 C;  2LUP B;  3HYI A;  4R2C A;  2WBU A;  5I0A A;  4DUZ E;  2EMX A;  5DNY A;  3ADG A;  4TUI A;  1IBM E;  3JAM C;  4ZYH A;  2CPN A;  3MSW A;  2UXB E;  3ECR A;  2VBJ A;  2EPX A;  3MX9 A;  3MXA A;  4R2D A;  1HNW E;  2EPL X;  4DR3 E;  2ENC A;  4R2P A;  2B7T A;  2EL5 A;  1EH8 A;  1X6F A;  3VK6 A;  2EL6 A;  4WYQ B;  2YTJ A;  4JI5 E;  2B9D A;  3E54 A;  4F9C B;  5IWA E;  3OML A;  3ADL A;  2EOF A;  4B3S E;  4BHC A;  4Q28 A;  5AE1 A;  3EPJ A;  1HR0 E;  5A0W A;  1O0W A;  4KZS A;  2WBT A;  3MHS C;  2EOM A;  1A1K A;  1RMD A;  4M30 A;  3KWR A;  1TF6 A;  1DFA A;  5KL3 A;  4JV5 E;  1AAY A;  2EOX A;  2YZT A;  2EMA A;  2IMZ A;  2ZM6 E;  1T9I A;  2JOX A;  4DR6 E;  3IGD A; 
#chains in the Genus database with same CATH homology
 3R7P A;  4O1S A;  2VBN B;  3C0W A;  1WHQ A;  3DJW A;  4DR1 E;  5AAS A;  1RC7 A;  2MC6 A;  1XMO E;  1N33 E;  2L33 A;  1EKZ A;  4LF6 E;  5A78 A;  2VQE E;  3IFJ A;  2QOJ Z;  1WXR A;  2VBO B;  1IBL E;  3ADI A;  2LQM A;  2L92 A;  2L2N A;  4JI7 E;  4JI2 E;  2V86 A;  2M7Q A;  4JI0 E;  2L8L A;  1QU6 A;  5A77 A;  4I8O A;  2NUG A;  3IWD A;  2AB5 A;  3FD2 A;  1DI2 A;  4BMJ A;  4WSP A;  2LWY A;  4WPY A;  1N32 E;  1N36 E;  1YZ9 A;  2LTR A;  2VE7 C;  2UUC E;  3OTO E;  2CW8 A;  2VS8 A;  4YHH E;  2L3J A;  3J7A G;  1JVA A;  4UNA A;  4B3M E;  1MOW A;  1X48 A;  4L8N A;  5LMN E;  2JMZ A;  4X65 E;  2JR1 A;  4WFT A;  2RSM A;  4LOX A;  5E5S A;  1XMQ E;  2DIX A;  4B3R E;  2LMZ A;  4D6N A;  4LF4 E;  4O1R A;  3F6H A;  2B7V A;  4AAG A;  2EX5 A;  1XNR E;  4AQX A;  4DMI A;  2VQF E;  2LUQ A;  3J81 C;  2EZ6 A;  2NUE A;  2HHH E;  4LF9 E;  2JNQ A;  2DSY A;  2VBO A;  5FLX C;  2K4V A;  2V88 A;  1T9J A;  5AKN A;  1AF5 A;  2FGG A;  1P8K Z;  3RMP A;  1YYK A;  2L6M A;  1GPP A;  1LWS A;  3T1Y E;  3J80 C;  1HNZ E;  4YHX A;  3MXB A;  4GKJ E;  4OOG C;  3UVF A;  1N34 E;  2XE0 A;  4OX9 E;  1YYO A;  4AAF A;  5IT9 C;  5A0M A;  5AKF A;  1X49 A;  2V8Q B;  1GQE A;  1UIL A;  2FV4 B;  3AV0 A;  4DR7 E;  3QQY A;  3JU0 A;  4X66 E;  3MIS A;  1N3F A;  1RQ0 A;  1FJG E;  4AQU A;  4X64 E;  4LTY A;  2NA2 A;  2VBL B;  4AQY E;  4DV4 E;  2F8B A;  3HXL A;  4E2U A;  2VBJ B;  5A2Q C;  4DV7 E;  1XNQ E;  3VYY A;  2ODR D;  2L2M A;  1ZBQ A;  5A74 A;  2JOB A;  2H36 X;  3LML A;  5CFF E;  1YYW A;  1I94 E;  3ZOQ B;  5AE3 A;  2UXC E;  1G9Y A;  4KL6 A;  4LU9 A;  3J7Y p;  3K6Q A;  4JI6 E;  3NZM A;  1U0C A;  2M1S A;  4BCA A;  1T4O A;  4D6O A;  3KO2 A;  1IBK E;  4LFC E;  2LRS A;  3MIP A;  2RS6 A;  4DUY E;  4DKK A;  3P1X A;  1VDE A;  4J8Z A;  4UNB A;  2V87 A;  1PKP A;  1N3E A;  1ZBT A;  1G9Z A;  1R7M A;  2N3H A;  4R03 A;  1FKA E;  4LF8 E;  2IN9 A;  3H09 A;  1SR9 A;  1J5E E;  4TUG A;  1ZD7 A;  2LJH A;  1EF0 A;  1UM2 A;  2JWO A;  4BC9 A;  2XE0 B;  1STU A;  2I3P A;  2VF1 A;  4JI4 E;  4JI8 E;  2V89 A;  4OZ6 A;  4P78 A;  3HPZ A;  3OOL A;  4UN9 G;  2EWL A;  5BR8 E;  2UU9 E;  4JYA E;  2M4I A;  4LFB E;  1AT0 A;  2V83 A;  4X62 E;  4AAD A;  2MDR A;  2KEQ A;  2O7M A;  3VYX A;  4UT0 A;  4GEQ B;  4JI3 E;  4Z1X A;  2G7H A;  4YIS A;  2NUF A;  2UUB E;  4GIG A;  3HYJ A;  1ZDE A;  2IN8 A;  2ODR C;  2VBN A;  3FIG A;  2E1M A;  2VBL A;  4UN7 G;  3HTX A;  4NXM E;  5K08 A;  5ADZ A;  2UUA E;  4GKK E;  4F9A B;  1J26 A;  4EFJ A;  2L2K B;  4P7D A;  2RS7 A;  2V85 A;  5AKM A;  4L5N C;  1M5X A;  4NXN E;  2MC5 A;  4BBY A;  1MI8 A;  4YIT A;  2B3T B;  3T1H E;  3IWB A;  3MXB B;  2LBS B;  4YY3 E;  2E5L E;  3C4T A;  2FTX B;  2KON A;  3C4B A;  3IWC A;  4DR4 E;  2KOU A;  1DQ3 A;  5E5O A;  4LF5 E;  5AK9 A;  4AAE A;  4M2Z A;  4UN7 A;  2IHR 1;  4DV0 E;  4DV3 E;  3EH8 A;  5A72 A;  3JTZ A;  5LMU E;  4KL5 A;  2L8T A;  2LTS A;  4LFA E;  1WHN A;  4X8W A;  3HQ1 A;  3OOR A;  3LLH A;  4LF7 E;  2F4V E;  4DR2 E;  4LQ0 A;  4DV6 E;  4K0K E;  1AM2 A;  2CW7 A;  1BP7 A;  2LCJ A;  4Z20 A;  4JI1 E;  4UNC A;  1LWT A;  4Z1Z A;  3AUZ A;  4BS9 A;  3HPS A;  2RTX A;  2IN0 A;  2JY9 A;  4UN8 G;  2VS7 A;  4DV5 E;  1T4N A;  4B3T E;  4F9B B;  4KHP E;  2UXD E;  5LL6 R;  5E67 A;  5E63 A;  3F6G A;  3ADJ A;  2KHX A;  5T6J A;  4DR5 E;  3C0X A;  4BC7 A;  4F54 A;  2L3C A;  4DV1 E;  2JVA A;  5A0M B;  4UN8 A;  1UHZ A;  1B24 A;  2DMY A;  5F3W A;  4DV2 E;  2I3Q A;  2LE2 A;  2N3G A;  4R8O A;  2DCH X;  4UN9 A;  1GZ6 A;  4M0V A;  1X47 A;  4AAB A;  1HNX E;  1U0D A;  4E2T A;  2YT4 A;  2DB2 A;  5AE2 A;  1T4L B;  3DF6 A;  2FLD A;  2WZO A;  2LUP B;  3HYI A;  5I0A A;  4DUZ E;  5DNY A;  3ADG A;  4TUI A;  1IBM E;  3JAM C;  2CPN A;  3MSW A;  2UXB E;  2VBJ A;  3MX9 A;  3MXA A;  1HNW E;  4DR3 E;  2B7T A;  3VK6 A;  4WYQ B;  4JI5 E;  2B9D A;  3E54 A;  4F9C B;  5IWA E;  3OML A;  3ADL A;  4B3S E;  4Q28 A;  5AE1 A;  1HR0 E;  5A0W A;  1O0W A;  4KZS A;  4M30 A;  3KWR A;  1DFA A;  4JV5 E;  2YZT A;  2IMZ A;  2ZM6 E;  1T9I A;  2JOX A;  4DR6 E;  3IGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...