1DQ3A

Crystal structure of an archaeal intein-encoded homing endonuclease pi-pfui
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
454
structure length
454
Chain Sequence
b'CIDGKAKIIFENEGEEHLTTMEEMYERYKHLGEFYDEEYNRWGIDVSNVPIYVKSFDPESKRVVKGKVNVIWKYELGKDVTKYEIITNKGTKILTSPWHPFFVLTPDFKIVEKRADELKEGDILIGGMPDGEDYKFIFDYWLAGFIAGDGCFDKYHSHVKGHEYIYDRLRIYDYRIETFEIINDYLEKTFGRKYSIQKDRNIYYIDIKARNITSHYLKLLEGIDNGIPPQILKEGKNAVLSFIAGLFDAEGHVSNKPGIELGMVNKRLIEDVTHYLNALGIKARIREKLRKDGIDYVLHVEEYSSLLRFYELIGKNLQNEEKREKLEKVLSNHKGGNFGLPLNFNAFKEWASEYGVEFKTNGSQTIAIINDERISLGQWHTRNRVSKAVLVKMLRKLYEATKDEEVKRMLHLIEGLEVVRHITTTNEPRTFYDLTVENYQNYLAGENGMIFVHN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDONUCLEASE
publication title Crystal structure of an archaeal intein-encoded homing endonuclease PI-PfuI.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 138
structure length 454
sequence length 454
ec nomenclature ec 1.17.4.1: Ribonucleoside-diphosphate reductase.
pdb deposition date 1999-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09061 Stirrup Stirrup
A PF09062 Endonuc_subdom PI-PfuI Endonuclease subdomain
A PF14528 LAGLIDADG_3 LAGLIDADG-like domain
A PF14890 Intein_splicing Intein splicing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.16.10 Mainly Beta Beta Complex Endonuclease - Pi-scei; Chain A, domain 1 Hedgehog/Intein (Hint) domain 1dq3A01
3.10.28.10 Alpha Beta Roll Endonuclease I-creI Homing endonucleases 1dq3A04
3.10.28.10 Alpha Beta Roll Endonuclease I-creI Homing endonucleases 1dq3A03
3.30.160.90 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1dq3A02
3FD2A 3NZMA 1UM2A 1AF5A 3OOLA 3MIPA 5A0MB 1R7MA 4UNAA 1U0DA 2VBJA 4GIGA 2AB5A 4UNBA 1MOWA 4YHXA 2LQMA 2VS7A 3C0WA 4EFJA 4LOXA 5K08A 4D6NA 5A74A 2VBJB 1LWTA 2VBOA 1N3EA 2IN9A 1G9YA 4O1RA 1DFAA 1LWSA 4UN8G 4LQ0A 4AABA 1ZDEA 4YITA 4AAEA 5AKNA 2VBLA 2LCJA 5AKFA 4KL6A 5I0AA 4UN8A 5A77A 1VDEA 4UN7G 1G9ZA 1T9IA 5A78A 5E5SA 2CW8A 3IGDA 5E67A 1JVAA 4OZ6A 4UN7A 3MX9A 4UN9G 2IN0A 2I3PA 1GPPA 4UNCA 4E2UA 4Z1XA 4AAFA 4UN9A 1ZD7A 3C0XA 3QQYA 4YISA 1AM2A 1U0CA 2FLDA 2IN8A 2O7MA 3MISA 4D6OA 4KL5A 3MXBA 3UVFA 1MI8A 1T9JA 1BP7A 2IMZA 2VBOB 1P8KZ 4O1SA 5A72A 4AQXA 2XE0A 2CW7A 2VBLB 3MXAA 3KO2A 2LWYA 5A0WA 1N3FA 2JMZA 4Z1ZA 4UT0A 3R7PA 1M5XA 3HYIA 2JNQA 3HYJA 4E2TA 2XE0B 5AKMA 5E63A 4Z20A 1DQ3A 2VS8A 5E5OA 3EH8A 3E54A 1AT0A 2I3QA 4AADA 2DCHX 2VBNA 3OORA 4AQUA 2KEQA 4AAGA 5AK9A 5A0MA 2EX5A 2L8LA 3MXBB 3IFJA 2VBNB 1EF0A 1B24A 2QOJZ
chains in the Genus database with same CATH superfamily
4GKJE 3FD2A 1AF5A 1HNZE 3OOLA 2CPNA 5LL6R 3ADLA 2YSPA 4WSPA 4KHPE 2EM4A 2EQ3A 2Q8UA 3J80C 1NEIA 2VBJA 2R1FA 5A6BD 2EM0A 3KWRA 4GIGA 3HQ1A 4BMJA 4B3TE 1MOWA 4TUGA 4F6NA 4GEQB 3J81C 3C0WA 4X65E 2NUEA 3L00A 1BB8A 1STUA 2EPKX 2YU8A 5DNYA 1LWTA 2VBOA 1N3EA 2IN9A 1G9YA 4JYAE 5A6KA 1TN9A 2EPOA 4R2RA 3HTXA 4AAEA 4P7DA 4O5GA 4F6MA 4LF6E 2V8QB 2M4IA 1VDEA 4UN7G 2FV4B 2DSYA 4WYQB 1G9ZA 1KYQA 2HHHE 5E5SA 1JVAA 4R2EA 3MX9A 5F3WA 2LJUA 1B69A 2EPAA 2YTPA 2YRMA 4BC7A 4B3SE 4Z1XA 4AAFA 4R2PA 1YUIA 4R2SA 2RPCA 2LT7A 2JP9A 1J26A 2EN3A 4F9BB 1ZD7A 4O43A 4YISA 1AM2A 4QFQA 1GQEA 3IWBA 2ELZA 2GLIA 5AC5A 4RH8A 4D6OA 2BBGA 5KL3A 2EL6A 4M2ZA 2I13A 1T4NA 4L8NA 2V87A 1T9JA 1YZ9A 3BGHA 1X48A 2YWQA 3OMLA 1YFHA 2N3HA 1I94E 2XE0A 1MGTA 2RSMA 5A2QC 2VBLB 4F54A 2DLKA 1WJPA 2L92A 2EN2A 2LWYA 4NHRA 4BC9A 4LF5E 2JY9A 5IXMB 2JMZA 4DR4E 4Z1ZA 2M9AA 3VK6A 5KL6A 1WHNA 4WXCA 2EQ1A 2JNQA 2GPIA 4LF7E 2L3JA 1ZU1A 2MDGA 1WXRA 1DQ3A 2FGGA 5E5OA 2DGCA 4AADA 2ENHA 2VBNA 2KEQA 4DV4E 4AAGA 2EMZA 2L2MA 1IBME 2ADRA 2BB8A 3BIDA 4IS1C 3MXBB 4LF9E 2UXBE 2EPZA 2RSIA 2QOJZ 4LF8E 3UK3C 3NZMA 4X9JA 4DKKA 1XNRE 1FJGE 2G7HA 5A0MB 4Q35B 2EMWA 2EM2A 4UNBA 4X62E 1IQOA 2LRSA 2EMKA 2EM6A 1WRJA 2EPPA 4HTGA 3MHSC 2EM7A 4EFJA 2YRHA 3J7AG 4LOXA 2DMYA 4D6NA 2VBJB 4F2JC 1BBGA 1N3GA 1DFAA 1LWSA 2ELYA 4LQ0A 2L33A 4WFTA 5LMNE 2V88A 5AKNA 2YTFA 2JPAA 2EOEA 2YTEA 4ZYEA 2EOJA 1A1KA 2L2KB 1RQ0A 4R2AA 4AQYE 2EM8A 3K6QA 2EOQA 5A78A 4DV5E 4B3RE 2DLQA 5E67A 4M9VC 1DI2A 1KJKA 2EN8A 2I3PA 1PKPA 3ECRA 1GPPA 4TUIA 2HC5A 2CTDA 4UNCA 4E2UA 2VQEE 4LFAE 2F4VE 1PDAA 1PJQA 3C0XA 3QQYA 4WSGA 3C4TA 1ZBQA 4O24A 2JXPA 4F9CB 2KHXA 4R2CA 3THNA 3MISA 2K4VA 1PJSA 3MHHC 4DV2E 2EPNA 2H36X 2LJHA 4R03A 2K7IA 2EOIA 3JAMC 2EMAA 2IMZA 5KL7A 1A1JA 2MDRA 2GHFA 4WPYA 1T39A 2VF1A 3QG5C 3M99B 2EPLX 2J7JA 4F9AB 1N32E 2CW7A 1GZ6A 4Q28A 1FKAE 2YTGA 2M1SA 4DV7E 2D9HA 1ZAAC 2L6MA 2MC5A 2EN6A 4ZYDA 1IBKE 1AAYA 4DR6E 3R7PA 2EM3A 4LFCE 3THOB 1HNWE 3HYJA 1MEYC 4E2TA 4WX9A 2XE0B 5AKMA 2KOUA 2EOYA 2YTJA 5E63A 4J8ZA 3EH8A 2LTSA 4JV5E 2YZTA 1AT0A 2CSHA 5BR8E 2ENAA 2DCHX 2NA2A 2L2NA 1UILA 4AQUA 1X3CA 4KWYA 5AK9A 2LCEA 2EE8A 1A1LA 2M7QA 2NUGA 1PJTA 3ADJA 3BF2A 4DMIA 1UBDC 4R2QA 1SR9A 5AE2A 2VBNB 1EF0A 2DIXA 2VQFE 4P78A 1HR0E 4ZYGA 4R2DA 3MIPA 2VRDA 1XNQE 1R7MA 4UNAA 2EOFA 2EJ4A 2NUFA 4I8OA 5A69A 2WBUA 1G2FC 3F6GA 1N34E 1BBOA 2AB5A 2EOXA 2EPCA 2WCC3 1L4SA 3VYXA 2L8TA 5A74A 5A6AA 4B3ME 2EPXA 1X6HA 1Z1BA 1YYKA 1AH5A 2WZOA 2V86A 1A1HA 4AABA 4LU9A 3P1XA 1N33E 2EN1A 2VBLA 2LCJA 3ADIA 4KL6A 4UN8A 2LMZA 5AE1A 3LLHA 5FLXC 2DMIA 1T9IA 4JI1E 2YPNA 4BBYA 2WBSA 4JI5E 3IGDA 1X5WA 2DRPA 4OZ6A 5AASA 3HPSA 4M30A 4JI8E 5KL2A 4DR3E 2EORA 1EKZA 2UUCE 2HGHA 1RMDA 4O4KA 2YU5A 4DR1E 2EM5A 4YHHE 2EMIA 3HPZA 4WXDA 1XMQE 2YTDA 4UN9A 2RQLA 1UHZA 5A6JA 2F8BA 3MSWA 4GKKE 4OOGC 1U0CA 3IWDA 2V85A 2FLDA 1ZR9A 2R76A 3LMLA 4LF4E 1YYOA 4DUYE 2EOHA 2V83A 3ADGA 4DR5E 2E1MA 4R8OA 2EZ6A 2EL5A 2N3GA 5AC4A 3MXBA 3UVFA 2IHR1 2LO3A 2B7VA 1MI8A 1BP7A 2UU9E 1HNXE 2VBOB 4O1SA 5A72A 2UXCE 3DJWA 2YTQA 1X6EA 2UXDE 4DV3E 3MXAA 1YYWA 2EQ0A 5A0WA 2N8XA 1X49A 1EH7A 1F2IG 3VYYA 1A1GA 2LV2A 2EN7A 1JK2A 2LUQA 4LFBE 4X66E 4ZYHA 1IMUA 4Z20A 1J5EE 2EOSA 2JR1A 2VS8A 3E54A 3C6KA 2A25A 1YSAC 4KZSA 4JI3E 4DV6E 2ODRC 5ADZA 3OORA 3AV0A 2CT1A 3DF6A 3EQ1A 2B9DA 4BS9A 2EX5A 5T6JA 1LLMC 1IBLE 2ZM6E 3JU0A 1RC7A 1G2DC 1WHQA 2ODRD 4LTYA 1YUJA 4DR7E 5IV8B 3VHTB 4NZVA 2NABA 1X47A 1X6FA 2DB2A 1UM2A 2EPMX 1JK1A 2B3TB 2VE7C 4GZNC 2JOXA 2MKNA 1U0DA 4DV1E 4RHBB 3T1YE 1NCSA 2EMFA 4N4RB 1O0WA 4YHXA 2LQMA 2E72A 2VS7A 2LUPB 2EMYA 3FIGA 5K08A 2EOZA 1QNTA 2MC6A 2MKDA 2UUBE 3KZZA 4O1RA 2EWLA 4DV0E 4OX9E 4UN8G 2YTOA 3KZYA 1ZDEA 4YITA 1T4LB 2LVHA 3HXLA 1EH6A 2UUAE 2JWOA 5AKFA 5I0AA 1YPNA 5A77A 2FTXB 3JTZA 5LMUE 2LTRA 4DR2E 3AUZA 3EPLA 2YT4A 3TQMA 2CW8A 4UN7A 5KL5A 4NXNE 4JI6E 2EL4A 4UN9G 3J7Yp 2YSOA 2IN0A 2EMBA 1N36E 2E5LE 2RS7A 4M0VA 2YTNA 2EN4A 4HEIA 2F4LA 2EMHA 5LLQA 2RS6A 5TSEA 4BHBA 5A6BA 4X64E 2WBTA 1A1FA 4JI4E 2KONA 3EPHA 2IN8A 4L5NC 2O7MA 2YRKA 2L3CA 4BHCA 2JVAA 4IJDA 5CFFE 1P47A 4KL5A 2EPRA 1IQSA 1SFEA 2PRTA 4MLVA 3EPJA 4JI7E 2V89A 2EPUA 1P8KZ 1QU6A 4AQXA 1DGCA 1TF3A 2EMCA 2ENCA 5IWAE 2EOMA 2EOOA 2LE2A 3KO2A 2JYAA 1N3FA 2LBSB 1GTKA 2EP3A 4UT0A 2JOBA 3OTOE 1M5XA 3HYIA 3H09A 2EMXA 3BBGA 5KL4A 2RTXA 3IWCA 3EPKA 2I9IA 1A1IA 1ZBTA 4LX3A 1T38A 3F6HA 4NXME 2I3QA 5IT9C 2B7TA 3ZOQB 2HJJA 1EH8A 4BCAA 4YY3E 4X8WA 3C6MA 5AE3A 4JI2E 2EM9A 1XMOE 5A0MA 3T1HE 4FK5C 4DUZE 2L8LA 4MLQA 1TF6A 1T4OA 2EMLA 4JI0E 2EMGA 1UN6B 3IFJA 3C4BA 3RMPA 1B24A 4K0KE 2YTIA
chains in the Genus database with same CATH topology
4GKJE 3FD2A 1AF5A 1HNZE 3OOLA 2CPNA 5LL6R 3ADLA 4WSPA 4KHPE 3J80C 2VBJA 3KWRA 4GIGA 3HQ1A 4BMJA 4B3TE 1MOWA 4TUGA 4GEQB 3J81C 3C0WA 4X65E 2NUEA 1STUA 5DNYA 1LWTA 2VBOA 1N3EA 2IN9A 1G9YA 4JYAE 3HTXA 4AAEA 4P7DA 4LF6E 2V8QB 2M4IA 1VDEA 4UN7G 2FV4B 2DSYA 4WYQB 1G9ZA 2HHHE 5E5SA 1JVAA 3MX9A 5F3WA 4B3SE 4BC7A 4Z1XA 4AAFA 1J26A 4F9BB 1ZD7A 4YISA 1AM2A 1GQEA 3IWBA 4D6OA 4M2ZA 1T4NA 4L8NA 2V87A 1T9JA 1YZ9A 1X48A 3OMLA 2N3HA 1I94E 2XE0A 2RSMA 5A2QC 2VBLB 4F54A 2L92A 2LWYA 4BC9A 4LF5E 2JY9A 2JMZA 4DR4E 4Z1ZA 3VK6A 1WHNA 2JNQA 4LF7E 2L3JA 1WXRA 1DQ3A 2FGGA 5E5OA 4AADA 2VBNA 2KEQA 4DV4E 4AAGA 2L2MA 1IBME 3MXBB 4LF9E 2UXBE 2QOJZ 4LF8E 3NZMA 4DKKA 1XNRE 1FJGE 2G7HA 5A0MB 4UNBA 4X62E 2LRSA 4EFJA 3J7AG 4LOXA 2DMYA 4D6NA 2VBJB 1DFAA 1LWSA 4LQ0A 2L33A 4WFTA 5LMNE 2V88A 5AKNA 2L2KB 1RQ0A 4AQYE 3K6QA 5A78A 4DV5E 4B3RE 5E67A 1DI2A 2I3PA 1PKPA 1GPPA 4TUIA 4UNCA 4E2UA 2VQEE 4LFAE 2F4VE 3C0XA 3QQYA 3C4TA 1ZBQA 4F9CB 2KHXA 3MISA 2K4VA 4DV2E 2H36X 2LJHA 4R03A 3JAMC 2IMZA 2MDRA 4WPYA 2VF1A 4F9AB 1N32E 2CW7A 1GZ6A 4Q28A 1FKAE 2M1SA 4DV7E 2L6MA 2MC5A 1IBKE 4DR6E 3R7PA 4LFCE 1HNWE 3HYJA 4E2TA 2XE0B 5AKMA 2KOUA 5E63A 4J8ZA 3EH8A 2LTSA 4JV5E 2YZTA 1AT0A 5BR8E 2DCHX 2NA2A 2L2NA 1UILA 4AQUA 5AK9A 2M7QA 2NUGA 3ADJA 4DMIA 1SR9A 5AE2A 2VBNB 1EF0A 2DIXA 2VQFE 4P78A 1HR0E 3MIPA 1XNQE 1R7MA 4UNAA 2NUFA 4I8OA 3F6GA 1N34E 2AB5A 3VYXA 2L8TA 5A74A 4B3ME 1YYKA 2WZOA 2V86A 4AABA 4LU9A 3P1XA 1N33E 2VBLA 2LCJA 3ADIA 4KL6A 4UN8A 2LMZA 5AE1A 3LLHA 5FLXC 1T9IA 4JI1E 4BBYA 4JI5E 3IGDA 4OZ6A 5AASA 3HPSA 4M30A 4JI8E 4DR3E 1EKZA 2UUCE 4DR1E 4YHHE 3HPZA 1XMQE 4UN9A 1UHZA 2F8BA 3MSWA 4GKKE 4OOGC 1U0CA 3IWDA 2V85A 2FLDA 3LMLA 4LF4E 1YYOA 4DUYE 2V83A 4DR5E 3ADGA 2E1MA 4R8OA 2EZ6A 2N3GA 3MXBA 3UVFA 2IHR1 2B7VA 1MI8A 1BP7A 2UU9E 1HNXE 2VBOB 4O1SA 5A72A 2UXCE 3DJWA 2UXDE 4DV3E 3MXAA 1YYWA 5A0WA 1X49A 3VYYA 2LUQA 4LFBE 4X66E 4Z20A 1J5EE 2VS8A 2JR1A 3E54A 4KZSA 4JI3E 4DV6E 2ODRC 5ADZA 3OORA 3AV0A 3DF6A 2B9DA 4BS9A 2EX5A 5T6JA 1IBLE 2ZM6E 3JU0A 1RC7A 1WHQA 2ODRD 4LTYA 4DR7E 1X47A 2DB2A 1UM2A 2B3TB 2VE7C 2JOXA 1U0DA 4DV1E 3T1YE 1O0WA 4YHXA 2LQMA 2VS7A 2LUPB 3FIGA 5K08A 2MC6A 2UUBE 4DV0E 4O1RA 2EWLA 4OX9E 4UN8G 1ZDEA 4YITA 1T4LB 3HXLA 2UUAE 2JWOA 5AKFA 5I0AA 5A77A 2FTXB 3JTZA 5LMUE 2LTRA 4DR2E 3AUZA 2YT4A 2CW8A 4UN7A 4NXNE 4JI6E 3J7Yp 4UN9G 2IN0A 1N36E 2E5LE 2RS7A 4M0VA 2RS6A 4X64E 4JI4E 2KONA 2IN8A 4L5NC 2O7MA 2L3CA 2JVAA 5CFFE 4KL5A 4JI7E 2V89A 1P8KZ 1QU6A 4AQXA 5IWAE 2LE2A 3KO2A 1N3FA 2LBSB 4UT0A 2JOBA 3OTOE 1M5XA 3HYIA 3H09A 2RTXA 3IWCA 1ZBTA 3F6HA 4NXME 2I3QA 5IT9C 2B7TA 3ZOQB 4BCAA 4YY3E 4X8WA 5AE3A 4JI2E 1XMOE 5A0MA 3T1HE 4DUZE 2L8LA 1T4OA 4JI0E 3IFJA 3C4BA 3RMPA 1B24A 4K0KE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FD2 A;  3NZM A;  1UM2 A;  1AF5 A;  3OOL A;  3MIP A;  5A0M B;  1R7M A;  4UNA A;  1U0D A;  2VBJ A;  4GIG A;  2AB5 A;  4UNB A;  1MOW A;  4YHX A;  2LQM A;  2VS7 A;  3C0W A;  4EFJ A;  4LOX A;  5K08 A;  4D6N A;  5A74 A;  2VBJ B;  1LWT A;  2VBO A;  1N3E A;  2IN9 A;  1G9Y A;  4O1R A;  1DFA A;  1LWS A;  4UN8 G;  4LQ0 A;  4AAB A;  1ZDE A;  4YIT A;  4AAE A;  5AKN A;  2VBL A;  2LCJ A;  5AKF A;  4KL6 A;  5I0A A;  4UN8 A;  5A77 A;  1VDE A;  4UN7 G;  1G9Z A;  1T9I A;  5A78 A;  5E5S A;  2CW8 A;  3IGD A;  5E67 A;  1JVA A;  4OZ6 A;  4UN7 A;  3MX9 A;  4UN9 G;  2IN0 A;  2I3P A;  1GPP A;  4UNC A;  4E2U A;  4Z1X A;  4AAF A;  4UN9 A;  1ZD7 A;  3C0X A;  3QQY A;  4YIS A;  1AM2 A;  1U0C A;  2FLD A;  2IN8 A;  2O7M A;  3MIS A;  4D6O A;  4KL5 A;  3MXB A;  3UVF A;  1MI8 A;  1T9J A;  1BP7 A;  2IMZ A;  2VBO B;  1P8K Z;  4O1S A;  5A72 A;  4AQX A;  2XE0 A;  2CW7 A;  2VBL B;  3MXA A;  3KO2 A;  2LWY A;  5A0W A;  1N3F A;  2JMZ A;  4Z1Z A;  4UT0 A;  3R7P A;  1M5X A;  3HYI A;  2JNQ A;  3HYJ A;  4E2T A;  2XE0 B;  5AKM A;  5E63 A;  4Z20 A;  1DQ3 A;  2VS8 A;  5E5O A;  3EH8 A;  3E54 A;  1AT0 A;  2I3Q A;  4AAD A;  2DCH X;  2VBN A;  3OOR A;  4AQU A;  2KEQ A;  4AAG A;  5AK9 A;  5A0M A;  2EX5 A;  2L8L A;  3MXB B;  3IFJ A;  2VBN B;  1EF0 A;  1B24 A;  2QOJ Z; 
#chains in the Genus database with same CATH topology
 4GKJ E;  3FD2 A;  1AF5 A;  1HNZ E;  3OOL A;  2CPN A;  5LL6 R;  3ADL A;  2YSP A;  4WSP A;  4KHP E;  2EM4 A;  2EQ3 A;  2Q8U A;  3J80 C;  1NEI A;  2VBJ A;  2R1F A;  5A6B D;  2EM0 A;  3KWR A;  4GIG A;  3HQ1 A;  4BMJ A;  4B3T E;  1MOW A;  4TUG A;  4F6N A;  4GEQ B;  3J81 C;  3C0W A;  4X65 E;  2NUE A;  3L00 A;  1BB8 A;  1STU A;  2EPK X;  2YU8 A;  5DNY A;  1LWT A;  2VBO A;  1N3E A;  2IN9 A;  1G9Y A;  4JYA E;  5A6K A;  1TN9 A;  2EPO A;  4R2R A;  3HTX A;  4AAE A;  4P7D A;  4O5G A;  4F6M A;  4LF6 E;  2V8Q B;  2M4I A;  1VDE A;  4UN7 G;  2FV4 B;  2DSY A;  4WYQ B;  1G9Z A;  1KYQ A;  2HHH E;  5E5S A;  1JVA A;  4R2E A;  3MX9 A;  5F3W A;  2LJU A;  1B69 A;  2EPA A;  2YTP A;  2YRM A;  4BC7 A;  4B3S E;  4Z1X A;  4AAF A;  4R2P A;  1YUI A;  4R2S A;  2RPC A;  2LT7 A;  2JP9 A;  1J26 A;  2EN3 A;  4F9B B;  1ZD7 A;  4O43 A;  4YIS A;  1AM2 A;  4QFQ A;  1GQE A;  3IWB A;  2ELZ A;  2GLI A;  5AC5 A;  4RH8 A;  4D6O A;  2BBG A;  5KL3 A;  2EL6 A;  4M2Z A;  2I13 A;  1T4N A;  4L8N A;  2V87 A;  1T9J A;  1YZ9 A;  3BGH A;  1X48 A;  2YWQ A;  3OML A;  1YFH A;  2N3H A;  1I94 E;  2XE0 A;  1MGT A;  2RSM A;  5A2Q C;  2VBL B;  4F54 A;  2DLK A;  1WJP A;  2L92 A;  2EN2 A;  2LWY A;  4NHR A;  4BC9 A;  4LF5 E;  2JY9 A;  5IXM B;  2JMZ A;  4DR4 E;  4Z1Z A;  2M9A A;  3VK6 A;  5KL6 A;  1WHN A;  4WXC A;  2EQ1 A;  2JNQ A;  2GPI A;  4LF7 E;  2L3J A;  1ZU1 A;  2MDG A;  1WXR A;  1DQ3 A;  2FGG A;  5E5O A;  2DGC A;  4AAD A;  2ENH A;  2VBN A;  2KEQ A;  4DV4 E;  4AAG A;  2EMZ A;  2L2M A;  1IBM E;  2ADR A;  2BB8 A;  3BID A;  4IS1 C;  3MXB B;  4LF9 E;  2UXB E;  2EPZ A;  2RSI A;  2QOJ Z;  4LF8 E;  3UK3 C;  3NZM A;  4X9J A;  4DKK A;  1XNR E;  1FJG E;  2G7H A;  5A0M B;  4Q35 B;  2EMW A;  2EM2 A;  4UNB A;  4X62 E;  1IQO A;  2LRS A;  2EMK A;  2EM6 A;  1WRJ A;  2EPP A;  4HTG A;  3MHS C;  2EM7 A;  4EFJ A;  2YRH A;  3J7A G;  4LOX A;  2DMY A;  4D6N A;  2VBJ B;  4F2J C;  1BBG A;  1N3G A;  1DFA A;  1LWS A;  2ELY A;  4LQ0 A;  2L33 A;  4WFT A;  5LMN E;  2V88 A;  5AKN A;  2YTF A;  2JPA A;  2EOE A;  2YTE A;  4ZYE A;  2EOJ A;  1A1K A;  2L2K B;  1RQ0 A;  4R2A A;  4AQY E;  2EM8 A;  3K6Q A;  2EOQ A;  5A78 A;  4DV5 E;  4B3R E;  2DLQ A;  5E67 A;  4M9V C;  1DI2 A;  1KJK A;  2EN8 A;  2I3P A;  1PKP A;  3ECR A;  1GPP A;  4TUI A;  2HC5 A;  2CTD A;  4UNC A;  4E2U A;  2VQE E;  4LFA E;  2F4V E;  1PDA A;  1PJQ A;  3C0X A;  3QQY A;  4WSG A;  3C4T A;  1ZBQ A;  4O24 A;  2JXP A;  4F9C B;  2KHX A;  4R2C A;  3THN A;  3MIS A;  2K4V A;  1PJS A;  3MHH C;  4DV2 E;  2EPN A;  2H36 X;  2LJH A;  4R03 A;  2K7I A;  2EOI A;  3JAM C;  2EMA A;  2IMZ A;  5KL7 A;  1A1J A;  2MDR A;  2GHF A;  4WPY A;  1T39 A;  2VF1 A;  3QG5 C;  3M99 B;  2EPL X;  2J7J A;  4F9A B;  1N32 E;  2CW7 A;  1GZ6 A;  4Q28 A;  1FKA E;  2YTG A;  2M1S A;  4DV7 E;  2D9H A;  1ZAA C;  2L6M A;  2MC5 A;  2EN6 A;  4ZYD A;  1IBK E;  1AAY A;  4DR6 E;  3R7P A;  2EM3 A;  4LFC E;  3THO B;  1HNW E;  3HYJ A;  1MEY C;  4E2T A;  4WX9 A;  2XE0 B;  5AKM A;  2KOU A;  2EOY A;  2YTJ A;  5E63 A;  4J8Z A;  3EH8 A;  2LTS A;  4JV5 E;  2YZT A;  1AT0 A;  2CSH A;  5BR8 E;  2ENA A;  2DCH X;  2NA2 A;  2L2N A;  1UIL A;  4AQU A;  1X3C A;  4KWY A;  5AK9 A;  2LCE A;  2EE8 A;  1A1L A;  2M7Q A;  2NUG A;  1PJT A;  3ADJ A;  3BF2 A;  4DMI A;  1UBD C;  4R2Q A;  1SR9 A;  5AE2 A;  2VBN B;  1EF0 A;  2DIX A;  2VQF E;  4P78 A;  1HR0 E;  4ZYG A;  4R2D A;  3MIP A;  2VRD A;  1XNQ E;  1R7M A;  4UNA A;  2EOF A;  2EJ4 A;  2NUF A;  4I8O A;  5A69 A;  2WBU A;  1G2F C;  3F6G A;  1N34 E;  1BBO A;  2AB5 A;  2EOX A;  2EPC A;  2WCC 3;  1L4S A;  3VYX A;  2L8T A;  5A74 A;  5A6A A;  4B3M E;  2EPX A;  1X6H A;  1Z1B A;  1YYK A;  1AH5 A;  2WZO A;  2V86 A;  1A1H A;  4AAB A;  4LU9 A;  3P1X A;  1N33 E;  2EN1 A;  2VBL A;  2LCJ A;  3ADI A;  4KL6 A;  4UN8 A;  2LMZ A;  5AE1 A;  3LLH A;  5FLX C;  2DMI A;  1T9I A;  4JI1 E;  2YPN A;  4BBY A;  2WBS A;  4JI5 E;  3IGD A;  1X5W A;  2DRP A;  4OZ6 A;  5AAS A;  3HPS A;  4M30 A;  4JI8 E;  5KL2 A;  4DR3 E;  2EOR A;  1EKZ A;  2UUC E;  2HGH A;  1RMD A;  4O4K A;  2YU5 A;  4DR1 E;  2EM5 A;  4YHH E;  2EMI A;  3HPZ A;  4WXD A;  1XMQ E;  2YTD A;  4UN9 A;  2RQL A;  1UHZ A;  5A6J A;  2F8B A;  3MSW A;  4GKK E;  4OOG C;  1U0C A;  3IWD A;  2V85 A;  2FLD A;  1ZR9 A;  2R76 A;  3LML A;  4LF4 E;  1YYO A;  4DUY E;  2EOH A;  2V83 A;  3ADG A;  4DR5 E;  2E1M A;  4R8O A;  2EZ6 A;  2EL5 A;  2N3G A;  5AC4 A;  3MXB A;  3UVF A;  2IHR 1;  2LO3 A;  2B7V A;  1MI8 A;  1BP7 A;  2UU9 E;  1HNX E;  2VBO B;  4O1S A;  5A72 A;  2UXC E;  3DJW A;  2YTQ A;  1X6E A;  2UXD E;  4DV3 E;  3MXA A;  1YYW A;  2EQ0 A;  5A0W A;  2N8X A;  1X49 A;  1EH7 A;  1F2I G;  3VYY A;  1A1G A;  2LV2 A;  2EN7 A;  1JK2 A;  2LUQ A;  4LFB E;  4X66 E;  4ZYH A;  1IMU A;  4Z20 A;  1J5E E;  2EOS A;  2JR1 A;  2VS8 A;  3E54 A;  3C6K A;  2A25 A;  1YSA C;  4KZS A;  4JI3 E;  4DV6 E;  2ODR C;  5ADZ A;  3OOR A;  3AV0 A;  2CT1 A;  3DF6 A;  3EQ1 A;  2B9D A;  4BS9 A;  2EX5 A;  5T6J A;  1LLM C;  1IBL E;  2ZM6 E;  3JU0 A;  1RC7 A;  1G2D C;  1WHQ A;  2ODR D;  4LTY A;  1YUJ A;  4DR7 E;  5IV8 B;  3VHT B;  4NZV A;  2NAB A;  1X47 A;  1X6F A;  2DB2 A;  1UM2 A;  2EPM X;  1JK1 A;  2B3T B;  2VE7 C;  4GZN C;  2JOX A;  2MKN A;  1U0D A;  4DV1 E;  4RHB B;  3T1Y E;  1NCS A;  2EMF A;  4N4R B;  1O0W A;  4YHX A;  2LQM A;  2E72 A;  2VS7 A;  2LUP B;  2EMY A;  3FIG A;  5K08 A;  2EOZ A;  1QNT A;  2MC6 A;  2MKD A;  2UUB E;  3KZZ A;  4O1R A;  2EWL A;  4DV0 E;  4OX9 E;  4UN8 G;  2YTO A;  3KZY A;  1ZDE A;  4YIT A;  1T4L B;  2LVH A;  3HXL A;  1EH6 A;  2UUA E;  2JWO A;  5AKF A;  5I0A A;  1YPN A;  5A77 A;  2FTX B;  3JTZ A;  5LMU E;  2LTR A;  4DR2 E;  3AUZ A;  3EPL A;  2YT4 A;  3TQM A;  2CW8 A;  4UN7 A;  5KL5 A;  4NXN E;  4JI6 E;  2EL4 A;  4UN9 G;  3J7Y p;  2YSO A;  2IN0 A;  2EMB A;  1N36 E;  2E5L E;  2RS7 A;  4M0V A;  2YTN A;  2EN4 A;  4HEI A;  2F4L A;  2EMH A;  5LLQ A;  2RS6 A;  5TSE A;  4BHB A;  5A6B A;  4X64 E;  2WBT A;  1A1F A;  4JI4 E;  2KON A;  3EPH A;  2IN8 A;  4L5N C;  2O7M A;  2YRK A;  2L3C A;  4BHC A;  2JVA A;  4IJD A;  5CFF E;  1P47 A;  4KL5 A;  2EPR A;  1IQS A;  1SFE A;  2PRT A;  4MLV A;  3EPJ A;  4JI7 E;  2V89 A;  2EPU A;  1P8K Z;  1QU6 A;  4AQX A;  1DGC A;  1TF3 A;  2EMC A;  2ENC A;  5IWA E;  2EOM A;  2EOO A;  2LE2 A;  3KO2 A;  2JYA A;  1N3F A;  2LBS B;  1GTK A;  2EP3 A;  4UT0 A;  2JOB A;  3OTO E;  1M5X A;  3HYI A;  3H09 A;  2EMX A;  3BBG A;  5KL4 A;  2RTX A;  3IWC A;  3EPK A;  2I9I A;  1A1I A;  1ZBT A;  4LX3 A;  1T38 A;  3F6H A;  4NXM E;  2I3Q A;  5IT9 C;  2B7T A;  3ZOQ B;  2HJJ A;  1EH8 A;  4BCA A;  4YY3 E;  4X8W A;  3C6M A;  5AE3 A;  4JI2 E;  2EM9 A;  1XMO E;  5A0M A;  3T1H E;  4FK5 C;  4DUZ E;  2L8L A;  4MLQ A;  1TF6 A;  1T4O A;  2EML A;  4JI0 E;  2EMG A;  1UN6 B;  3IFJ A;  3C4B A;  3RMP A;  1B24 A;  4K0K E;  2YTI A; 
#chains in the Genus database with same CATH homology
 4GKJ E;  3FD2 A;  1AF5 A;  1HNZ E;  3OOL A;  2CPN A;  5LL6 R;  3ADL A;  4WSP A;  4KHP E;  3J80 C;  2VBJ A;  3KWR A;  4GIG A;  3HQ1 A;  4BMJ A;  4B3T E;  1MOW A;  4TUG A;  4GEQ B;  3J81 C;  3C0W A;  4X65 E;  2NUE A;  1STU A;  5DNY A;  1LWT A;  2VBO A;  1N3E A;  2IN9 A;  1G9Y A;  4JYA E;  3HTX A;  4AAE A;  4P7D A;  4LF6 E;  2V8Q B;  2M4I A;  1VDE A;  4UN7 G;  2FV4 B;  2DSY A;  4WYQ B;  1G9Z A;  2HHH E;  5E5S A;  1JVA A;  3MX9 A;  5F3W A;  4B3S E;  4BC7 A;  4Z1X A;  4AAF A;  1J26 A;  4F9B B;  1ZD7 A;  4YIS A;  1AM2 A;  1GQE A;  3IWB A;  4D6O A;  4M2Z A;  1T4N A;  4L8N A;  2V87 A;  1T9J A;  1YZ9 A;  1X48 A;  3OML A;  2N3H A;  1I94 E;  2XE0 A;  2RSM A;  5A2Q C;  2VBL B;  4F54 A;  2L92 A;  2LWY A;  4BC9 A;  4LF5 E;  2JY9 A;  2JMZ A;  4DR4 E;  4Z1Z A;  3VK6 A;  1WHN A;  2JNQ A;  4LF7 E;  2L3J A;  1WXR A;  1DQ3 A;  2FGG A;  5E5O A;  4AAD A;  2VBN A;  2KEQ A;  4DV4 E;  4AAG A;  2L2M A;  1IBM E;  3MXB B;  4LF9 E;  2UXB E;  2QOJ Z;  4LF8 E;  3NZM A;  4DKK A;  1XNR E;  1FJG E;  2G7H A;  5A0M B;  4UNB A;  4X62 E;  2LRS A;  4EFJ A;  3J7A G;  4LOX A;  2DMY A;  4D6N A;  2VBJ B;  1DFA A;  1LWS A;  4LQ0 A;  2L33 A;  4WFT A;  5LMN E;  2V88 A;  5AKN A;  2L2K B;  1RQ0 A;  4AQY E;  3K6Q A;  5A78 A;  4DV5 E;  4B3R E;  5E67 A;  1DI2 A;  2I3P A;  1PKP A;  1GPP A;  4TUI A;  4UNC A;  4E2U A;  2VQE E;  4LFA E;  2F4V E;  3C0X A;  3QQY A;  3C4T A;  1ZBQ A;  4F9C B;  2KHX A;  3MIS A;  2K4V A;  4DV2 E;  2H36 X;  2LJH A;  4R03 A;  3JAM C;  2IMZ A;  2MDR A;  4WPY A;  2VF1 A;  4F9A B;  1N32 E;  2CW7 A;  1GZ6 A;  4Q28 A;  1FKA E;  2M1S A;  4DV7 E;  2L6M A;  2MC5 A;  1IBK E;  4DR6 E;  3R7P A;  4LFC E;  1HNW E;  3HYJ A;  4E2T A;  2XE0 B;  5AKM A;  2KOU A;  5E63 A;  4J8Z A;  3EH8 A;  2LTS A;  4JV5 E;  2YZT A;  1AT0 A;  5BR8 E;  2DCH X;  2NA2 A;  2L2N A;  1UIL A;  4AQU A;  5AK9 A;  2M7Q A;  2NUG A;  3ADJ A;  4DMI A;  1SR9 A;  5AE2 A;  2VBN B;  1EF0 A;  2DIX A;  2VQF E;  4P78 A;  1HR0 E;  3MIP A;  1XNQ E;  1R7M A;  4UNA A;  2NUF A;  4I8O A;  3F6G A;  1N34 E;  2AB5 A;  3VYX A;  2L8T A;  5A74 A;  4B3M E;  1YYK A;  2WZO A;  2V86 A;  4AAB A;  4LU9 A;  3P1X A;  1N33 E;  2VBL A;  2LCJ A;  3ADI A;  4KL6 A;  4UN8 A;  2LMZ A;  5AE1 A;  3LLH A;  5FLX C;  1T9I A;  4JI1 E;  4BBY A;  4JI5 E;  3IGD A;  4OZ6 A;  5AAS A;  3HPS A;  4M30 A;  4JI8 E;  4DR3 E;  1EKZ A;  2UUC E;  4DR1 E;  4YHH E;  3HPZ A;  1XMQ E;  4UN9 A;  1UHZ A;  2F8B A;  3MSW A;  4GKK E;  4OOG C;  1U0C A;  3IWD A;  2V85 A;  2FLD A;  3LML A;  4LF4 E;  1YYO A;  4DUY E;  2V83 A;  4DR5 E;  3ADG A;  2E1M A;  4R8O A;  2EZ6 A;  2N3G A;  3MXB A;  3UVF A;  2IHR 1;  2B7V A;  1MI8 A;  1BP7 A;  2UU9 E;  1HNX E;  2VBO B;  4O1S A;  5A72 A;  2UXC E;  3DJW A;  2UXD E;  4DV3 E;  3MXA A;  1YYW A;  5A0W A;  1X49 A;  3VYY A;  2LUQ A;  4LFB E;  4X66 E;  4Z20 A;  1J5E E;  2VS8 A;  2JR1 A;  3E54 A;  4KZS A;  4JI3 E;  4DV6 E;  2ODR C;  5ADZ A;  3OOR A;  3AV0 A;  3DF6 A;  2B9D A;  4BS9 A;  2EX5 A;  5T6J A;  1IBL E;  2ZM6 E;  3JU0 A;  1RC7 A;  1WHQ A;  2ODR D;  4LTY A;  4DR7 E;  1X47 A;  2DB2 A;  1UM2 A;  2B3T B;  2VE7 C;  2JOX A;  1U0D A;  4DV1 E;  3T1Y E;  1O0W A;  4YHX A;  2LQM A;  2VS7 A;  2LUP B;  3FIG A;  5K08 A;  2MC6 A;  2UUB E;  4DV0 E;  4O1R A;  2EWL A;  4OX9 E;  4UN8 G;  1ZDE A;  4YIT A;  1T4L B;  3HXL A;  2UUA E;  2JWO A;  5AKF A;  5I0A A;  5A77 A;  2FTX B;  3JTZ A;  5LMU E;  2LTR A;  4DR2 E;  3AUZ A;  2YT4 A;  2CW8 A;  4UN7 A;  4NXN E;  4JI6 E;  3J7Y p;  4UN9 G;  2IN0 A;  1N36 E;  2E5L E;  2RS7 A;  4M0V A;  2RS6 A;  4X64 E;  4JI4 E;  2KON A;  2IN8 A;  4L5N C;  2O7M A;  2L3C A;  2JVA A;  5CFF E;  4KL5 A;  4JI7 E;  2V89 A;  1P8K Z;  1QU6 A;  4AQX A;  5IWA E;  2LE2 A;  3KO2 A;  1N3F A;  2LBS B;  4UT0 A;  2JOB A;  3OTO E;  1M5X A;  3HYI A;  3H09 A;  2RTX A;  3IWC A;  1ZBT A;  3F6H A;  4NXM E;  2I3Q A;  5IT9 C;  2B7T A;  3ZOQ B;  4BCA A;  4YY3 E;  4X8W A;  5AE3 A;  4JI2 E;  1XMO E;  5A0M A;  3T1H E;  4DUZ E;  2L8L A;  1T4O A;  4JI0 E;  3IFJ A;  3C4B A;  3RMP A;  1B24 A;  4K0K E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...