1DQ3A

Crystal structure of an archaeal intein-encoded homing endonuclease pi-pfui
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
454
structure length
454
Chain Sequence
CIDGKAKIIFENEGEEHLTTMEEMYERYKHLGEFYDEEYNRWGIDVSNVPIYVKSFDPESKRVVKGKVNVIWKYELGKDVTKYEIITNKGTKILTSPWHPFFVLTPDFKIVEKRADELKEGDILIGGMPDGEDYKFIFDYWLAGFIAGDGCFDKYHSHVKGHEYIYDRLRIYDYRIETFEIINDYLEKTFGRKYSIQKDRNIYYIDIKARNITSHYLKLLEGIDNGIPPQILKEGKNAVLSFIAGLFDAEGHVSNKPGIELGMVNKRLIEDVTHYLNALGIKARIREKLRKDGIDYVLHVEEYSSLLRFYELIGKNLQNEEKREKLEKVLSNHKGGNFGLPLNFNAFKEWASEYGVEFKTNGSQTIAIINDERISLGQWHTRNRVSKAVLVKMLRKLYEATKDEEVKRMLHLIEGLEVVRHITTTNEPRTFYDLTVENYQNYLAGENGMIFVHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDONUCLEASE
publication title Crystal structure of an archaeal intein-encoded homing endonuclease PI-PfuI.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 138
structure length 454
sequence length 454
ec nomenclature ec 1.17.4.1: Ribonucleoside-diphosphate reductase.
pdb deposition date 1999-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09061 Stirrup Stirrup
A PF09062 Endonuc_subdom PI-PfuI Endonuclease subdomain
A PF14528 LAGLIDADG_3 LAGLIDADG-like domain
A PF14890 Intein_splicing Intein splicing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.16.10 Mainly Beta Beta Complex Endonuclease - Pi-scei; Chain A, domain 1 Hedgehog/Intein (Hint) domain 1dq3A01
3.10.28.10 Alpha Beta Roll Endonuclease I-creI Homing endonucleases 1dq3A04
3.10.28.10 Alpha Beta Roll Endonuclease I-creI Homing endonucleases 1dq3A03
3.30.160.90 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1dq3A02
2XE0A 2IN8A 2LQMA 1AF5A 1LWTA 5AKFA 2KEQA 2O7MA 4AADA 4UNAA 1EF0A 4E2UA 4UN9A 1JVAA 4Z20A 4D6NA 4AAGA 1VDEA 5A0MB 2EX5A 1GPPA 4UN9G 2L8LA 3MX9A 4AABA 4UN7A 4KL6A 1MI8A 1N3EA 5A0WA 4OZ6A 5E5SA 4UN7G 1ZD7A 3KO2A 4KL5A 3MXBB 1LWSA 4Z1XA 4YITA 4O1RA 3OORA 1P8KZ 5A78A 3MISA 1R7MA 2I3QA 5A0MA 2VS8A 4AAFA 2VBLB 2IN0A 3MIPA 4YHXA 3HYIA 2DCHX 4Z1ZA 3MXAA 3C0WA 1N3FA 5I0AA 3C0XA 5AKMA 5K08A 2AB5A 4YISA 3HYJA 4LOXA 1T9JA 2IMZA 3MXBA 2CW7A 1AM2A 4O1SA 1UM2A 2VBNB 3EH8A 4UNBA 5AK9A 2VBLA 4UN8A 2VBJB 5A77A 1U0DA 2IN9A 3OOLA 4AQXA 2VBOB 1U0CA 2I3PA 1DFAA 2LWYA 3NZMA 2JMZA 4UNCA 5A72A 4UN8G 2CW8A 4UT0A 2VS7A 4GIGA 1G9ZA 4E2TA 1BP7A 4EFJA 1MOWA 3IGDA 2XE0B 2VBNA 1AT0A 1T9IA 3E54A 1DQ3A 3FD2A 3R7PA 3IFJA 1M5XA 2VBJA 5E67A 4AQUA 4AAEA 5A74A 5E5OA 3QQYA 4LQ0A 1ZDEA 2LCJA 5E63A 2VBOA 3UVFA 4D6OA 2JNQA 2QOJZ 1G9YA 1B24A 5AKNA 2FLDA
chains in the Genus database with same CATH superfamily
2IN8A 3BIDA 3C4TA 4WXDA 2YTIA 2EN6A 4O24A 4LU9A 1KJKA 1A1HA 2K4VA 4R2PA 4JI6E 2F4VE 4YHHE 4R2AA 2EQ3A 4E2UA 5AC4A 5IT9C 4Z20A 2LTRA 5A0MB 3VYYA 1IBLE 2G7HA 1GPPA 2FTXB 2EPMX 2JY9A 4MLVA 3MX9A 4AABA 4F6MA 1A1GA 3MHHC 1N3EA 3HPSA 2ENCA 1FJGE 2EM3A 1A1LA 2MDGA 2YTOA 1Z1BA 2YSPA 1G2FC 4DV0E 2KONA 1ZD7A 4NHRA 2YRKA 4NZVA 4JI1E 5ADZA 4Z1XA 4YITA 2EOHA 2UXDE 5A78A 2LCEA 2RQLA 5A0MA 2DB2A 5AC5A 4R2RA 2RSMA 2B7VA 2EMFA 4JV5E 3MIPA 4YHXA 3HYIA 4M0VA 3TQMA 1XMOE 4QFQA 2EN2A 5A6BA 5AKMA 5K08A 4P7DA 4YISA 2EMKA 1WRJA 4WSGA 3T1YE 2EPPA 4K0KE 2YRMA 2N8XA 4L5NC 2F8BA 4LOXA 3DJWA 2CW7A 1N33E 1JK2A 5LLQA 2E5LE 2JXPA 2VBNB 3DF6A 4UNBA 5AK9A 2EQ0A 1LLMC 2UUCE 3KWRA 1U0DA 2UXBE 2IN9A 2EN1A 4F9BB 2EM4A 2LWYA 4L8NA 1AAYA 4B3SE 4DV4E 5AE2A 4F54A 5A72A 2EL4A 2CW8A 2EL5A 3BBGA 2VS7A 2YTFA 5KL4A 4E2TA 4JI5E 2PRTA 2WZOA 5LMNE 4LF8E 2WCC3 3IGDA 4R8OA 2VBNA 4BMJA 4LTYA 2EMZA 1AT0A 4R2EA 2YU8A 4KWYA 1RC7A 2UU9E 2L6MA 2LJUA 1M5XA 4B3ME 4AQUA 5E67A 1F2IG 5A74A 2EPCA 1PDAA 2EZ6A 4LQ0A 2EWLA 1O0WA 3UVFA 3EPKA 3JTZA 2ENHA 2NUEA 1B69A 1G9YA 5KL7A 5LL6R 1HR0E 4KL6A 5AKNA 2BBGA 5A2QC 1IQOA 2EP3A 2GLIA 2VQFE 2JVAA 3HXLA 2MKNA 2YTQA 1AF5A 2EJ4A 2L33A 5T6JA 1YUJA 2NABA 2WBTA 1EKZA 2EM0A 2LO3A 2JOBA 5KL2A 4WXCA 1VDEA 1UILA 4LF5E 4DMIA 2EMIA 4BC9A 2L8LA 5A69A 2I13A 3MHSC 1MI8A 2YU5A 4NXNE 2EMBA 4GZNC 2JYAA 2Q8UA 4M30A 4YY3E 2YPNA 1GQEA 2CSHA 5F3WA 2JPAA 1IBME 1MGTA 1X6HA 3ADJA 3KO2A 2HGHA 2EOOA 4LF7E 3OORA 1P8KZ 3HPZA 2UUAE 2WBUA 4BBYA 1WHNA 4AAFA 4Q28A 2E1MA 1GZ6A 4DR2E 4F9AB 2V87A 2YSOA 3MXAA 2YTDA 2M7QA 2DGCA 1P47A 2EOEA 2EOSA 2M9AA 4BC7A 1YPNA 2L2MA 1SFEA 2LJHA 3F6GA 1T9JA 4I8OA 3VYXA 1T39A 2DSYA 2EOZA 4IJDA 1AM2A 1X48A 2FV4B 4R2QA 1PJSA 4X62E 2MKDA 2B3TB 4ZYHA 4B3RE 4RHBB 1N32E 3OOLA 2YTEA 2LVHA 4AQXA 3JAMC 4HTGA 1DFAA 4WSPA 4DR3E 2B7TA 4JI0E 2JMZA 1HNZE 4UNCA 2EN7A 1PJQA 1G9ZA 3EPHA 1EH6A 2EPNA 3T1HE 2RSIA 4DR4E 1BB8A 5AE1A 4JI3E 3VHTB 4F9CB 2RS6A 3LLHA 1SR9A 4O43A 2EM7A 2VRDA 1EH7A 5IXMB 3E54A 1T4OA 2V85A 4WX9A 1TF6A 3IFJA 4BS9A 2HC5A 5E5OA 2EPXA 4OOGC 2EM6A 2LCJA 3L00A 1T4NA 1X3CA 2L92A 4N4RB 3VK6A 4X64E 4D6OA 4KHPE 1X5WA 2YRHA 2JOXA 2EN3A 2FGGA 4ZYDA 1TN9A 2UUBE 1NEIA 1B24A 2ZM6E 2EMCA 2MDRA 3FIGA 3IWCA 2FLDA 5CFFE 1LWTA 1UBDC 2LRSA 2EN4A 2EOXA 4GEQB 4R2CA 2KEQA 5A6BD 1L4SA 4UNAA 2KHXA 4UN9A 4DUZE 1WHQA 2EM2A 4JYAE 4D6NA 2EOJA 2N3HA 2YTJA 3IWDA 4J8ZA 5FLXC 4X9JA 4AAGA 1AH5A 1ZBTA 4TUIA 1A1IA 1STUA 4F6NA 1A1JA 4UN9G 1BBGA 2EMAA 1IQSA 2VQEE 4GKKE 1UN6B 2EMWA 4OX9E 2LUQA 1X6EA 3KZYA 4LFBE 2RPCA 1HNWE 2EPOA 5A0WA 4JI4E 5KL3A 4DR1E 4BHCA 5E5SA 4X65E 2EE8A 2EM9A 4O4KA 1PKPA 2ELYA 1YYOA 3MXBB 1LWSA 4O1RA 1ZU1A 2I3QA 5IV8B 2VS8A 2EOFA 2IN0A 2EPAA 4X66E 1UHZA 2E72A 2EMLA 2GPIA 4Z1ZA 4MLQA 3C0WA 1ZBQA 3C6MA 3ADLA 2DLQA 1YZ9A 2HHHE 2YWQA 3AUZA 5I0AA 3H09A 2AB5A 5DNYA 2CPNA 4WYQB 4DR5E 2ADRA 1KYQA 3HYJA 2GHFA 2DMYA 4LFAE 4R03A 3MXBA 4M2ZA 2EM8A 5AASA 2LUPB 4O1SA 2JP9A 1N3GA 1YYKA 3EH8A 2NA2A 4DV2E 2EL6A 3THNA 2HJJA 4DR7E 5A77A 5LMUE 2JR1A 1U0CA 2I3PA 3ZOQB 3HQ1A 3HTXA 4P78A 1J5EE 1J26A 4ZYGA 3RMPA 2CT1A 4NXME 4TUGA 2V88A 4GIGA 2V8QB 4DUYE 2KOUA 1IMUA 2R1FA 1BP7A 1MOWA 2XE0B 4DR6E 1NCSA 4LF6E 2J7JA 5IWAE 2YTPA 1T9IA 2DIXA 4LF4E 3FD2A 3R7PA 4AAEA 1XMQE 1XNQE 1YFHA 1G2DC 1I94E 1QU6A 1YSAC 2EM5A 2EPZA 3K6QA 1X47A 2JNQA 2LTSA 3F6HA 4DKKA 2CTDA 2EORA 2QOJZ 2V89A 2UXCE 2JWOA 5KL6A 3AV0A 1N34E 2EPLX 2XE0A 3ADGA 2LQMA 2EPKX 4X8WA 4F2JC 4AQYE 4DV6E 1IBKE 3KZZA 1TF3A 5AKFA 2VE7C 1ZAAC 2O7MA 4AADA 2MC5A 4HEIA 3MSWA 4ZYEA 2EMHA 3IWBA 1EF0A 4LX3A 2IHR1 3C4BA 4O5GA 2M4IA 1JVAA 3ECRA 2B9DA 4FK5C 2LV2A 2F4LA 5AE3A 4LF9E 2VF1A 2EX5A 2WBSA 2LBSB 2L3CA 4WFTA 2DLKA 1RMDA 4UN7A 3J81C 2DRPA 2V83A 1QNTA 4IS1C 5BR8E 4B3TE 2L8TA 4OZ6A 2K7IA 2R76A 3EPJA 3EPLA 3OTOE 2RTXA 1YUIA 4UN7G 4M9VC 3OMLA 4KL5A 2LE2A 1X49A 3J80C 2ODRC 1PJTA 2NUFA 1XNRE 4JI8E 3MISA 1R7MA 2ELZA 2NUGA 4GKJE 2VBLB 2ODRD 2I9IA 4BHBA 1FKAE 1WXRA 2EOIA 2DCHX 3ADIA 2YTNA 4BCAA 4JI7E 2EMYA 3J7AG 1N3FA 3C0XA 3J7Yp 4WPYA 4KZSA 2H36X 1EH8A 1WJPA 4Q35B 2LT7A 2IMZA 5KL5A 4JI2E 1YYWA 2EOQA 2EPUA 2M1SA 1DI2A 4RH8A 1UM2A 2V86A 4R2DA 1HNXE 2N3GA 2YZTA 4R2SA 2EOMA 3BGHA 2EN8A 2VBLA 4UN8A 2VBJB 2BB8A 3C6KA 1DGCA 2VBOB 1GTKA 2ENAA 1RQ0A 3NZMA 2EPRA 2YT4A 3THOB 1ZR9A 4UN8G 4UT0A 3M99B 3P1XA 4DV5E 3BF2A 2LMZA 4DV1E 2EMXA 2L3JA 5A6JA 4EFJA 3UK3C 1MEYC 2EOYA 1A1KA 3JU0A 2D9HA 2DMIA 1T38A 3EQ1A 4LFCE 1T4LB 1JK1A 5TSEA 2RS7A 1DQ3A 3LMLA 2VBJA 1BBOA 2EMGA 3QQYA 1ZDEA 2YTGA 5E63A 2VBOA 3QG5C 5A6KA 4DV3E 1A1FA 2EQ1A 2L2NA 5A6AA 2A25A 1N36E 2MC6A 4DV7E 2L2KB 1X6FA
chains in the Genus database with same CATH topology
2IN8A 3C4TA 4LU9A 2K4VA 4JI6E 2F4VE 4YHHE 4E2UA 5IT9C 4Z20A 2LTRA 5A0MB 3VYYA 1IBLE 2G7HA 1GPPA 2FTXB 2JY9A 3MX9A 4AABA 1N3EA 3HPSA 1FJGE 4DV0E 2KONA 1ZD7A 4JI1E 5ADZA 4Z1XA 4YITA 2UXDE 5A78A 5A0MA 2DB2A 2RSMA 2B7VA 4JV5E 3MIPA 4YHXA 3HYIA 4M0VA 1XMOE 5AKMA 5K08A 4P7DA 4YISA 3T1YE 4K0KE 4L5NC 2F8BA 4LOXA 3DJWA 2CW7A 1N33E 2E5LE 2VBNB 3DF6A 4UNBA 5AK9A 2UUCE 3KWRA 1U0DA 2UXBE 2IN9A 4F9BB 2LWYA 4L8NA 4B3SE 4DV4E 5AE2A 4F54A 5A72A 2CW8A 2VS7A 4E2TA 4JI5E 2WZOA 5LMNE 4LF8E 3IGDA 4R8OA 2VBNA 4BMJA 4LTYA 1AT0A 1RC7A 2UU9E 2L6MA 1M5XA 4B3ME 4AQUA 5E67A 5A74A 2EZ6A 4LQ0A 2EWLA 1O0WA 3UVFA 3JTZA 2NUEA 1G9YA 5LL6R 1HR0E 4KL6A 5AKNA 5A2QC 2VQFE 2JVAA 3HXLA 1AF5A 2L33A 5T6JA 1EKZA 2JOBA 1VDEA 1UILA 4LF5E 4DMIA 4BC9A 2L8LA 1MI8A 4NXNE 4M30A 4YY3E 5F3WA 1GQEA 1IBME 3ADJA 3KO2A 4LF7E 3OORA 1P8KZ 3HPZA 2UUAE 4BBYA 1WHNA 4AAFA 4Q28A 2E1MA 1GZ6A 4DR2E 4F9AB 2V87A 3MXAA 2M7QA 4BC7A 2L2MA 2LJHA 3F6GA 4I8OA 1T9JA 3VYXA 2DSYA 1AM2A 1X48A 2FV4B 4X62E 2B3TB 4B3RE 1N32E 3OOLA 4AQXA 3JAMC 1DFAA 4WSPA 4DR3E 2B7TA 4JI0E 2JMZA 1HNZE 4UNCA 1G9ZA 3T1HE 4DR4E 5AE1A 4JI3E 4F9CB 2RS6A 3LLHA 1SR9A 3E54A 1T4OA 2V85A 3IFJA 4BS9A 5E5OA 4OOGC 2LCJA 1T4NA 2L92A 3VK6A 4X64E 4D6OA 4KHPE 2JOXA 2FGGA 2UUBE 1B24A 2ZM6E 3FIGA 2MDRA 3IWCA 2FLDA 5CFFE 1LWTA 2LRSA 4GEQB 2KEQA 4UNAA 2KHXA 4UN9A 4DUZE 1WHQA 4JYAE 4D6NA 3IWDA 2N3HA 5FLXC 4J8ZA 4TUIA 3ADLA 4AAGA 1ZBTA 1STUA 4UN9G 2VQEE 4GKKE 4OX9E 2LUQA 4LFBE 1HNWE 5A0WA 4JI4E 4DR1E 5E5SA 4X65E 1PKPA 1YYOA 3MXBB 1LWSA 4O1RA 2I3QA 2VS8A 2IN0A 4X66E 1UHZA 4Z1ZA 3C0WA 1ZBQA 1YZ9A 2HHHE 3AUZA 5I0AA 3H09A 2AB5A 5DNYA 2CPNA 4WYQB 4DR5E 3HYJA 2DMYA 4LFAE 4R03A 3MXBA 4M2ZA 5AASA 2LUPB 4O1SA 1YYKA 3EH8A 2NA2A 4DV2E 4DR7E 5A77A 5LMUE 2JR1A 1U0CA 2I3PA 3ZOQB 3HQ1A 3HTXA 4P78A 1J5EE 1J26A 3RMPA 4NXME 4TUGA 2V88A 4GIGA 2V8QB 4DUYE 2KOUA 1BP7A 1MOWA 2XE0B 4DR6E 4LF6E 5IWAE 1T9IA 2DIXA 4LF4E 3FD2A 3R7PA 4AAEA 1XMQE 1XNQE 1I94E 1QU6A 3K6QA 1X47A 2JNQA 2LTSA 3F6HA 4DKKA 2QOJZ 2V89A 2UXCE 2JWOA 3AV0A 1N34E 2XE0A 3ADGA 2LQMA 4X8WA 4AQYE 4DV6E 1IBKE 5AKFA 2VE7C 2O7MA 4AADA 2MC5A 3MSWA 3IWBA 1EF0A 2IHR1 3C4BA 2M4IA 1JVAA 2B9DA 5AE3A 4LF9E 2VF1A 2EX5A 2LBSB 2L3CA 4WFTA 4UN7A 3J81C 2V83A 5BR8E 4B3TE 2L8TA 4OZ6A 3OTOE 2RTXA 4UN7G 3OMLA 4KL5A 2LE2A 1X49A 3J80C 2ODRC 2NUFA 1XNRE 4JI8E 3MISA 1R7MA 2NUGA 4GKJE 2VBLB 2ODRD 1FKAE 1WXRA 2DCHX 3ADIA 4BCAA 4JI7E 3J7AG 1N3FA 3C0XA 3J7Yp 4WPYA 4KZSA 2H36X 2IMZA 4JI2E 1YYWA 2M1SA 1DI2A 1UM2A 2V86A 1HNXE 2N3GA 2YZTA 2VBLA 4UN8A 2VBJB 2VBOB 1RQ0A 3NZMA 2YT4A 4UN8G 4UT0A 3P1XA 4DV5E 2LMZA 4DV1E 2L3JA 4EFJA 3JU0A 4LFCE 1T4LB 2RS7A 1DQ3A 3LMLA 2VBJA 3QQYA 1ZDEA 4DV3E 5E63A 2VBOA 2L2NA 1N36E 2MC6A 4DV7E 2L2KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XE0 A;  2IN8 A;  2LQM A;  1AF5 A;  1LWT A;  5AKF A;  2KEQ A;  2O7M A;  4AAD A;  4UNA A;  1EF0 A;  4E2U A;  4UN9 A;  1JVA A;  4Z20 A;  4D6N A;  4AAG A;  1VDE A;  5A0M B;  2EX5 A;  1GPP A;  4UN9 G;  2L8L A;  3MX9 A;  4AAB A;  4UN7 A;  4KL6 A;  1MI8 A;  1N3E A;  5A0W A;  4OZ6 A;  5E5S A;  4UN7 G;  1ZD7 A;  3KO2 A;  4KL5 A;  3MXB B;  1LWS A;  4Z1X A;  4YIT A;  4O1R A;  3OOR A;  1P8K Z;  5A78 A;  3MIS A;  1R7M A;  2I3Q A;  5A0M A;  2VS8 A;  4AAF A;  2VBL B;  2IN0 A;  3MIP A;  4YHX A;  3HYI A;  2DCH X;  4Z1Z A;  3MXA A;  3C0W A;  1N3F A;  5I0A A;  3C0X A;  5AKM A;  5K08 A;  2AB5 A;  4YIS A;  3HYJ A;  4LOX A;  1T9J A;  2IMZ A;  3MXB A;  2CW7 A;  1AM2 A;  4O1S A;  1UM2 A;  2VBN B;  3EH8 A;  4UNB A;  5AK9 A;  2VBL A;  4UN8 A;  2VBJ B;  5A77 A;  1U0D A;  2IN9 A;  3OOL A;  4AQX A;  2VBO B;  1U0C A;  2I3P A;  1DFA A;  2LWY A;  3NZM A;  2JMZ A;  4UNC A;  5A72 A;  4UN8 G;  2CW8 A;  4UT0 A;  2VS7 A;  4GIG A;  1G9Z A;  4E2T A;  1BP7 A;  4EFJ A;  1MOW A;  3IGD A;  2XE0 B;  2VBN A;  1AT0 A;  1T9I A;  3E54 A;  1DQ3 A;  3FD2 A;  3R7P A;  3IFJ A;  1M5X A;  2VBJ A;  5E67 A;  4AQU A;  4AAE A;  5A74 A;  5E5O A;  3QQY A;  4LQ0 A;  1ZDE A;  2LCJ A;  5E63 A;  2VBO A;  3UVF A;  4D6O A;  2JNQ A;  2QOJ Z;  1G9Y A;  1B24 A;  5AKN A;  2FLD A; 
#chains in the Genus database with same CATH topology
 2IN8 A;  3BID A;  3C4T A;  4WXD A;  2YTI A;  2EN6 A;  4O24 A;  4LU9 A;  1KJK A;  1A1H A;  2K4V A;  4R2P A;  4JI6 E;  2F4V E;  4YHH E;  4R2A A;  2EQ3 A;  4E2U A;  5AC4 A;  5IT9 C;  4Z20 A;  2LTR A;  5A0M B;  3VYY A;  1IBL E;  2G7H A;  1GPP A;  2FTX B;  2EPM X;  2JY9 A;  4MLV A;  3MX9 A;  4AAB A;  4F6M A;  1A1G A;  3MHH C;  1N3E A;  3HPS A;  2ENC A;  1FJG E;  2EM3 A;  1A1L A;  2MDG A;  2YTO A;  1Z1B A;  2YSP A;  1G2F C;  4DV0 E;  2KON A;  1ZD7 A;  4NHR A;  2YRK A;  4NZV A;  4JI1 E;  5ADZ A;  4Z1X A;  4YIT A;  2EOH A;  2UXD E;  5A78 A;  2LCE A;  2RQL A;  5A0M A;  2DB2 A;  5AC5 A;  4R2R A;  2RSM A;  2B7V A;  2EMF A;  4JV5 E;  3MIP A;  4YHX A;  3HYI A;  4M0V A;  3TQM A;  1XMO E;  4QFQ A;  2EN2 A;  5A6B A;  5AKM A;  5K08 A;  4P7D A;  4YIS A;  2EMK A;  1WRJ A;  4WSG A;  3T1Y E;  2EPP A;  4K0K E;  2YRM A;  2N8X A;  4L5N C;  2F8B A;  4LOX A;  3DJW A;  2CW7 A;  1N33 E;  1JK2 A;  5LLQ A;  2E5L E;  2JXP A;  2VBN B;  3DF6 A;  4UNB A;  5AK9 A;  2EQ0 A;  1LLM C;  2UUC E;  3KWR A;  1U0D A;  2UXB E;  2IN9 A;  2EN1 A;  4F9B B;  2EM4 A;  2LWY A;  4L8N A;  1AAY A;  4B3S E;  4DV4 E;  5AE2 A;  4F54 A;  5A72 A;  2EL4 A;  2CW8 A;  2EL5 A;  3BBG A;  2VS7 A;  2YTF A;  5KL4 A;  4E2T A;  4JI5 E;  2PRT A;  2WZO A;  5LMN E;  4LF8 E;  2WCC 3;  3IGD A;  4R8O A;  2VBN A;  4BMJ A;  4LTY A;  2EMZ A;  1AT0 A;  4R2E A;  2YU8 A;  4KWY A;  1RC7 A;  2UU9 E;  2L6M A;  2LJU A;  1M5X A;  4B3M E;  4AQU A;  5E67 A;  1F2I G;  5A74 A;  2EPC A;  1PDA A;  2EZ6 A;  4LQ0 A;  2EWL A;  1O0W A;  3UVF A;  3EPK A;  3JTZ A;  2ENH A;  2NUE A;  1B69 A;  1G9Y A;  5KL7 A;  5LL6 R;  1HR0 E;  4KL6 A;  5AKN A;  2BBG A;  5A2Q C;  1IQO A;  2EP3 A;  2GLI A;  2VQF E;  2JVA A;  3HXL A;  2MKN A;  2YTQ A;  1AF5 A;  2EJ4 A;  2L33 A;  5T6J A;  1YUJ A;  2NAB A;  2WBT A;  1EKZ A;  2EM0 A;  2LO3 A;  2JOB A;  5KL2 A;  4WXC A;  1VDE A;  1UIL A;  4LF5 E;  4DMI A;  2EMI A;  4BC9 A;  2L8L A;  5A69 A;  2I13 A;  3MHS C;  1MI8 A;  2YU5 A;  4NXN E;  2EMB A;  4GZN C;  2JYA A;  2Q8U A;  4M30 A;  4YY3 E;  2YPN A;  1GQE A;  2CSH A;  5F3W A;  2JPA A;  1IBM E;  1MGT A;  1X6H A;  3ADJ A;  3KO2 A;  2HGH A;  2EOO A;  4LF7 E;  3OOR A;  1P8K Z;  3HPZ A;  2UUA E;  2WBU A;  4BBY A;  1WHN A;  4AAF A;  4Q28 A;  2E1M A;  1GZ6 A;  4DR2 E;  4F9A B;  2V87 A;  2YSO A;  3MXA A;  2YTD A;  2M7Q A;  2DGC A;  1P47 A;  2EOE A;  2EOS A;  2M9A A;  4BC7 A;  1YPN A;  2L2M A;  1SFE A;  2LJH A;  3F6G A;  1T9J A;  4I8O A;  3VYX A;  1T39 A;  2DSY A;  2EOZ A;  4IJD A;  1AM2 A;  1X48 A;  2FV4 B;  4R2Q A;  1PJS A;  4X62 E;  2MKD A;  2B3T B;  4ZYH A;  4B3R E;  4RHB B;  1N32 E;  3OOL A;  2YTE A;  2LVH A;  4AQX A;  3JAM C;  4HTG A;  1DFA A;  4WSP A;  4DR3 E;  2B7T A;  4JI0 E;  2JMZ A;  1HNZ E;  4UNC A;  2EN7 A;  1PJQ A;  1G9Z A;  3EPH A;  1EH6 A;  2EPN A;  3T1H E;  2RSI A;  4DR4 E;  1BB8 A;  5AE1 A;  4JI3 E;  3VHT B;  4F9C B;  2RS6 A;  3LLH A;  1SR9 A;  4O43 A;  2EM7 A;  2VRD A;  1EH7 A;  5IXM B;  3E54 A;  1T4O A;  2V85 A;  4WX9 A;  1TF6 A;  3IFJ A;  4BS9 A;  2HC5 A;  5E5O A;  2EPX A;  4OOG C;  2EM6 A;  2LCJ A;  3L00 A;  1T4N A;  1X3C A;  2L92 A;  4N4R B;  3VK6 A;  4X64 E;  4D6O A;  4KHP E;  1X5W A;  2YRH A;  2JOX A;  2EN3 A;  2FGG A;  4ZYD A;  1TN9 A;  2UUB E;  1NEI A;  1B24 A;  2ZM6 E;  2EMC A;  2MDR A;  3FIG A;  3IWC A;  2FLD A;  5CFF E;  1LWT A;  1UBD C;  2LRS A;  2EN4 A;  2EOX A;  4GEQ B;  4R2C A;  2KEQ A;  5A6B D;  1L4S A;  4UNA A;  2KHX A;  4UN9 A;  4DUZ E;  1WHQ A;  2EM2 A;  4JYA E;  4D6N A;  2EOJ A;  2N3H A;  2YTJ A;  3IWD A;  4J8Z A;  5FLX C;  4X9J A;  4AAG A;  1AH5 A;  1ZBT A;  4TUI A;  1A1I A;  1STU A;  4F6N A;  1A1J A;  4UN9 G;  1BBG A;  2EMA A;  1IQS A;  2VQE E;  4GKK E;  1UN6 B;  2EMW A;  4OX9 E;  2LUQ A;  1X6E A;  3KZY A;  4LFB E;  2RPC A;  1HNW E;  2EPO A;  5A0W A;  4JI4 E;  5KL3 A;  4DR1 E;  4BHC A;  5E5S A;  4X65 E;  2EE8 A;  2EM9 A;  4O4K A;  1PKP A;  2ELY A;  1YYO A;  3MXB B;  1LWS A;  4O1R A;  1ZU1 A;  2I3Q A;  5IV8 B;  2VS8 A;  2EOF A;  2IN0 A;  2EPA A;  4X66 E;  1UHZ A;  2E72 A;  2EML A;  2GPI A;  4Z1Z A;  4MLQ A;  3C0W A;  1ZBQ A;  3C6M A;  3ADL A;  2DLQ A;  1YZ9 A;  2HHH E;  2YWQ A;  3AUZ A;  5I0A A;  3H09 A;  2AB5 A;  5DNY A;  2CPN A;  4WYQ B;  4DR5 E;  2ADR A;  1KYQ A;  3HYJ A;  2GHF A;  2DMY A;  4LFA E;  4R03 A;  3MXB A;  4M2Z A;  2EM8 A;  5AAS A;  2LUP B;  4O1S A;  2JP9 A;  1N3G A;  1YYK A;  3EH8 A;  2NA2 A;  4DV2 E;  2EL6 A;  3THN A;  2HJJ A;  4DR7 E;  5A77 A;  5LMU E;  2JR1 A;  1U0C A;  2I3P A;  3ZOQ B;  3HQ1 A;  3HTX A;  4P78 A;  1J5E E;  1J26 A;  4ZYG A;  3RMP A;  2CT1 A;  4NXM E;  4TUG A;  2V88 A;  4GIG A;  2V8Q B;  4DUY E;  2KOU A;  1IMU A;  2R1F A;  1BP7 A;  1MOW A;  2XE0 B;  4DR6 E;  1NCS A;  4LF6 E;  2J7J A;  5IWA E;  2YTP A;  1T9I A;  2DIX A;  4LF4 E;  3FD2 A;  3R7P A;  4AAE A;  1XMQ E;  1XNQ E;  1YFH A;  1G2D C;  1I94 E;  1QU6 A;  1YSA C;  2EM5 A;  2EPZ A;  3K6Q A;  1X47 A;  2JNQ A;  2LTS A;  3F6H A;  4DKK A;  2CTD A;  2EOR A;  2QOJ Z;  2V89 A;  2UXC E;  2JWO A;  5KL6 A;  3AV0 A;  1N34 E;  2EPL X;  2XE0 A;  3ADG A;  2LQM A;  2EPK X;  4X8W A;  4F2J C;  4AQY E;  4DV6 E;  1IBK E;  3KZZ A;  1TF3 A;  5AKF A;  2VE7 C;  1ZAA C;  2O7M A;  4AAD A;  2MC5 A;  4HEI A;  3MSW A;  4ZYE A;  2EMH A;  3IWB A;  1EF0 A;  4LX3 A;  2IHR 1;  3C4B A;  4O5G A;  2M4I A;  1JVA A;  3ECR A;  2B9D A;  4FK5 C;  2LV2 A;  2F4L A;  5AE3 A;  4LF9 E;  2VF1 A;  2EX5 A;  2WBS A;  2LBS B;  2L3C A;  4WFT A;  2DLK A;  1RMD A;  4UN7 A;  3J81 C;  2DRP A;  2V83 A;  1QNT A;  4IS1 C;  5BR8 E;  4B3T E;  2L8T A;  4OZ6 A;  2K7I A;  2R76 A;  3EPJ A;  3EPL A;  3OTO E;  2RTX A;  1YUI A;  4UN7 G;  4M9V C;  3OML A;  4KL5 A;  2LE2 A;  1X49 A;  3J80 C;  2ODR C;  1PJT A;  2NUF A;  1XNR E;  4JI8 E;  3MIS A;  1R7M A;  2ELZ A;  2NUG A;  4GKJ E;  2VBL B;  2ODR D;  2I9I A;  4BHB A;  1FKA E;  1WXR A;  2EOI A;  2DCH X;  3ADI A;  2YTN A;  4BCA A;  4JI7 E;  2EMY A;  3J7A G;  1N3F A;  3C0X A;  3J7Y p;  4WPY A;  4KZS A;  2H36 X;  1EH8 A;  1WJP A;  4Q35 B;  2LT7 A;  2IMZ A;  5KL5 A;  4JI2 E;  1YYW A;  2EOQ A;  2EPU A;  2M1S A;  1DI2 A;  4RH8 A;  1UM2 A;  2V86 A;  4R2D A;  1HNX E;  2N3G A;  2YZT A;  4R2S A;  2EOM A;  3BGH A;  2EN8 A;  2VBL A;  4UN8 A;  2VBJ B;  2BB8 A;  3C6K A;  1DGC A;  2VBO B;  1GTK A;  2ENA A;  1RQ0 A;  3NZM A;  2EPR A;  2YT4 A;  3THO B;  1ZR9 A;  4UN8 G;  4UT0 A;  3M99 B;  3P1X A;  4DV5 E;  3BF2 A;  2LMZ A;  4DV1 E;  2EMX A;  2L3J A;  5A6J A;  4EFJ A;  3UK3 C;  1MEY C;  2EOY A;  1A1K A;  3JU0 A;  2D9H A;  2DMI A;  1T38 A;  3EQ1 A;  4LFC E;  1T4L B;  1JK1 A;  5TSE A;  2RS7 A;  1DQ3 A;  3LML A;  2VBJ A;  1BBO A;  2EMG A;  3QQY A;  1ZDE A;  2YTG A;  5E63 A;  2VBO A;  3QG5 C;  5A6K A;  4DV3 E;  1A1F A;  2EQ1 A;  2L2N A;  5A6A A;  2A25 A;  1N36 E;  2MC6 A;  4DV7 E;  2L2K B;  1X6F A; 
#chains in the Genus database with same CATH homology
 2IN8 A;  3C4T A;  4LU9 A;  2K4V A;  4JI6 E;  2F4V E;  4YHH E;  4E2U A;  5IT9 C;  4Z20 A;  2LTR A;  5A0M B;  3VYY A;  1IBL E;  2G7H A;  1GPP A;  2FTX B;  2JY9 A;  3MX9 A;  4AAB A;  1N3E A;  3HPS A;  1FJG E;  4DV0 E;  2KON A;  1ZD7 A;  4JI1 E;  5ADZ A;  4Z1X A;  4YIT A;  2UXD E;  5A78 A;  5A0M A;  2DB2 A;  2RSM A;  2B7V A;  4JV5 E;  3MIP A;  4YHX A;  3HYI A;  4M0V A;  1XMO E;  5AKM A;  5K08 A;  4P7D A;  4YIS A;  3T1Y E;  4K0K E;  4L5N C;  2F8B A;  4LOX A;  3DJW A;  2CW7 A;  1N33 E;  2E5L E;  2VBN B;  3DF6 A;  4UNB A;  5AK9 A;  2UUC E;  3KWR A;  1U0D A;  2UXB E;  2IN9 A;  4F9B B;  2LWY A;  4L8N A;  4B3S E;  4DV4 E;  5AE2 A;  4F54 A;  5A72 A;  2CW8 A;  2VS7 A;  4E2T A;  4JI5 E;  2WZO A;  5LMN E;  4LF8 E;  3IGD A;  4R8O A;  2VBN A;  4BMJ A;  4LTY A;  1AT0 A;  1RC7 A;  2UU9 E;  2L6M A;  1M5X A;  4B3M E;  4AQU A;  5E67 A;  5A74 A;  2EZ6 A;  4LQ0 A;  2EWL A;  1O0W A;  3UVF A;  3JTZ A;  2NUE A;  1G9Y A;  5LL6 R;  1HR0 E;  4KL6 A;  5AKN A;  5A2Q C;  2VQF E;  2JVA A;  3HXL A;  1AF5 A;  2L33 A;  5T6J A;  1EKZ A;  2JOB A;  1VDE A;  1UIL A;  4LF5 E;  4DMI A;  4BC9 A;  2L8L A;  1MI8 A;  4NXN E;  4M30 A;  4YY3 E;  5F3W A;  1GQE A;  1IBM E;  3ADJ A;  3KO2 A;  4LF7 E;  3OOR A;  1P8K Z;  3HPZ A;  2UUA E;  4BBY A;  1WHN A;  4AAF A;  4Q28 A;  2E1M A;  1GZ6 A;  4DR2 E;  4F9A B;  2V87 A;  3MXA A;  2M7Q A;  4BC7 A;  2L2M A;  2LJH A;  3F6G A;  4I8O A;  1T9J A;  3VYX A;  2DSY A;  1AM2 A;  1X48 A;  2FV4 B;  4X62 E;  2B3T B;  4B3R E;  1N32 E;  3OOL A;  4AQX A;  3JAM C;  1DFA A;  4WSP A;  4DR3 E;  2B7T A;  4JI0 E;  2JMZ A;  1HNZ E;  4UNC A;  1G9Z A;  3T1H E;  4DR4 E;  5AE1 A;  4JI3 E;  4F9C B;  2RS6 A;  3LLH A;  1SR9 A;  3E54 A;  1T4O A;  2V85 A;  3IFJ A;  4BS9 A;  5E5O A;  4OOG C;  2LCJ A;  1T4N A;  2L92 A;  3VK6 A;  4X64 E;  4D6O A;  4KHP E;  2JOX A;  2FGG A;  2UUB E;  1B24 A;  2ZM6 E;  3FIG A;  2MDR A;  3IWC A;  2FLD A;  5CFF E;  1LWT A;  2LRS A;  4GEQ B;  2KEQ A;  4UNA A;  2KHX A;  4UN9 A;  4DUZ E;  1WHQ A;  4JYA E;  4D6N A;  3IWD A;  2N3H A;  5FLX C;  4J8Z A;  4TUI A;  3ADL A;  4AAG A;  1ZBT A;  1STU A;  4UN9 G;  2VQE E;  4GKK E;  4OX9 E;  2LUQ A;  4LFB E;  1HNW E;  5A0W A;  4JI4 E;  4DR1 E;  5E5S A;  4X65 E;  1PKP A;  1YYO A;  3MXB B;  1LWS A;  4O1R A;  2I3Q A;  2VS8 A;  2IN0 A;  4X66 E;  1UHZ A;  4Z1Z A;  3C0W A;  1ZBQ A;  1YZ9 A;  2HHH E;  3AUZ A;  5I0A A;  3H09 A;  2AB5 A;  5DNY A;  2CPN A;  4WYQ B;  4DR5 E;  3HYJ A;  2DMY A;  4LFA E;  4R03 A;  3MXB A;  4M2Z A;  5AAS A;  2LUP B;  4O1S A;  1YYK A;  3EH8 A;  2NA2 A;  4DV2 E;  4DR7 E;  5A77 A;  5LMU E;  2JR1 A;  1U0C A;  2I3P A;  3ZOQ B;  3HQ1 A;  3HTX A;  4P78 A;  1J5E E;  1J26 A;  3RMP A;  4NXM E;  4TUG A;  2V88 A;  4GIG A;  2V8Q B;  4DUY E;  2KOU A;  1BP7 A;  1MOW A;  2XE0 B;  4DR6 E;  4LF6 E;  5IWA E;  1T9I A;  2DIX A;  4LF4 E;  3FD2 A;  3R7P A;  4AAE A;  1XMQ E;  1XNQ E;  1I94 E;  1QU6 A;  3K6Q A;  1X47 A;  2JNQ A;  2LTS A;  3F6H A;  4DKK A;  2QOJ Z;  2V89 A;  2UXC E;  2JWO A;  3AV0 A;  1N34 E;  2XE0 A;  3ADG A;  2LQM A;  4X8W A;  4AQY E;  4DV6 E;  1IBK E;  5AKF A;  2VE7 C;  2O7M A;  4AAD A;  2MC5 A;  3MSW A;  3IWB A;  1EF0 A;  2IHR 1;  3C4B A;  2M4I A;  1JVA A;  2B9D A;  5AE3 A;  4LF9 E;  2VF1 A;  2EX5 A;  2LBS B;  2L3C A;  4WFT A;  4UN7 A;  3J81 C;  2V83 A;  5BR8 E;  4B3T E;  2L8T A;  4OZ6 A;  3OTO E;  2RTX A;  4UN7 G;  3OML A;  4KL5 A;  2LE2 A;  1X49 A;  3J80 C;  2ODR C;  2NUF A;  1XNR E;  4JI8 E;  3MIS A;  1R7M A;  2NUG A;  4GKJ E;  2VBL B;  2ODR D;  1FKA E;  1WXR A;  2DCH X;  3ADI A;  4BCA A;  4JI7 E;  3J7A G;  1N3F A;  3C0X A;  3J7Y p;  4WPY A;  4KZS A;  2H36 X;  2IMZ A;  4JI2 E;  1YYW A;  2M1S A;  1DI2 A;  1UM2 A;  2V86 A;  1HNX E;  2N3G A;  2YZT A;  2VBL A;  4UN8 A;  2VBJ B;  2VBO B;  1RQ0 A;  3NZM A;  2YT4 A;  4UN8 G;  4UT0 A;  3P1X A;  4DV5 E;  2LMZ A;  4DV1 E;  2L3J A;  4EFJ A;  3JU0 A;  4LFC E;  1T4L B;  2RS7 A;  1DQ3 A;  3LML A;  2VBJ A;  3QQY A;  1ZDE A;  4DV3 E;  5E63 A;  2VBO A;  2L2N A;  1N36 E;  2MC6 A;  4DV7 E;  2L2K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...