1DQ3A

Crystal structure of an archaeal intein-encoded homing endonuclease pi-pfui
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
454
structure length
454
Chain Sequence
CIDGKAKIIFENEGEEHLTTMEEMYERYKHLGEFYDEEYNRWGIDVSNVPIYVKSFDPESKRVVKGKVNVIWKYELGKDVTKYEIITNKGTKILTSPWHPFFVLTPDFKIVEKRADELKEGDILIGGMPDGEDYKFIFDYWLAGFIAGDGCFDKYHSHVKGHEYIYDRLRIYDYRIETFEIINDYLEKTFGRKYSIQKDRNIYYIDIKARNITSHYLKLLEGIDNGIPPQILKEGKNAVLSFIAGLFDAEGHVSNKPGIELGMVNKRLIEDVTHYLNALGIKARIREKLRKDGIDYVLHVEEYSSLLRFYELIGKNLQNEEKREKLEKVLSNHKGGNFGLPLNFNAFKEWASEYGVEFKTNGSQTIAIINDERISLGQWHTRNRVSKAVLVKMLRKLYEATKDEEVKRMLHLIEGLEVVRHITTTNEPRTFYDLTVENYQNYLAGENGMIFVHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an archaeal intein-encoded homing endonuclease PI-PfuI.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
molecule keywords ENDONUCLEASE
total genus 138
structure length 454
sequence length 454
ec nomenclature ec 1.17.4.1: Ribonucleoside-diphosphate reductase.
pdb deposition date 1999-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09061 Stirrup Stirrup
A PF09062 Endonuc_subdom PI-PfuI Endonuclease subdomain
A PF14528 LAGLIDADG_3 LAGLIDADG-like domain
A PF14890 Intein_splicing Intein splicing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.16.10 Mainly Beta Beta Complex Endonuclease - Pi-scei; Chain A, domain 1 Hedgehog/Intein (Hint) domain 1dq3A01
3.10.28.10 Alpha Beta Roll Endonuclease I-creI Homing endonucleases 1dq3A04
3.10.28.10 Alpha Beta Roll Endonuclease I-creI Homing endonucleases 1dq3A03
3.30.160.90 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1dq3A02
3HYJA 4UN8A 4O1RA 4AQUA 2VS7A 4UN9A 5AK9A 1G9ZA 1AM2A 2QOJZ 4AABA 1G9YA 4YISA 5I0AA 5A78A 2IN0A 2L8LA 4LQ0A 2I3PA 3IGDA 4GIGA 4D6OA 1LWTA 1R7MA 4AADA 4O1SA 4UNBA 1ZD7A 5AKFA 3QQYA 1GPPA 5E5OA 3KO2A 4AAFA 4AQXA 1N3FA 1U0CA 1BP7A 2I3QA 3OORA 2LWYA 2DCHX 4OZ6A 3NZMA 4KL5A 4UN8G 2FLDA 3FD2A 3EH8A 5A72A 5A74A 2VBLA 2EX5A 1DQ3A 5A0MB 2IN8A 3HYIA 2XE0B 2XE0A 3MXBB 3OOLA 1T9JA 4UN9G 1MI8A 3MX9A 1AT0A 1DFAA 4UN7G 5A77A 2AB5A 2VBOA 4LOXA 5K08A 2VBNB 3UVFA 1N3EA 3MISA 1U0DA 1EF0A 3MIPA 2LCJA 3E54A 3C0WA 3R7PA 4EFJA 1VDEA 2VS8A 2JNQA 2VBJA 1AF5A 4Z20A 4Z1XA 4UNCA 5E67A 3MXAA 4KL6A 1UM2A 2IMZA 4YITA 3MXBA 5E63A 2VBJB 4UNAA 4E2UA 4D6NA 5AKNA 2JMZA 5A0MA 1M5XA 2IN9A 4AAGA 4UT0A 1T9IA 2VBLB 2VBOB 1JVAA 2CW7A 1ZDEA 4E2TA 2KEQA 2VBNA 1MOWA 5AKMA 4Z1ZA 3C0XA 3IFJA 5A0WA 2CW8A 1P8KZ 2LQMA 4UN7A 4AAEA 1B24A 1LWSA 5E5SA 4YHXA 2O7MA
chains in the Genus database with same CATH superfamily
1QU6A 4O1RA 1YYWA 3BF2A 1F2IG 2UXBE 4UN9A 5LMUE 2ELYA 2B9DA 4FK5C 4DR5E 1KYQA 4YISA 4N4RB 5I0AA 3VYYA 2V86A 5KL4A 3F6GA 3VYXA 2JP9A 5FLXC 3EPKA 4DKKA 2LVHA 1HR0E 4GIGA 4YHHE 1LWTA 4JI0E 4NHRA 2L2KB 2EORA 5AKFA 2EMYA 2GLIA 5E5OA 2RSMA 2EQ0A 4BHCA 2EM0A 4JI1E 2B7TA 2N8XA 3TQMA 5F3WA 1SR9A 3ECRA 3HXLA 1XNQE 2ENHA 2EM3A 1JK1A 3EQ1A 2EM8A 4B3RE 4DR6E 2MDRA 2LBSB 1WHQA 2VBLA 4I8OA 2KONA 3HTXA 5A0MB 2DLKA 2UXCE 2XE0B 3OOLA 2GHFA 3C4TA 1UN6B 2YPNA 5AC5A 1IQOA 4F6NA 2RS7A 5A77A 2M7QA 4GZNC 2YU8A 3DF6A 2LTSA 2LCEA 4ZYEA 3ADLA 3HPZA 5K08A 4LF4E 1GZ6A 2EL6A 4R2EA 4NXNE 2JVAA 2FGGA 2EN4A 4QFQA 5KL3A 3JAMC 1EF0A 1A1LA 2LCJA 2CSHA 2KOUA 4EFJA 2EMFA 2YTIA 1A1JA 2VS8A 2VBJA 2VF1A 1PDAA 4LU9A 2UU9E 2EOIA 2EOOA 4KL6A 2NUFA 2DMIA 2NUGA 2B7VA 4YITA 1YYKA 5E63A 4DV7E 4R03A 1A1KA 4LFBE 4KWYA 4LX3A 5A6AA 5AKNA 1ZBQA 2V87A 2RPCA 3F6HA 4L8NA 1X49A 2RSIA 1IQSA 2L2MA 3MHHC 5AE3A 5A6BD 2WZOA 4E2TA 2VBNA 1MEYC 1T4LB 2MKNA 4Z1ZA 5CFFE 1FJGE 2CW8A 2EMKA 1P8KZ 5BR8E 5IXMB 4UN7A 1T4OA 5KL7A 4R2DA 2ODRD 1B24A 1HNWE 1LWSA 2V83A 3THNA 2EM6A 1YUJA 3HYJA 4UN8A 4AQUA 4F9AB 5LMNE 2EMXA 2M1SA 2DLQA 2JXPA 2EOSA 2L92A 1YUIA 2HGHA 4F54A 3IWDA 2Q8UA 2QOJZ 1G9YA 2EOEA 2WBTA 4X8WA 4IS1C 2EPAA 2M9AA 5AASA 5A78A 1N34E 3P1XA 4MLVA 1O0WA 2N3HA 3C6KA 2K4VA 4R2QA 2I3PA 4B3TE 2LUPB 1EH7A 3MSWA 4D6OA 1T4NA 2VE7C 2YTGA 2YT4A 2YWQA 4O1SA 4UNBA 2JOXA 2VQEE 1GPPA 4JI5E 4B3SE 2A25A 2MC5A 3BIDA 5LLQA 4O24A 4DV2E 4BHBA 2EN6A 4J8ZA 4JI4E 2ODRC 4OZ6A 3NZMA 4GEQB 2EMCA 4UN8G 2FLDA 4LF9E 1PJTA 5TSEA 2LV2A 2EX5A 3OMLA 2IN8A 3VK6A 1G2FC 4DR7E 5AC4A 4BMJA 2I13A 3MXBB 4LFAE 2HC5A 2EMWA 2RS6A 2M4IA 1YSAC 4GKJE 5KL6A 2G7HA 4M30A 2JPAA 1EH8A 2JR1A 3KWRA 1DFAA 4UN7G 1X48A 2AB5A 3H09A 5IV8B 1I94E 1ZBTA 2DRPA 4GKKE 2VBNB 3UVFA 1T38A 1WHNA 4R2AA 2EPOA 2EMBA 1T39A 2UUAE 1N3EA 3MISA 3IWBA 4ZYDA 3ADIA 4JYAE 4YY3E 1ZU1A 2EOMA 2EM7A 5A6KA 5LL6R 2EOQA 4Z20A 2LO3A 3QG5C 5E67A 3FIGA 3MXAA 2EMHA 2IMZA 1TN9A 2HJJA 3MXBA 5AE1A 4DUZE 4K0KE 2KHXA 2VBJB 3T1HE 1XNRE 4UNAA 2EOJA 5KL2A 4D6NA 4HEIA 1FKAE 2JMZA 4Q35B 5T6JA 4AAGA 2YZTA 2YTNA 4MLQA 2ENAA 1T9IA 2VBOB 1YPNA 3JTZA 4AQYE 2CW7A 3MHSC 2DIXA 4B3ME 1ZDEA 2EJ4A 4ZYHA 2R76A 2YTFA 4BS9A 1MOWA 2YRKA 3C0XA 2EOFA 1A1FA 2FTXB 3DJWA 2L3CA 1A1GA 5E5SA 1HNZE 1L4SA 2O7MA 2EMZA 1X5WA 2JOBA 1YZ9A 2VS7A 5A2QC 4Q28A 1G9ZA 4L5NC 1AM2A 2DMYA 2IN0A 1N36E 4R8OA 2EOYA 2B3TB 2EN7A 2YTJA 1X6FA 4R2CA 3IGDA 1PJSA 4M9VC 3UK3C 1G2DC 3BGHA 2D9HA 2I9IA 5DNYA 1IMUA 4O43A 2V88A 4HTGA 2R1FA 2YSPA 3KO2A 4AAFA 4AQXA 1N3FA 1BP7A 2I3QA 4DMIA 2LMZA 2ELZA 3EPLA 2EL5A 2DCHX 4BBYA 4BC9A 2VQFE 2EMLA 2EM2A 5A74A 2WBUA 1J5EE 1DQ3A 4WXDA 2VRDA 1IBLE 1EKZA 4R2RA 3HYIA 4JI3E 2F4VE 4DUYE 2DSYA 2XE0A 2JYAA 1T9JA 1AH5A 4M2ZA 1PJQA 1XMQE 3KZZA 2EPPA 2RTXA 4LF7E 3HPSA 3HQ1A 2EM5A 2EPXA 4KZSA 4TUGA 2ENCA 3J7Yp 2YTDA 3ADJA 1X47A 4R2PA 4WYQB 2EPNA 4BCAA 4DV5E 2LTRA 2V85A 1X6EA 4LF5E 3C0WA 2YRMA 2CT1A 4P7DA 2MDGA 4F9CB 2NUEA 5AE2A 2E1MA 1AF5A 2EOXA 2IHR1 4UNCA 4Z1XA 4WSGA 1A1IA 2WCC3 3C4BA 1TF6A 4JI2E 1BBGA 4WXCA 2E72A 2RQLA 4O5GA 5A0MA 5IWAE 3T1YE 2L2NA 3K6QA 2EQ1A 2VBLB 2EMAA 1QNTA 4WSPA 1RMDA 4X66E 1JK2A 1TF3A 1XMOE 4OOGC 1J26A 2F4LA 4LF8E 2CPNA 2MC6A 4DV6E 3JU0A 2WBSA 4ZYGA 2HHHE 3ADGA 3IWCA 1Z1BA 4YHXA 2V89A 2EPCA 2L33A 1UBDC 2EZ6A 3AUZA 2LRSA 4M0VA 4DV1E 2EMGA 5AK9A 2DB2A 4NXME 4AABA 1IBME 4TUIA 1PKPA 4JV5E 2LJHA 5A69A 1BBOA 1KJKA 2L8LA 2YSOA 4DV3E 4KHPE 4LQ0A 2EPUA 1NEIA 2EP3A 2UUBE 1EH6A 1A1HA 1MGTA 1R7MA 2JWOA 4DV0E 4F6MA 1IBKE 3RMPA 4WX9A 4AADA 1HNXE 2EPRA 1ZD7A 2GPIA 3QQYA 2EE8A 4RH8A 2N3GA 1B69A 5A6BA 2EM4A 2K7IA 1U0CA 3OTOE 1WXRA 2NABA 4DV4E 1ZAAC 3OORA 2LWYA 1N33E 4X65E 2ADRA 4IJDA 2NA2A 4KL5A 2BBGA 2H36X 3VHTB 3M99B 5A6JA 2EPKX 2V8QB 2ZM6E 3FD2A 3EH8A 1UILA 3L00A 4DR1E 2EN2A 2LUQA 5A72A 3J7AG 2DGCA 1RC7A 4JI7E 2MKDA 2UXDE 4JI6E 1SFEA 2EPZA 1RQ0A 3KZYA 2EL4A 2EWLA 2EMIA 4X62E 4OX9E 4UN9G 3BBGA 1MI8A 1AAYA 4LFCE 2L3JA 1NCSA 3MX9A 1AT0A 1UHZA 1DGCA 2EQ3A 2FV4B 4DR4E 2VBOA 3LLHA 4O4KA 4BC7A 4LOXA 4R2SA 2YTEA 2EN3A 4X64E 4LTYA 4F9BB 5KL5A 2L8TA 2LE2A 3J80C 2J7JA 1X3CA 5ADZA 2EPLX 1U0DA 3AV0A 2E5LE 1YYOA 1YFHA 1STUA 3THOB 2L6MA 3MIPA 3E54A 3R7PA 1WJPA 2YTOA 1LLMC 3EPHA 1BB8A 1VDEA 4LF6E 2JNQA 2UUCE 2EN1A 4RHBB 2BB8A 1GTKA 4NZVA 3LMLA 2YRHA 1UM2A 1DI2A 2YU5A 2YTQA 1GQEA 2EN8A 4E2UA 2PRTA 3EPJA 4X9JA 1M5XA 2IN9A 2EPMX 4UT0A 1N3GA 4DR3E 2LJUA 2EOZA 1X6HA 2CTDA 4F2JC 1JVAA 4JI8E 3J81C 1P47A 2EM9A 4P78A 4WPYA 1WRJA 2F8BA 4DR2E 2KEQA 5AKMA 1N32E 3IFJA 5A0WA 1ZR9A 3ZOQB 2LQMA 4WFTA 2LT7A 4AAEA 2EOHA 3C6MA 2JY9A 5IT9C 2YTPA
chains in the Genus database with same CATH topology
1QU6A 4O1RA 1YYWA 2UXBE 4UN9A 5LMUE 2B9DA 4DR5E 4YISA 5I0AA 3VYYA 2V86A 3F6GA 3VYXA 5FLXC 4DKKA 1HR0E 4GIGA 4YHHE 1LWTA 4JI0E 2L2KB 5AKFA 5E5OA 2RSMA 4JI1E 2B7TA 5F3WA 1SR9A 3HXLA 1XNQE 4B3RE 4DR6E 2MDRA 2LBSB 1WHQA 2VBLA 4I8OA 2KONA 3HTXA 5A0MB 2UXCE 2XE0B 3OOLA 3C4TA 2RS7A 5A77A 2M7QA 3DF6A 2LTSA 3ADLA 3HPZA 5K08A 4LF4E 1GZ6A 4NXNE 2JVAA 2FGGA 3JAMC 1EF0A 2LCJA 2KOUA 4EFJA 2VS8A 2VBJA 2VF1A 4LU9A 2UU9E 4KL6A 2NUFA 2NUGA 2B7VA 4YITA 1YYKA 5E63A 4DV7E 4R03A 4LFBE 5AKNA 1ZBQA 2V87A 3F6HA 4L8NA 1X49A 2L2MA 5AE3A 2WZOA 4E2TA 2VBNA 1T4LB 4Z1ZA 5CFFE 1FJGE 2CW8A 1P8KZ 5BR8E 4UN7A 1T4OA 2ODRD 1B24A 1HNWE 1LWSA 2V83A 3HYJA 4UN8A 4AQUA 4F9AB 5LMNE 2M1SA 2L92A 4F54A 3IWDA 2QOJZ 1G9YA 4X8WA 5AASA 5A78A 1N34E 3P1XA 1O0WA 2N3HA 2K4VA 2I3PA 4B3TE 2LUPB 3MSWA 4D6OA 1T4NA 2VE7C 2YT4A 4O1SA 4UNBA 2JOXA 2VQEE 1GPPA 4JI5E 4B3SE 2MC5A 4DV2E 4J8ZA 4JI4E 2ODRC 4OZ6A 3NZMA 4GEQB 4UN8G 2FLDA 4LF9E 2EX5A 3OMLA 2IN8A 3VK6A 4DR7E 4BMJA 3MXBB 4LFAE 2RS6A 2M4IA 4GKJE 2G7HA 4M30A 2JR1A 3KWRA 1DFAA 4UN7G 1X48A 2AB5A 3H09A 1I94E 1ZBTA 4GKKE 2VBNB 3UVFA 1WHNA 2UUAE 1N3EA 3MISA 3IWBA 3ADIA 4JYAE 4YY3E 5LL6R 4Z20A 5E67A 3FIGA 3MXAA 2IMZA 5AE1A 3MXBA 4K0KE 4DUZE 2KHXA 2VBJB 3T1HE 1XNRE 4UNAA 4D6NA 1FKAE 2JMZA 5T6JA 4AAGA 2YZTA 1T9IA 2VBOB 4AQYE 3JTZA 2CW7A 2DIXA 4B3ME 1ZDEA 4BS9A 1MOWA 3C0XA 2FTXB 3DJWA 2L3CA 5E5SA 1HNZE 2O7MA 2JOBA 1YZ9A 2VS7A 5A2QC 4Q28A 1G9ZA 4L5NC 1AM2A 2DMYA 2IN0A 1N36E 4R8OA 2B3TB 3IGDA 5DNYA 2V88A 3KO2A 4AAFA 4AQXA 1N3FA 1BP7A 2I3QA 4DMIA 2LMZA 2DCHX 4BBYA 4BC9A 2VQFE 5A74A 1J5EE 1DQ3A 1IBLE 1EKZA 3HYIA 4JI3E 2F4VE 4DUYE 2DSYA 2XE0A 1T9JA 4M2ZA 1XMQE 2RTXA 4LF7E 3HPSA 3HQ1A 4KZSA 4TUGA 3J7Yp 3ADJA 1X47A 4WYQB 4BCAA 4DV5E 2LTRA 2V85A 4LF5E 3C0WA 4P7DA 4F9CB 2NUEA 5AE2A 2E1MA 1AF5A 2IHR1 4UNCA 4Z1XA 3C4BA 4JI2E 5IWAE 5A0MA 3T1YE 2L2NA 3K6QA 2VBLB 4WSPA 4X66E 1XMOE 4OOGC 1J26A 4LF8E 2CPNA 2MC6A 4DV6E 3JU0A 2HHHE 3ADGA 3IWCA 4YHXA 2V89A 2L33A 2EZ6A 3AUZA 2LRSA 4M0VA 4DV1E 5AK9A 2DB2A 4NXME 4AABA 1IBME 4TUIA 1PKPA 4JV5E 2LJHA 2L8LA 4DV3E 4KHPE 4LQ0A 2UUBE 1R7MA 2JWOA 4DV0E 1IBKE 3RMPA 4AADA 1HNXE 1ZD7A 3QQYA 2N3GA 1U0CA 3OTOE 1WXRA 4DV4E 3OORA 2LWYA 1N33E 4X65E 2NA2A 4KL5A 2H36X 2V8QB 2ZM6E 3FD2A 3EH8A 1UILA 4DR1E 2LUQA 5A72A 3J7AG 1RC7A 4JI7E 2UXDE 4JI6E 1RQ0A 2EWLA 4X62E 4OX9E 4UN9G 1MI8A 4LFCE 2L3JA 3MX9A 1AT0A 1UHZA 2FV4B 4DR4E 2VBOA 3LLHA 4BC7A 4LOXA 4X64E 4LTYA 4F9BB 2L8TA 2LE2A 3J80C 5ADZA 1U0DA 3AV0A 2E5LE 1YYOA 1STUA 3MIPA 3E54A 3R7PA 2L6MA 1VDEA 4LF6E 2JNQA 2UUCE 3LMLA 1UM2A 1DI2A 1GQEA 4E2UA 1M5XA 2IN9A 4UT0A 4DR3E 1JVAA 4JI8E 3J81C 4P78A 4WPYA 2F8BA 4DR2E 2KEQA 5AKMA 1N32E 3IFJA 5A0WA 3ZOQB 2LQMA 4WFTA 4AAEA 2JY9A 5IT9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HYJ A;  4UN8 A;  4O1R A;  4AQU A;  2VS7 A;  4UN9 A;  5AK9 A;  1G9Z A;  1AM2 A;  2QOJ Z;  4AAB A;  1G9Y A;  4YIS A;  5I0A A;  5A78 A;  2IN0 A;  2L8L A;  4LQ0 A;  2I3P A;  3IGD A;  4GIG A;  4D6O A;  1LWT A;  1R7M A;  4AAD A;  4O1S A;  4UNB A;  1ZD7 A;  5AKF A;  3QQY A;  1GPP A;  5E5O A;  3KO2 A;  4AAF A;  4AQX A;  1N3F A;  1U0C A;  1BP7 A;  2I3Q A;  3OOR A;  2LWY A;  2DCH X;  4OZ6 A;  3NZM A;  4KL5 A;  4UN8 G;  2FLD A;  3FD2 A;  3EH8 A;  5A72 A;  5A74 A;  2VBL A;  2EX5 A;  1DQ3 A;  5A0M B;  2IN8 A;  3HYI A;  2XE0 B;  2XE0 A;  3MXB B;  3OOL A;  1T9J A;  4UN9 G;  1MI8 A;  3MX9 A;  1AT0 A;  1DFA A;  4UN7 G;  5A77 A;  2AB5 A;  2VBO A;  4LOX A;  5K08 A;  2VBN B;  3UVF A;  1N3E A;  3MIS A;  1U0D A;  1EF0 A;  3MIP A;  2LCJ A;  3E54 A;  3C0W A;  3R7P A;  4EFJ A;  1VDE A;  2VS8 A;  2JNQ A;  2VBJ A;  1AF5 A;  4Z20 A;  4Z1X A;  4UNC A;  5E67 A;  3MXA A;  4KL6 A;  1UM2 A;  2IMZ A;  4YIT A;  3MXB A;  5E63 A;  2VBJ B;  4UNA A;  4E2U A;  4D6N A;  5AKN A;  2JMZ A;  5A0M A;  1M5X A;  2IN9 A;  4AAG A;  4UT0 A;  1T9I A;  2VBL B;  2VBO B;  1JVA A;  2CW7 A;  1ZDE A;  4E2T A;  2KEQ A;  2VBN A;  1MOW A;  5AKM A;  4Z1Z A;  3C0X A;  3IFJ A;  5A0W A;  2CW8 A;  1P8K Z;  2LQM A;  4UN7 A;  4AAE A;  1B24 A;  1LWS A;  5E5S A;  4YHX A;  2O7M A; 
#chains in the Genus database with same CATH topology
 1QU6 A;  4O1R A;  1YYW A;  3BF2 A;  1F2I G;  2UXB E;  4UN9 A;  5LMU E;  2ELY A;  2B9D A;  4FK5 C;  4DR5 E;  1KYQ A;  4YIS A;  4N4R B;  5I0A A;  3VYY A;  2V86 A;  5KL4 A;  3F6G A;  3VYX A;  2JP9 A;  5FLX C;  3EPK A;  4DKK A;  2LVH A;  1HR0 E;  4GIG A;  4YHH E;  1LWT A;  4JI0 E;  4NHR A;  2L2K B;  2EOR A;  5AKF A;  2EMY A;  2GLI A;  5E5O A;  2RSM A;  2EQ0 A;  4BHC A;  2EM0 A;  4JI1 E;  2B7T A;  2N8X A;  3TQM A;  5F3W A;  1SR9 A;  3ECR A;  3HXL A;  1XNQ E;  2ENH A;  2EM3 A;  1JK1 A;  3EQ1 A;  2EM8 A;  4B3R E;  4DR6 E;  2MDR A;  2LBS B;  1WHQ A;  2VBL A;  4I8O A;  2KON A;  3HTX A;  5A0M B;  2DLK A;  2UXC E;  2XE0 B;  3OOL A;  2GHF A;  3C4T A;  1UN6 B;  2YPN A;  5AC5 A;  1IQO A;  4F6N A;  2RS7 A;  5A77 A;  2M7Q A;  4GZN C;  2YU8 A;  3DF6 A;  2LTS A;  2LCE A;  4ZYE A;  3ADL A;  3HPZ A;  5K08 A;  4LF4 E;  1GZ6 A;  2EL6 A;  4R2E A;  4NXN E;  2JVA A;  2FGG A;  2EN4 A;  4QFQ A;  5KL3 A;  3JAM C;  1EF0 A;  1A1L A;  2LCJ A;  2CSH A;  2KOU A;  4EFJ A;  2EMF A;  2YTI A;  1A1J A;  2VS8 A;  2VBJ A;  2VF1 A;  1PDA A;  4LU9 A;  2UU9 E;  2EOI A;  2EOO A;  4KL6 A;  2NUF A;  2DMI A;  2NUG A;  2B7V A;  4YIT A;  1YYK A;  5E63 A;  4DV7 E;  4R03 A;  1A1K A;  4LFB E;  4KWY A;  4LX3 A;  5A6A A;  5AKN A;  1ZBQ A;  2V87 A;  2RPC A;  3F6H A;  4L8N A;  1X49 A;  2RSI A;  1IQS A;  2L2M A;  3MHH C;  5AE3 A;  5A6B D;  2WZO A;  4E2T A;  2VBN A;  1MEY C;  1T4L B;  2MKN A;  4Z1Z A;  5CFF E;  1FJG E;  2CW8 A;  2EMK A;  1P8K Z;  5BR8 E;  5IXM B;  4UN7 A;  1T4O A;  5KL7 A;  4R2D A;  2ODR D;  1B24 A;  1HNW E;  1LWS A;  2V83 A;  3THN A;  2EM6 A;  1YUJ A;  3HYJ A;  4UN8 A;  4AQU A;  4F9A B;  5LMN E;  2EMX A;  2M1S A;  2DLQ A;  2JXP A;  2EOS A;  2L92 A;  1YUI A;  2HGH A;  4F54 A;  3IWD A;  2Q8U A;  2QOJ Z;  1G9Y A;  2EOE A;  2WBT A;  4X8W A;  4IS1 C;  2EPA A;  2M9A A;  5AAS A;  5A78 A;  1N34 E;  3P1X A;  4MLV A;  1O0W A;  2N3H A;  3C6K A;  2K4V A;  4R2Q A;  2I3P A;  4B3T E;  2LUP B;  1EH7 A;  3MSW A;  4D6O A;  1T4N A;  2VE7 C;  2YTG A;  2YT4 A;  2YWQ A;  4O1S A;  4UNB A;  2JOX A;  2VQE E;  1GPP A;  4JI5 E;  4B3S E;  2A25 A;  2MC5 A;  3BID A;  5LLQ A;  4O24 A;  4DV2 E;  4BHB A;  2EN6 A;  4J8Z A;  4JI4 E;  2ODR C;  4OZ6 A;  3NZM A;  4GEQ B;  2EMC A;  4UN8 G;  2FLD A;  4LF9 E;  1PJT A;  5TSE A;  2LV2 A;  2EX5 A;  3OML A;  2IN8 A;  3VK6 A;  1G2F C;  4DR7 E;  5AC4 A;  4BMJ A;  2I13 A;  3MXB B;  4LFA E;  2HC5 A;  2EMW A;  2RS6 A;  2M4I A;  1YSA C;  4GKJ E;  5KL6 A;  2G7H A;  4M30 A;  2JPA A;  1EH8 A;  2JR1 A;  3KWR A;  1DFA A;  4UN7 G;  1X48 A;  2AB5 A;  3H09 A;  5IV8 B;  1I94 E;  1ZBT A;  2DRP A;  4GKK E;  2VBN B;  3UVF A;  1T38 A;  1WHN A;  4R2A A;  2EPO A;  2EMB A;  1T39 A;  2UUA E;  1N3E A;  3MIS A;  3IWB A;  4ZYD A;  3ADI A;  4JYA E;  4YY3 E;  1ZU1 A;  2EOM A;  2EM7 A;  5A6K A;  5LL6 R;  2EOQ A;  4Z20 A;  2LO3 A;  3QG5 C;  5E67 A;  3FIG A;  3MXA A;  2EMH A;  2IMZ A;  1TN9 A;  2HJJ A;  3MXB A;  5AE1 A;  4DUZ E;  4K0K E;  2KHX A;  2VBJ B;  3T1H E;  1XNR E;  4UNA A;  2EOJ A;  5KL2 A;  4D6N A;  4HEI A;  1FKA E;  2JMZ A;  4Q35 B;  5T6J A;  4AAG A;  2YZT A;  2YTN A;  4MLQ A;  2ENA A;  1T9I A;  2VBO B;  1YPN A;  3JTZ A;  4AQY E;  2CW7 A;  3MHS C;  2DIX A;  4B3M E;  1ZDE A;  2EJ4 A;  4ZYH A;  2R76 A;  2YTF A;  4BS9 A;  1MOW A;  2YRK A;  3C0X A;  2EOF A;  1A1F A;  2FTX B;  3DJW A;  2L3C A;  1A1G A;  5E5S A;  1HNZ E;  1L4S A;  2O7M A;  2EMZ A;  1X5W A;  2JOB A;  1YZ9 A;  2VS7 A;  5A2Q C;  4Q28 A;  1G9Z A;  4L5N C;  1AM2 A;  2DMY A;  2IN0 A;  1N36 E;  4R8O A;  2EOY A;  2B3T B;  2EN7 A;  2YTJ A;  1X6F A;  4R2C A;  3IGD A;  1PJS A;  4M9V C;  3UK3 C;  1G2D C;  3BGH A;  2D9H A;  2I9I A;  5DNY A;  1IMU A;  4O43 A;  2V88 A;  4HTG A;  2R1F A;  2YSP A;  3KO2 A;  4AAF A;  4AQX A;  1N3F A;  1BP7 A;  2I3Q A;  4DMI A;  2LMZ A;  2ELZ A;  3EPL A;  2EL5 A;  2DCH X;  4BBY A;  4BC9 A;  2VQF E;  2EML A;  2EM2 A;  5A74 A;  2WBU A;  1J5E E;  1DQ3 A;  4WXD A;  2VRD A;  1IBL E;  1EKZ A;  4R2R A;  3HYI A;  4JI3 E;  2F4V E;  4DUY E;  2DSY A;  2XE0 A;  2JYA A;  1T9J A;  1AH5 A;  4M2Z A;  1PJQ A;  1XMQ E;  3KZZ A;  2EPP A;  2RTX A;  4LF7 E;  3HPS A;  3HQ1 A;  2EM5 A;  2EPX A;  4KZS A;  4TUG A;  2ENC A;  3J7Y p;  2YTD A;  3ADJ A;  1X47 A;  4R2P A;  4WYQ B;  2EPN A;  4BCA A;  4DV5 E;  2LTR A;  2V85 A;  1X6E A;  4LF5 E;  3C0W A;  2YRM A;  2CT1 A;  4P7D A;  2MDG A;  4F9C B;  2NUE A;  5AE2 A;  2E1M A;  1AF5 A;  2EOX A;  2IHR 1;  4UNC A;  4Z1X A;  4WSG A;  1A1I A;  2WCC 3;  3C4B A;  1TF6 A;  4JI2 E;  1BBG A;  4WXC A;  2E72 A;  2RQL A;  4O5G A;  5A0M A;  5IWA E;  3T1Y E;  2L2N A;  3K6Q A;  2EQ1 A;  2VBL B;  2EMA A;  1QNT A;  4WSP A;  1RMD A;  4X66 E;  1JK2 A;  1TF3 A;  1XMO E;  4OOG C;  1J26 A;  2F4L A;  4LF8 E;  2CPN A;  2MC6 A;  4DV6 E;  3JU0 A;  2WBS A;  4ZYG A;  2HHH E;  3ADG A;  3IWC A;  1Z1B A;  4YHX A;  2V89 A;  2EPC A;  2L33 A;  1UBD C;  2EZ6 A;  3AUZ A;  2LRS A;  4M0V A;  4DV1 E;  2EMG A;  5AK9 A;  2DB2 A;  4NXM E;  4AAB A;  1IBM E;  4TUI A;  1PKP A;  4JV5 E;  2LJH A;  5A69 A;  1BBO A;  1KJK A;  2L8L A;  2YSO A;  4DV3 E;  4KHP E;  4LQ0 A;  2EPU A;  1NEI A;  2EP3 A;  2UUB E;  1EH6 A;  1A1H A;  1MGT A;  1R7M A;  2JWO A;  4DV0 E;  4F6M A;  1IBK E;  3RMP A;  4WX9 A;  4AAD A;  1HNX E;  2EPR A;  1ZD7 A;  2GPI A;  3QQY A;  2EE8 A;  4RH8 A;  2N3G A;  1B69 A;  5A6B A;  2EM4 A;  2K7I A;  1U0C A;  3OTO E;  1WXR A;  2NAB A;  4DV4 E;  1ZAA C;  3OOR A;  2LWY A;  1N33 E;  4X65 E;  2ADR A;  4IJD A;  2NA2 A;  4KL5 A;  2BBG A;  2H36 X;  3VHT B;  3M99 B;  5A6J A;  2EPK X;  2V8Q B;  2ZM6 E;  3FD2 A;  3EH8 A;  1UIL A;  3L00 A;  4DR1 E;  2EN2 A;  2LUQ A;  5A72 A;  3J7A G;  2DGC A;  1RC7 A;  4JI7 E;  2MKD A;  2UXD E;  4JI6 E;  1SFE A;  2EPZ A;  1RQ0 A;  3KZY A;  2EL4 A;  2EWL A;  2EMI A;  4X62 E;  4OX9 E;  4UN9 G;  3BBG A;  1MI8 A;  1AAY A;  4LFC E;  2L3J A;  1NCS A;  3MX9 A;  1AT0 A;  1UHZ A;  1DGC A;  2EQ3 A;  2FV4 B;  4DR4 E;  2VBO A;  3LLH A;  4O4K A;  4BC7 A;  4LOX A;  4R2S A;  2YTE A;  2EN3 A;  4X64 E;  4LTY A;  4F9B B;  5KL5 A;  2L8T A;  2LE2 A;  3J80 C;  2J7J A;  1X3C A;  5ADZ A;  2EPL X;  1U0D A;  3AV0 A;  2E5L E;  1YYO A;  1YFH A;  1STU A;  3THO B;  2L6M A;  3MIP A;  3E54 A;  3R7P A;  1WJP A;  2YTO A;  1LLM C;  3EPH A;  1BB8 A;  1VDE A;  4LF6 E;  2JNQ A;  2UUC E;  2EN1 A;  4RHB B;  2BB8 A;  1GTK A;  4NZV A;  3LML A;  2YRH A;  1UM2 A;  1DI2 A;  2YU5 A;  2YTQ A;  1GQE A;  2EN8 A;  4E2U A;  2PRT A;  3EPJ A;  4X9J A;  1M5X A;  2IN9 A;  2EPM X;  4UT0 A;  1N3G A;  4DR3 E;  2LJU A;  2EOZ A;  1X6H A;  2CTD A;  4F2J C;  1JVA A;  4JI8 E;  3J81 C;  1P47 A;  2EM9 A;  4P78 A;  4WPY A;  1WRJ A;  2F8B A;  4DR2 E;  2KEQ A;  5AKM A;  1N32 E;  3IFJ A;  5A0W A;  1ZR9 A;  3ZOQ B;  2LQM A;  4WFT A;  2LT7 A;  4AAE A;  2EOH A;  3C6M A;  2JY9 A;  5IT9 C;  2YTP A; 
#chains in the Genus database with same CATH homology
 1QU6 A;  4O1R A;  1YYW A;  2UXB E;  4UN9 A;  5LMU E;  2B9D A;  4DR5 E;  4YIS A;  5I0A A;  3VYY A;  2V86 A;  3F6G A;  3VYX A;  5FLX C;  4DKK A;  1HR0 E;  4GIG A;  4YHH E;  1LWT A;  4JI0 E;  2L2K B;  5AKF A;  5E5O A;  2RSM A;  4JI1 E;  2B7T A;  5F3W A;  1SR9 A;  3HXL A;  1XNQ E;  4B3R E;  4DR6 E;  2MDR A;  2LBS B;  1WHQ A;  2VBL A;  4I8O A;  2KON A;  3HTX A;  5A0M B;  2UXC E;  2XE0 B;  3OOL A;  3C4T A;  2RS7 A;  5A77 A;  2M7Q A;  3DF6 A;  2LTS A;  3ADL A;  3HPZ A;  5K08 A;  4LF4 E;  1GZ6 A;  4NXN E;  2JVA A;  2FGG A;  3JAM C;  1EF0 A;  2LCJ A;  2KOU A;  4EFJ A;  2VS8 A;  2VBJ A;  2VF1 A;  4LU9 A;  2UU9 E;  4KL6 A;  2NUF A;  2NUG A;  2B7V A;  4YIT A;  1YYK A;  5E63 A;  4DV7 E;  4R03 A;  4LFB E;  5AKN A;  1ZBQ A;  2V87 A;  3F6H A;  4L8N A;  1X49 A;  2L2M A;  5AE3 A;  2WZO A;  4E2T A;  2VBN A;  1T4L B;  4Z1Z A;  5CFF E;  1FJG E;  2CW8 A;  1P8K Z;  5BR8 E;  4UN7 A;  1T4O A;  2ODR D;  1B24 A;  1HNW E;  1LWS A;  2V83 A;  3HYJ A;  4UN8 A;  4AQU A;  4F9A B;  5LMN E;  2M1S A;  2L92 A;  4F54 A;  3IWD A;  2QOJ Z;  1G9Y A;  4X8W A;  5AAS A;  5A78 A;  1N34 E;  3P1X A;  1O0W A;  2N3H A;  2K4V A;  2I3P A;  4B3T E;  2LUP B;  3MSW A;  4D6O A;  1T4N A;  2VE7 C;  2YT4 A;  4O1S A;  4UNB A;  2JOX A;  2VQE E;  1GPP A;  4JI5 E;  4B3S E;  2MC5 A;  4DV2 E;  4J8Z A;  4JI4 E;  2ODR C;  4OZ6 A;  3NZM A;  4GEQ B;  4UN8 G;  2FLD A;  4LF9 E;  2EX5 A;  3OML A;  2IN8 A;  3VK6 A;  4DR7 E;  4BMJ A;  3MXB B;  4LFA E;  2RS6 A;  2M4I A;  4GKJ E;  2G7H A;  4M30 A;  2JR1 A;  3KWR A;  1DFA A;  4UN7 G;  1X48 A;  2AB5 A;  3H09 A;  1I94 E;  1ZBT A;  4GKK E;  2VBN B;  3UVF A;  1WHN A;  2UUA E;  1N3E A;  3MIS A;  3IWB A;  3ADI A;  4JYA E;  4YY3 E;  5LL6 R;  4Z20 A;  5E67 A;  3FIG A;  3MXA A;  2IMZ A;  5AE1 A;  3MXB A;  4K0K E;  4DUZ E;  2KHX A;  2VBJ B;  3T1H E;  1XNR E;  4UNA A;  4D6N A;  1FKA E;  2JMZ A;  5T6J A;  4AAG A;  2YZT A;  1T9I A;  2VBO B;  4AQY E;  3JTZ A;  2CW7 A;  2DIX A;  4B3M E;  1ZDE A;  4BS9 A;  1MOW A;  3C0X A;  2FTX B;  3DJW A;  2L3C A;  5E5S A;  1HNZ E;  2O7M A;  2JOB A;  1YZ9 A;  2VS7 A;  5A2Q C;  4Q28 A;  1G9Z A;  4L5N C;  1AM2 A;  2DMY A;  2IN0 A;  1N36 E;  4R8O A;  2B3T B;  3IGD A;  5DNY A;  2V88 A;  3KO2 A;  4AAF A;  4AQX A;  1N3F A;  1BP7 A;  2I3Q A;  4DMI A;  2LMZ A;  2DCH X;  4BBY A;  4BC9 A;  2VQF E;  5A74 A;  1J5E E;  1DQ3 A;  1IBL E;  1EKZ A;  3HYI A;  4JI3 E;  2F4V E;  4DUY E;  2DSY A;  2XE0 A;  1T9J A;  4M2Z A;  1XMQ E;  2RTX A;  4LF7 E;  3HPS A;  3HQ1 A;  4KZS A;  4TUG A;  3J7Y p;  3ADJ A;  1X47 A;  4WYQ B;  4BCA A;  4DV5 E;  2LTR A;  2V85 A;  4LF5 E;  3C0W A;  4P7D A;  4F9C B;  2NUE A;  5AE2 A;  2E1M A;  1AF5 A;  2IHR 1;  4UNC A;  4Z1X A;  3C4B A;  4JI2 E;  5IWA E;  5A0M A;  3T1Y E;  2L2N A;  3K6Q A;  2VBL B;  4WSP A;  4X66 E;  1XMO E;  4OOG C;  1J26 A;  4LF8 E;  2CPN A;  2MC6 A;  4DV6 E;  3JU0 A;  2HHH E;  3ADG A;  3IWC A;  4YHX A;  2V89 A;  2L33 A;  2EZ6 A;  3AUZ A;  2LRS A;  4M0V A;  4DV1 E;  5AK9 A;  2DB2 A;  4NXM E;  4AAB A;  1IBM E;  4TUI A;  1PKP A;  4JV5 E;  2LJH A;  2L8L A;  4DV3 E;  4KHP E;  4LQ0 A;  2UUB E;  1R7M A;  2JWO A;  4DV0 E;  1IBK E;  3RMP A;  4AAD A;  1HNX E;  1ZD7 A;  3QQY A;  2N3G A;  1U0C A;  3OTO E;  1WXR A;  4DV4 E;  3OOR A;  2LWY A;  1N33 E;  4X65 E;  2NA2 A;  4KL5 A;  2H36 X;  2V8Q B;  2ZM6 E;  3FD2 A;  3EH8 A;  1UIL A;  4DR1 E;  2LUQ A;  5A72 A;  3J7A G;  1RC7 A;  4JI7 E;  2UXD E;  4JI6 E;  1RQ0 A;  2EWL A;  4X62 E;  4OX9 E;  4UN9 G;  1MI8 A;  4LFC E;  2L3J A;  3MX9 A;  1AT0 A;  1UHZ A;  2FV4 B;  4DR4 E;  2VBO A;  3LLH A;  4BC7 A;  4LOX A;  4X64 E;  4LTY A;  4F9B B;  2L8T A;  2LE2 A;  3J80 C;  5ADZ A;  1U0D A;  3AV0 A;  2E5L E;  1YYO A;  1STU A;  3MIP A;  3E54 A;  3R7P A;  2L6M A;  1VDE A;  4LF6 E;  2JNQ A;  2UUC E;  3LML A;  1UM2 A;  1DI2 A;  1GQE A;  4E2U A;  1M5X A;  2IN9 A;  4UT0 A;  4DR3 E;  1JVA A;  4JI8 E;  3J81 C;  4P78 A;  4WPY A;  2F8B A;  4DR2 E;  2KEQ A;  5AKM A;  1N32 E;  3IFJ A;  5A0W A;  3ZOQ B;  2LQM A;  4WFT A;  4AAE A;  2JY9 A;  5IT9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...