2CW8A

Crystal structure of intein homing endonuclease ii
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
537
structure length
537
Chain Sequence
SILPEEWLPVLEEGEVHFVRIGELIDRMMEENAGKVKREGETEVLEVSGLEVPSFNRRTNKAELKRVKALIRHDYSGKVYTIRLKSGRRIKITSGHSLFSVRNGELVEVTGDELKPGDLVAVPRRLELPERNHVLNLVELLLGTPEEETLDIVMTIPVKGKKNFFKGMLRTLRWIFGEEKRPRTARRYLRHLEDLGYVRLKKIGYEVLDWDSLKNYRRLYEALVENVRYNGNKREYLVEFNSIRDAVGIMPLKELKEWKIGTLNGFRMRKLIEVDESLAKLLGYYVSEGYARKQRNPKNGWSYSVKLYNEDPEVLDDMERLASRFFGKVRRGRNYVEIPKKIGYLLFENMCGVLAENKRIPEFVFTSPKGVRLAFLEGYFIGDGDVHPNKRLRLSTKSELLANQLVLLLNSVGVSAVKLGHDSGVYRVYINEELPFVKLDKKKNAYYSHVIPKEVLSEVFGKVFQKNVSPQTFRKMVEDGRLDPEKAQRLSWLIEGDVVLDRVESVDVEDYDGYVYDLSVEDNENFLVGFGLVYAHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of intein homing endonuclease II encoded in DNA polymerase gene from hyperthermophilic archaeon Thermococcus kodakaraensis strain KOD1
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Endonuclease PI-PkoII
total genus 153
structure length 537
sequence length 537
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2005-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14528 LAGLIDADG_3 LAGLIDADG-like domain
A PF14890 Intein_splicing Intein splicing domain
A PF18714 PI-TkoII_IV DNA polymerase II intein Domain IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1010 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2cw8A02
2.170.16.10 Mainly Beta Beta Complex Endonuclease - Pi-scei; Chain A, domain 1 Hedgehog/Intein (Hint) domain 2cw8A01
3.10.28.10 Alpha Beta Roll Endonuclease I-creI Homing endonucleases 2cw8A03
3.30.1490.210 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2cw8A04
4OZ6A 5AKMA 2I3PA 4Z20A 2CW7A 5E5SA 4E2UA 2IN9A 2IMZA 1LWTA 2VBJB 5E67A 3OORA 4UN7A 3MXAA 4UT0A 4YISA 2VBJA 1B24A 2O7MA 5A0MA 3HYJA 1AF5A 4UN8A 1G9ZA 4O1SA 4AABA 2VBNA 4UN9G 1R7MA 3MXBB 2DCHX 2EX5A 1MI8A 2L8LA 2QOJZ 4UN9A 3OOLA 1ZDEA 3IGDA 2LWYA 4UN7G 4AQXA 4D6OA 3C0WA 2VS7A 1GPPA 1ZD7A 2JNQA 4GIGA 5K08A 5AKFA 3E54A 1G9YA 2XE0B 4KL6A 3QQYA 5A74A 2I3QA 4EFJA 1MOWA 4AAEA 4KL5A 5A77A 5A0MB 2VS8A 3MX9A 1VDEA 4YHXA 1EF0A 2VBOB 4Z1ZA 2LCJA 4AAGA 5E5OA 1T9IA 4UNAA 1M5XA 1AT0A 3MISA 2JMZA 3HYIA 2VBOA 4AQUA 5AKNA 1BP7A 2CW8A 3KO2A 3MIPA 2FLDA 1T9JA 3NZMA 2KEQA 2VBLB 4LQ0A 1DQ3A 1AM2A 1UM2A 1N3FA 5A78A 4E2TA 2XE0A 3UVFA 1JVAA 4UN8G 4UNBA 2LQMA 5AK9A 1N3EA 2IN0A 3MXBA 4AAFA 1U0CA 4Z1XA 1U0DA 3IFJA 4LOXA 5A0WA 4UNCA 1DFAA 4AADA 2VBLA 1LWSA 3R7PA 1P8KZ 2AB5A 5I0AA 3C0XA 5A72A 4O1RA 5E63A 2IN8A 4D6NA 3FD2A 3EH8A 4YITA 2VBNB
chains in the Genus database with same CATH superfamily
1SAUA 2Q8KA 4AVPA 2BHYA 4Z20A 2GZWA 2ZJPF 2CKZB 1SAXA 2WAFA 3OL4A 5KG3A 2IN9A 2FMYA 1PVEA 1LWTA 5E20A 2R7LA 4RUAA 2R92G 1R1UA 1ZR4A 5KAIC 4YJ3F 1EHIA 2HVRA 3PSFA 4ED6A 3H3VK 3FMRA 3M07A 1RETA 3VPDA 3LA7A 2NVXJ 5C3EJ 3CMAI 1GSOA 1ETXA 4UT0A 3BA9A 3JRGA 3VYRB 4W1UA 1XGMA 4KT6A 2VN2A 2R7WA 5L9XA 3SYTA 3OYFA 5EZHA 2D45A 2R6FA 3HOYG 5HV6A 1OWTA 2FMAA 2CRGA 2O3FA 4XBFA 5L3BA 1B72B 3HOUG 4UN9G 1G59A 4OIRF 2EA2A 5C5JA 2M1BA 4M6VA 4EMSA 3OV8A 4ECZA 3C3WA 3Q3SA 3M9MB 1RPWA 2M0CA 1T3NA 2HXIA 1OQYA 1KJJA 3FDSA 3GQCA 2GIVA 2UXBH 2ZCWA 4AQXA 4ESFA 3GZ6A 3KEOA 4DZJA 4O3OA 1AOYA 2R92A 2BBYA 2LD5A 3HOTA 2YU9J 1AWCA 1AUVA 3MAJA 4IXAA 4JYAH 2STWA 1WCMG 4PSWA 3PL8A 1PUFA 3CD6I 1FP1D 2JSCA 1ZGWA 1U78A 2VA2A 1BIBA 4FHTA 5M5XJ 2W6MA 1Y1VJ 2Z2SB 1IC8A 2WY7Q 3H92A 2DBBA 4UCTA 4BXFA 5A77A 4EJVA 2M4GA 2ZJRF 1BR1A 1Y8QB 2JVGA 2HJWA 3ETJA 1YW9A 4BWSC 2FU4A 4YHXA 2NOJB 4U7DA 5L1JA 1FMWA 3ZQQA 4CCMA 1RJPA 1X9NA 1SD6A 1SFKA 2XAQA 5D8KB 4IZZA 5CPRB 2CQYA 1ZREA 3BJYA 1H9TA 3DLLF 1T9IA 5J8FA 1JDBB 2ZB9A 1MKMA 3FHNA 1Z67A 2L7ZA 2UXXA 5KFLA 2E19A 5KFBA 3LFUA 1RJRA 2CW8A 3I4PA 4OINF 3KO2A 4D5FA 3EPZA 1E4EA 1ZGJA 2G9WA 3ECHA 4I98B 4II3A 4HNUA 1TWAA 3ISPA 3T8RA 4MFDA 1B6AA 4E4TA 5KG4A 2BOLA 1ZYRF 2XF7A 3LSJA 3TQNA 1A35A 2GLTA 2X4HA 4BHCA 2ETHA 2NS0A 2Z5UA 3K3PA 2VJ4A 3D5SC 2K4BA 2KJBA 2A05A 2OV7A 1M0TA 1SYXB 3PM1A 2FPPB 4DV4H 3I4MJ 5KT5A 4HSRA 3KEQA 2VE9A 3S15J 3OSFA 3CC7I 5LHIA 3Q2OA 2ZJQF 1SFOJ 1X4OA 2ZMEB 5HS9A 2AB5A 3BTIA 3KTMA 3CP2A 2ZNZA 1S72I 4M3FA 3GILA 5K7ZA 1HOMA 3JTGA 1S9FA 1QZZA 4MEYF 2W6ZA 3BQ0A 4OZ6A 3K1PA 3TDZC 4HRIA 4U7CA 1HC8A 2AGQA 1QZYA 3TO7A 2HNHA 3BWGA 4V2FA 4RM2A 3U21A 2B7EA 4QWDA 1BJZA 2E5NA 4BJ6C 1K79A 2R5YA 4JX4A 2XKOA 4FS1A 1P7IA 1R7JA 3OR2C 5D5UB 2R87A 1T0FC 1UFMA 4LOCA 3R4KA 3AG3H 5DG9A 4XONA 5TGTA 2LNBA 3PNVA 4Y3OA 4EM1A 1I7NA 4ESBA 4MV6A 3ZMVA 4C9YA 2K86A 1RKWA 3MXBB 2E34A 3CZ6A 1ORKA 2CO5A 3C2BA 3H5AA 1U8RA 4O4HF 2PMZE 2QOJZ 5ICEA 2NYXA 4I6ZA 2R7ZA 2Q0OA 3V42A 2Z1DA 1EUCB 5KG6A 2K9NA 4IHVA 2LF7A 3SDGA 5A2QZ 4P9UA 2FRHA 3JW4A 2R7VA 2QCOA 3KP5A 2E2JJ 4PJ0C 2X1DA 3BJAA 4RAFA 2HOTA 1GPPA 4ZHQF 1RZ4A 2IP2A 2JA7J 1UHMA 4ZH4F 1G9YA 1XDSA 2XAJA 4B4CA 3L2WA 5TRDA 1I6HJ 5KFWA 4O5VA 3Q9SA 1VQ9I 1KQ8A 4C5CA 1HBXG 5KVRA 4EFJA 4EEQA 5CVIA 4RA2A 1JKRC 3BR1A 1JGGA 3MKZA 1MH3A 3LFKA 3F8BA 4ESJA 2J6UA 1K83J 2PMZN 3TGNA 4QWBA 4AWXB 3L7WA 3GEZA 3F3XA 4B44A 1P92A 4E7JA 3BG3A 1N77A 3KYCB 4IOAF 2LDUA 4ENNA 1LVKA 3GLXA 4J01A 5AKNA 3WTSC 4M9SA 3CF5F 3KEYA 4CHUA 3I55I 2KMUA 5IT3A 4LD5A 3BR5A 4Y4RA 2VBLB 3L09A 4PJMA 4YB8B 3HJEA 4L5EA 5D8LB 3PW0A 3J7AO 1LEAA 4S05A 1RK6A 2V79A 5B1BH 3V8KA 3MR3A 1N25A 2PEXA 4A2BA 5C4JJ 4Y52J 2JA5A 3SJMA 1IZ1A 1XX5A 3GFIA 5KFRA 3RKWA 5HLTA 4A3MJ 3FKIA 4DR6H 2ZFUA 3WGGA 3M8FA 2DA2A 2YS9A 1ACIA 4PDBA 2LKPA 4FETA 1KBLA 2PJPA 3WGHA 2QQ8A 3P9CA 1U0DA 3HKZE 1RI7A 2O7OA 3IFJA 4HBLA 2E1MB 3JRBA 4F50A 2X6XA 3K4JA 2KLOA 1K7AA 3ZPLA 1I3AA 1X3WB 3O8HA 2NVTJ 4MA0A 1Z7LA 1IGNA 4AYBE 3K4LA 3CCSI 1TC3C 2IN8A 2VBZA 3GTJJ 5J1UA 1HNWH 3AKZA 5CKTA 2TRTA 2YR2A 2JRTA 3FM3A 1BNCA 5KFKA 4QW8A 2IMWP 4AUXA 2VBWA 4FASD 2WAEA 3OS1A 2RREA 1Q1VA 3H0GA 3RGXA 2LBFA 1QGPA 2OC6A 1E3OC 2R8HA 2H1LA 3OORA 3GV8B 1OMIA 1LPQA 4IQJA 3HRUA 4DV5H 3EUHC 5DGAA 5KFTA 1USSA 1GV2A 2I8CA 2C2RA 1O75A 1LFPA 1UELB 3HYJA 2R0QC 2SCUB 2R7DA 1O3SA 3RAQA 5E3MA 1MBEA 4DYRA 5DUKA 4MV7A 1YIOA 4HDVA 3PO3J 1LE8A 5B5EC 1DP3A 2E5ZA 3ABMH 1U8BA 3I9V2 3KALA 2DW4A 1JTYA 2FK2A 1XCBA 2V9PA 3VYSB 3D1NI 2XIGA 1ETWA 5FGMA 4X64H 4ECUA 1Z2NX 2R7MA 2L0KA 1OCCH 2L8LA 5KT2A 2MLKA 4MLOA 5H20A 1GSHA 4IPAA 1ETQA 4L5JA 1O3TA 1XDUA 4HX4A 2PQ8A 2VQDA 2JA6G 4IHSA 1FJGH 2HQAA 3K10A 3FXKA 2IGKA 4LJZF 3E54A 4J9QA 2ELJA 1HKSA 1B8IB 2RNJA 1TAEA 1TWGJ 4LG0A 3EETA 3H20A 2KKOA 4ZYEA 3ZP5A 4A3BJ 4XYMB 2V1DA 2FQ3A 2GA2A 4IZOA 3IH4A 3N4MA 1BI2A 3GIQA 2QVOA 5K2MA 4EGJA 3KAKA 3I53A 3WHCA 2XGPA 5JHFA 1IO2A 1YYVA 2VT2A 4YIRX 1LKXA 5LP6F 2E35A 5L3DA 5LD2C 1J75A 5E5OA 1BW6A 1Z0XA 3WTWC 3OUZA 2DQLA 3F8NA 2BXZA 1JKQC 4ED0A 4V2GA 4DIQA 4XRMA 4LK0F 4YFKF 4IRDA 3K6GA 1UCRA 4IQ4A 1MBGA 3JR9A 4UNOA 3KX2A 3OOPA 3QPHA 3U9TA 5ILVA 5KG7A 1ZR2A 2KEQA 2DPDA 4O3MA 1DQ3A 1EKEA 4J9RA 1K6OA 1WHUA 2DMNA 4ECXA 3DLAA 3A01B 3FMAA 5KFEA 1KU3A 3A0BC 2PMUA 3RKQA 2IA2A 4MA5A 4O4LF 5LRSA 2LQMA 2IN0A 4XL9A 4KJZA 3OYDA 3BJ6A 3BQYA 3PO2G 3WG7H 2WYOA 3QQAA 4GYGA 3RFCA 4LF9H 3F0CA 1SD5A 3PSIA 4AADA 3H3VH 3LMLA 1T6SA 2W71A 4QIWE 4LITA 1X1DA 3ZXSA 3GTGA 2FK3A 4M9ZA 1OCZH 1SFXA 5FFXA 4EEFG 4CC5A 1LB2A 2ZXIA 1ETYA 2FQ4A 1TZLA 2CGPA 5KG0A 2VQCA 2OF7A 1O4XA 3K7AJ 2IPQX 1Y56A 3MWMA 2XSDC 3HDDA 1K83A 5KNLA 3OYKA 3S8PA 3RGZA 3OYJA 2VJJA 1EJ9A 1S29A 1E0EA 4J0MA 3HOZJ 4BHPA 3GBGA 3NRVA 2H27A 1YE9A 4IEJA 4PGHA 4GKJH 3S3NA 2HDWA 2FX0A 2V1NA 3LSIA 1JJ8C 2L01A 2JA8J 2XAUA 4BAYA 4IHWA 1X1BA 1Y6IA 1SANA 2DFHA 4LB5A 3BZKA 3TQTA 4J9SA 5LEKA 4AIKA 2KZGA 1SEUA 2EZIA 4RNOA 3G1MA 2XGDA 1Z3YA 3P9KA 2FE3A 3S16J 5FKOA 2LVSA 1FTZA 5KFJA 4G6QA 5D6FA 4LX3A 2CV2A 4Q4ZF 2P8TA 2ZMEA 2YS6A 1KJ9A 5KFIA 1S97A 2DCEA 4L9NA 1FNNA 2EJRA 1F9NA 4HF0A 4PFPA 1WJAA 4BUPA 2YCHA 3L2VA 2NRAC 1G6NA 2QZ8A 4UN7G 1OFCX 2HYFA 2VQLA 2VC1A 4EJTA 4RGUA 3JRCA 3H1CA 3FXRA 1XTAA 2Y30A 1GV5A 1ZGAA 2F4VH 3K0LA 3W3CA 1AU7A 3BY6A 3FKIG 1YJ9I 4LFBH 1S5LC 3DU6A 1VTNC 1FOYA 4UY8I 4RLFA 3CCVI 2PJRA 2F4IA 4GC6A 1SMYF 1UAAA 3IHUA 4HOBA 2DJIA 3O2PE 4CCKA 3DKWA 3RDIA 1OCOH 4CA0A 4GDFA 4A3DJ 2ASLA 3K4CA 2EFWA 1E4EB 3C2HA 5CJ9A 4EYHB 2HQNA 4J9NA 5JUMA 1WRJA 4R79A 4Q45A 2A6EF 1KC7A 3MR2A 1UG2A 2LMDA 1DGRM 4AIHA 2R82A 4B3MH 4FQGA 3H3UA 5K1YA 4PWQA 4HX8A 1BC7C 3MISA 1JT0A 3JRWA 3T1HH 3HYIA 1K6YA 5FLXZ 2LBFB 3H0GG 1KA8A 1FC3A 1OKRA 2CU7A 2F4OB 3AAFA 1S8NA 1CQJB 3CQZA 2DN0A 2NNNA 5KCMA 3HRSA 5HLHA 1U3EM 4TV8F 2DMUA 5E1ZB 3VDXA 1MNDA 3CLQA 3OOUA 4KISA 3VMMA 2HWVA 2X85A 4ZYDA 2R7SA 4ASNA 2VODA 3GTOJ 1B6RA 3HOWG 2EB7A 2CMPA 4QPOA 4DBQA 5KFHA 3HGGA 4JI1H 4NLGA 1YLFA 1H88C 3OIPA 1SD7A 2FEZA 3V8JA 2OUMA 4N9HA 3SI8A 2ADUA 1RYSA 2OCEA 2ZXHA 5A0WA 4EJWA 1KU2A 2EIMH 2FNPA 2RKHA 3PQJA 4I0AA 1VQMI 2ME0A 3KZIC 3TQ1A 2L2OA 5E3NA 2J9GA 3O6BB 3I64A 3UFXB 5DUIA 2XASA 1B72A 1T94A 2HOEA 1XDNA 1YOVB 3WTVC 4F3QA 1REPC 4BJTA 2FJZA 3MWEA 1VQKI 4BGDA 4D0PA 4RZRA 1T56A 4CUGA 3IH3A 4I7HA 4RDUA 2W8KA 5HNFA 3G73A 4B3SH 4DQ2A 2BYVE 3RKXA 1R6RA 1IUFA 4G6TB 3SFZA 2K9LA 3QRFF 4BY1J 3K4BA 1IOWA 2FBIA 5IP9G 2IA0A 2MH2A 1PUEE 4DR7H 3CUQC 3REOA 4FE7A 2VPLA 1IUYA 3HG9A 4FBTA 2EQRA 3EUKL 3BJOA 4RB0A 3SEZA 3VYUB 1ODDA 2FA5A 5KFUA 3F9KA 4IJAA 2F5CA 2L9NA 4NQWB 4I09A 5H6RA 2BZTA 1JUMA 3RZDJ 3N6XA 3SDBA 1DUXC 1HW5A 4PJLA 5IOZA 1X1AA 2KFDA 1HF0A 1FOXA 3WTYC 1FZPB 1BJTA 2YU9A 3RB3A 1YQAA 5ILUA 4R8HA 2EIKH 1DPRA 4A3DG 1M1EB 4J9PA 5GAEJ 1EV7A 2FKLA 3LQQA 5LRRA 5B1AH 3DQVC 4QLCU 3HSEA 2NU6B 1ZETA 4UN9A 3BR3A 3DTIA 4XKBA 4I55F 2XCAA 3MZ8A 1RUNA 1Y14B 1Y1VG 4ED3A 3RTRA 2DT7B 1YO5C 1ZRFA 3JTHA 5CVRA 4LF6H 1ETOA 2F5DA 2NOGA 3NWTA 2OWOA 2ZM6H 3O8GA 3MMYB 1SFEA 2YL2A 5GP9A 3L2CA 5HS7A 3FXMA 3HUGB 2WTEA 3GTMA 1QPMA 1JTXA 2CSOA 1GDTA 1FBQA 3FXUA 1IG7A 1TLHB 4IRKA 3NAUA 2L9SA 3Q9VA 3ZR8X 5HS8A 3Q0WA 3OYLA 5HLGA 1P8LA 5KFFA 4YP3A 5HNHA 2FJ1A 1MOWA 2W85A 4A3KG 1FKAH 2KIQA 2ZNYA 3KHHA 4LIUA 1NH3A 2JEJA 2P7VB 5M5YJ 2HPMA 3N43B 3KPHA 1MMNA 5F08A 5KX5F 1DV1A 5KFZA 1X3UA 5HBRB 2OCCH 3JRIA 2I8DA 2OZ6A 5ED4A 1DQUA 3T0YA 1KJIA 2IA6A 4DL2A 1WGXA 4L9TA 4M73A 2MG4A 4DGWB 5K5OA 1WFXA 2ECBA 2YSRA 2FBHA 1K78A 2R86A 1BR2A 3UQ8A 3C18A 3NZMA 4DL4A 4MFEA 5GONF 1WH7A 5ICFA 3RB6A 3FZVA 1FJLA 4IR9A 4RS8A 5FPRA 4Q8EA 1W0UA 4JV0A 2HYGD 2JRMA 3J81K 2Y75A 4XORA 1ERDA 3WE3A 2H1KA 1FBSA 5KFSA 3F72A 2RGRA 3COAC 4CZCA 2FUG2 1FOKA 4QWQA 1EH8A 4UNBA 3S2WA 4IKFA 2IA1A 4DJAA 2M87A 3OY9A 1XMQH 4JX5A 3TOAA 2ZXWH 2CV0A 2PLYA 5AK9A 3HOZG 4G3IA 4HV6A 3QPSA 5IYDJ 1GYFA 1FSHA 4Y8VB 2FBKA 1IAWA 5DD8A 3I3LA 5JVTA 1F5TA 1R1TA 3PO2J 1UNNC 1S0NA 4J9MA 1LWSA 1NK3P 1YRNB 4IHJF 5EEGA 4KN7X 3N05A 1QZEA 1N48A 3AG4H 3R0AA 3ZQLA 1BIAA 4EGQA 1A04A 2MGQA 2QKLB 1BN5A 1WKMA 5F9LA 3LNQA 2Q1ZB 2VKVA 4XMYA 1V3FA 5FKNA 1R23A 2HOSA 4KICA 4XSZF 4LSAA 4L5IA 2I3PA 3ONQA 4UB8C 2HS5A 3H0GJ 1XN7A 5L1LA 3T5KA 5E5SA 2BW3A 4BEHB 4MO7A 2XGXA 4G7OF 1W4MA 5FLMJ 2OPTA 4F92B 5JR3A 3R60A 2GIZA 2E1OA 2LKSA 5DYMA 3HEFA 3RSNA 4FX4A 3FK7A 4BXXG 1E2XA 4JX6A 3CJNA 3GYHX 3G2BA 1LDDA 4YIFA 1MJBA 1BI3A 1B24A 2JT1A 3S3OA 3CUQB 2JA5G 2R7RA 1S6LA 2QBYA 5DTDA 4ON0A 4O1SA 3QPLA 5CA0F 2ZBKA 5BQTA 4BNCA 3N41B 2NVUB 3CCRI 4UFZA 5J1RA 2RV8A 3T1YH 5JVGF 5AIPA 2YZMA 4L9VA 4BU2A 4HZFA 1ZTRA 3I59B 1OJLA 2JA5J 2H6CA 1MI8A 4IAJA 1Z6RA 4JI0H 2EFNA 4BL0B 1U2WA 2V1XA 3MR5A 2M30A 2Y9YA 3HC7A 4NUBA 1EZ1A 3BZ6A 3CCEI 1SVMA 2CQ7A 2ZJ2A 4HW0A 2XRNA 3RKYA 4XQFA 3RYRA 3R5HA 5E3OA 4R8UA 1M7JA 1RRJA 1C30A 2R93A 1FPQA 2QLZA 3ROUA 5KT3A 3L1PA 3HB9A 5EWGA 1I94H 4UUSA 3N97A 4UUVA 4ENKA 4A3GJ 4S04A 1J2XA 4B8XA 5EDNA 3G6YA 4HNVA 4RLQA 4EGZA 4KUMA 1EH7A 2JA7A 2JSPA 2R7TA 1XD7A 4Z1ZA 1MW7A 4XYLB 2Y0SN 5LFAA 2PI0A 1AKHB 2LCJA 2D1HA 2Q2EA 3RPUA 1MDMA 4UCRA 4JI2H 3DPUA 4P96A 2F2EA 3CCUI 3R23A 2B63G 4G94A 5AIQA 3BTJA 3K4KA 1IN5A 3JZIA 5L3CA 5H2FC 4BY1G 2VUGA 1WR2A 2JPBA 4LQ0A 4A2AA 3FBIB 3CESA 1ETKA 1R1VA 4M6XA 4EYIB 3E5NA 2IBKA 2VR1A 1DPUA 2HGSA 1I50A 4E7KA 1YFHA 5LL6b 5LMUH 1TWGA 1NG7A 5BMZA 2DYSH 4C2TA 1YITI 1IDZA 2FOWA 3FXLA 3M8JA 3KZZA 1TWCJ 3WTTC 2GBYA 3K2ZA 3ABUA 1ZLJA 4M71A 2DK5A 4D1QA 3M7GA 3OTOH 3DBLB 3F8FA 1BR4A 2MBFA 4I02A 4ZYHA 4EBDA 2R5ZA 1RK5A 3K1NA 1JI8A 2BQUA 3GZ5A 1UMQA 4C3JJ 4YHHH 2TCTA 3L2UA 2NU9B 4FE4A 5F1RA 2X0LA 4E7IA 3IN5A 3Q0UA 2DPJA 1OLTA 3MJFA 5KFPA 3T5XA 2E1MC 5FROA 3EH8A 2VPRA 4ED7A 4DYCA 2E1CA 2J5OA 2RDPA 2UXNA 4A12A 4ECRA 2LLKA 4FU0A 4GYIA 3H5NA 2DA4A 2VJIA 2VBJB 1VQ6I 3KAJA 4MV1A 4Z2YA 2XPWA 1RR7A 2R5YB 4Y15A 1VKZA 4ZQIA 2DPIA 2DT6A 3PW2A 3BG5A 4ECYA 1HR0H 1V5EA 2Y48A 4NXNH 1WJDA 2NAZA 4UN7A 2CQKA 1D0XA 4YELA 2VUMJ 3GTQJ 3NWSA 5K5RA 5FRMA 1W96A 2CJJA 4AD9A 1YW8A 3OSGA 3LA3A 2ASJA 2ZFWA 1V9PA 1FVIA 1ULZA 4XNFA 5JFRA 3W2WA 2HTSA 5H6QA 3IRRA 4BE1A 4GKKH 1D3YA 4L0YB 5HDGA 4DZPA 2VJ5A 1HW2A 3CCYA 1DIKA 1N32H 3EYYA 1MMDA 4C5AA 3I4NJ 2W8LA 2WADA 2LH9A 5LHHA 4GRIA 1FTTA 2VB6A 2CS3A 3F6VA 3FMSA 4JP0A 3G6VA 5HDNA 4O3RA 2LOOA 1XMKA 1XSVA 5F64A 4M3BA 1LVAA 3QFFA 2W9CB 4LLNA 3J81Z 2VBXA 2E7XA 1EYZA 4PCQA 4G7ZF 3K4MA 5CQEA 3CMYA 4S0HB 2R93G 5J8CA 2R8KA 2BQ3A 2UUZA 1VQNI 1MMSA 5BPIA 2IGNA 4H4KC 5K08A 4NBQA 1FWZA 3ZCOA 5E17F 4X1EA 2HDDA 1JXSA 4BBRG 2COMA 2GQQA 1IBKH 2OZUA 5GAGJ 1QVUA 4ECTA 4MQ9F 2XPUA 3G6XA 2O03A 3ELKA 2W48A 3H9QA 3GTGJ 4HSTA 1OYWA 2ESNA 4DR3H 2C2DA 3Q5FA 1HDDC 5A0MB 2X48A 4XLPF 4ABZA 1DU0A 3GCMA 1T08B 3UNGC 2VKEA 3PIOF 2GXGA 4CO8A 3EYIA 1TWFA 4A3JG 4HEA2 1MSFC 1TQPA 1I3QJ 3OYAA 4L18B 4CGZA 2C00A 5EEHA 3OSNA 4UCSA 3KFWX 2ECCA 3RBEA 3PN1A 3IH2A 2PX9A 3TOBA 1BP7A 3CDLA 1C0WA 2V5AA 4ZI7F 4A3EG 2FLDA 2DPUA 4EBEA 2GAUA 4AQYH 1S0OA 3HHHA 5KFCA 3B6CA 4JV5H 4BBSG 4CDGA 4B3XA 1JE8A 3HGYA 4I50F 5A78A 4DL6A 2OBPA 2OTLI 2DTZA 4D5CA 1A31A 1R5HA 2M7BA 1O7FA 5F1JA 5EEAA 1PUFB 3HHGA 1JT6A 4UN8G 4UHTA 2VBYA 1LEBA 3RBDA 1IN7A 3E6MA 1G8XA 3GVAA 4C3HJ 3PJRA 3LOCA 1YS7A 1W36D 2CFXA 3CTAA 4LF7H 1VQOI 1TWHA 3Q1KA 2OD5A 5DDGA 5C44G 2YU3A 3I4MG 1WJ5A 5GPCA 1RESA 2BVLA 2W7OA 4APMA 3RJ0A 1SVLA 2ELKA 1SCUB 1EF4A 4Y7NJ 5L3GA 3GTQA 2VUMA 3BP8A 3IAM2 2LSOA 5BNGA 4AU7A 3W2AA 4UB6C 2XGCA 5KHDA 4YITA 3I71A 3OYBA 2JJ7A 2AHQA 3L4JA 1UZCA 2CUZA 3G71I 2LTPA 1ZHSA 4DL7A 5E1XA 2B63J 5J4YA 2CW7A 3BQ1A 4E2UA 1RC9A 3LSKA 2IMZA 1KJ8A 1TQMA 3CCMI 3G1LA 3DEWA 1J7KA 4WX9A 1HCRA 5FPOA 2E7WA 2D1VA 2W4SA 2DFFA 5J4VA 4A3KJ 3OS0A 4AM3A 1MJ9A 1ZHQA 2Q2UA 5LMNH 4O3NA 1P7JA 5KFQA 2A6TA 1KU9A 2RAEA 2WAQN 3HRMA 3WE2A 3HOUJ 4R7RA 5E18F 4DW6A 1R9TJ 4WD3A 1XSXA 3BQ2A 3N40P 4YISA 2R8JA 3WTXC 1QHHD 3E6BA 4KA4A 1AF5A 4ECVA 3WU0A 4U6PA 3ZQCA 4AABA 4EEYA 2B63A 1JXLA 2FXAA 2JUCA 5KFVA 2LREA 4LGWA 2IS2A 2VOPA 1VQLI 2GXAA 2YX7A 4B1RA 2FLPA 1VQ7I 1N33H 4BACA 1OYYA 2DWCA 1K4TA 1T36A 2VPQA 5LA6F 2KDOA 2IGMA 2D5VA 4K0KH 1GVDA 2HTJA 3OYNA 2LY1A 3IGDA 4MV8A 2UVUA 4Y33A 1BGWA 3DU5A 4A3JJ 1T38A 2MCTA 5LYJF 2Y0SA 3TIIA 3JCUC 2M9HA 4QIWA 3TW7A 1Z1DA 3BDDA 4ECSA 4DOZA 3EDPA 3S2HJ 2A07F 4GFBA 1D1CA 1R4MB 3BC8A 2TDXA 4XOTA 1VS0A 2DIKA 2ZKZA 2XAHA 3T8TA 5DQIA 3JSOA 3H9JA 5EGOA 2CG4A 1T2KA 3JSLA 1F36A 4CYDA 4HPQA 3K1MA 4MIMA 2H09A 4F4YA 1GT0C 2LY2A 3H35A 1IRFA 4RMNA 2BHZA 1D5VA 1N56A 1UHSA 1I1GA 2VOBA 2MD0A 4PGGA 1OCRH 1SC7A 4XM3A 3VSLA 2LYCA 5E8GA 5GTIC 4IHXA 4ED1A 1I6UA 1V5FA 4C2MA 2R4GA 1M5XA 3I5UA 3MZHA 3CO7C 1X19A 3S1NJ 3H40A 2HKXA 2W9BA 4HA8A 3K5HA 2R7OA 2V7FA 4J9LA 2BGCA 2PN6A 4LLLA 4EJOA 5B3SH 2PBZA 4X6AJ 3T5JA 1WI3A 4JQFA 2VA3A 3IAS2 1D8JA 1B59A 2VKHA 1I6XA 2GOXB 5J6XA 1BXRA 2ZO4A 1QRYA 1PK8A 5DLFA 4JI3H 3ZMTA 4R1HA 3MKWB 2JEIA 1U5TC 3A03A 2W9CA 5DG7A 1Z7UA 2QKMB 1B9MA 4GO1A 1AN7A 4WK8F 3RPUD 5ERIA 2HOAA 5C3EG 5BPHA 4J9OA 1MNEA 2YS7A 3KP4A 3C2GA 4ED2A 2HQRA 1Q1HA 4DUZH 2A6HF 3SQNA 3OYMA 1KONA 1GO3E 4KZSA 2ALZA 1VQ8I 4MQVA 2WDTA 2LFBA 4EJUA 3DKXA 3A2KA 2QSHX 4NB5A 3N8DA 4JUZA 3RV4A 4BH9A 2FLNA 4QFQA 4QWCA 1ON2A 4A3FJ 3C0XA 1QO0D 1XMOH 3I12A 1RNLA 2AU0A 3CJQB 1CQIB 1W7PB 3TO6A 2CQQA 5F9NA 3QQYA 2F6CA 1MBKA 3A4CA 4MHGA 2QENA 4A0YA 5BPFA 2XUBA 4MAMA 3V7SA 1D1BA 2QYOA 1ZLKA 2RF4A 3RTXA 4DLKA 2HPIA 4AC0A 2P5KA 2HHHH 1E3PA 4PSXA 2FPGB 3GXOA 5D5VB 1GLVA 5FD6A 4F93B 3OWTA 1VZ0A 2AS5F 4KNYA 2X6YA 1BM9A 5KFNA 4N4NB 5M5WJ 1XNRH 3M9NB 1M0WA 1JHFA 3B02A 2HKOA 4EBCA 4A6EA 4ZZDA 5JLXA 4GXOA 2G7HA 4UUTA 1HLVA 4X62H 3M4IA 2VBNA 2RQPA 3OYEA 5H80A 1VQ5I 1FLIA 4QW9A 1IN8A 2E2IJ 5KG2A 4KYWA 2ISYA 1YIJI 3I54A 4UXNA 3ZMZA 3WTUC 1FYLA 5GTHC 3J80Z 4E70A 3LSGA 2EZHA 2L02A 3BR6A 3Q8PB 3LSTA 4BY7G 2ZSHB 3R5XA 2R8GA 4BE2A 2VQHA 4P1WA 3W2VA 5JHUA 1Y0NA 3Q0VA 3BQZA 4DYQA 5D4RA 4BQAA 4IRIA 3ZQ7A 2UUBH 3BCAA 4OIPF 1ZD7A 3IP4B 1A6QA 4A2UA 2IGOA 2X6WA 3PR5B 4OIQF 2UXCH 4FCYA 5DCMB 2GA1A 1W93A 2NS7A 3FHZA 2DA3A 4AAEA 4PK4A 4NDLA 4IHTA 2VUMG 1XPXA 3PFYA 1VDEA 1GXQA 2VBOB 4DNCA 1POGA 2DDAA 4DV7H 4O2BF 1R5ID 3QOPA 3RF2A 3VPCA 4UNAA 3KYLA 2BY3A 5FLVA 1Z91A 1K1SA 2YYAA 4FX0A 2VASA 5DEQA 4EGYA 2JMZA 4PJJA 1QQIA 5BR8H 2MH9A 3IRQA 4HF2A 3DPLC 2WB1N 4A3MG 2NUAB 2C28A 2L5QA 3R5FA 1V4YA 1FY7A 3DCFA 2XPVA 3GTLA 1XCVA 5IYDG 1H0MA 2XF6A 2AGPA 4LH6A 2JPCA 2V9KA 4QWAA 4CH7A 2GM4A 3QPTA 3HOSA 2YRXA 4UCVA 4E4HA 3S1QJ 3NGDA 4F91B 4FBUA 4LMYA 3I59A 1N36H 4JK1X 1G4DA 3DF7A 1S7OA 4DV6H 4LLGF 5HDKA 2UZKA 4F7ZA 4G12A 2YZGA 1S7EA 2AQEA 1O3RA 3C1DA 1UC8A 2V58A 1WH5A 4UNCA 1JKJB 1ZAOA 1X4PA 1HNXH 4XSXF 2DMPA 3PNTA 3HBLA 2V9VA 4IWXA 1YTYA 1V4RA 4PFOA 2JA2A 1B1BA 1CGPA 3N42B 4YR0A 3VODA 1ZKGA 1ULYA 2KZVA 2R7ZG 2FD5A 4CZZA 1TQIA 1P2FA 2DFIA 3F23A 3S2DJ 4KMFA 4FM9A 3RJPA 3U9SA 2RC4A 2J6TA 2X0SA 2CQNA 2W6OA 2V4RA 4JYKA 4D7MA 1W5TA 1C3OA 5EDWA 4GGGA 3P5JA 3U2RA 1CF7B 4LSXA 1X2NA 1MMAA 1UHWA 2HXOA 3NEUA 5LEJA 3PIPF 1S03G 2K3FA 3PFIA 2IS1A 1RJQA 3OHBA 2P6SA 2M7AA 3HKZN 2M4KA 5FD5A 5F0HA 2O7MA 3RZOJ 2G7UA 3MKYB 3MFKA 3BT9A 5DD4A 5HLIA 4CXFA 4HV5A 5EG0B 5EZYF 1A6IA 3BG7A 5LXTF 5KFXA 2DI3A 5F6FA 3ZQGA 3WTZA 2L3DA 4RM3A 1R49A 3BR0A 1G2HA 4LF4H 4B48A 3KIOA 1AHDP 1F4KA 2YRWA 2QF7A 5CAEB 2RVCA 2VQFH 4DV0H 3AFHA 5LOVF 4C3IJ 3O3KA 2UXDH 4MTDA 4CSWA 4IHYA 2WE6A 5CYVA 2AGOA 4K2EA 5ICCA 5FJ8G 3BABA 3KP6A 2H8RA 3J7AK 4XZ3B 1U5TB 3K4NA 2E2HA 4A3LG 3CQZJ 1ZARA 2BR0A 3CDHA 2EFOA 3VPRA 5KFGA 2RGVA 4U88A 3AG2H 5HODA 1K78B 1YJWI 2OAZA 4KL6A 4J9KA 2QK4A 4OX9H 3GTKA 4BS9A 1T98A 1H8AC 3L2RA 2LG4A 4YR2A 3PW7A 3WODF 1X1PA 2A5YB 2KJCA 2JMWA 2WC2A 3FBNB 4Q43A 1LJ9A 1J5EH 2LY9A 4Q48A 1A0IA 4TQRA 4O3SA 1ONVA 2XAFA 2GWRA 3J81W 1ZG3A 4A0XA 3RAXA 2CWEA 2NVYA 2EFPA 3GWZA 2C6YA 3FMQA 4XRFA 4Y17A 1OR7C 1N34H 1I27A 1FMVA 3QZ8A 4RB3C 2E71A 3QYEA 2Q2TA 2W24A 4ANJA 5EF6A 3HTUA 2JEGA 3TKYA 4DR4H 1VBGA 2DLLA 5KFOA 5BOXA 3HTSB 5D4SA 3CDIA 3CMEI 1HA8A 2E5LH 3M8EA 3RQIA 3FX3A 1TA8A 4XN0A 1FEXA 2ELHA 1CQTA 9ANTA 2CZGA 2GPSA 3LSPA 4WBNF 3HPHA 2KT0A 4HNTA 1MZBA 4HX7A 2Y69H 3V4ZA 5IY5H 4N0BA 2ISZA 1DGSA 1JHHA 2XC9A 4M9UA 2IW5A 1JIHA 2EFQA 5LLQA 1LFUP 2Z9OA 1DFAA 4G8XA 4NC7A 2XGQA 2ATLA 2P6TA 4BDYA 1WCMA 4WXDA 1IDYA 2N8GA 1P4XA 3R7PA 1A9XA 3T5HA 2KL4A 3LWFA 2IP4A 2JTVA 2VOOA 2XC7A 2DODA 1H89C 4BQOA 4OIOF 5K7HA 2AO9A 2H8WA 1UG0A 2ZDGA 2EH3A 5GADJ 2O9LA 3SHFA 3G3ZA 2Q2EB 5FKMA 4XLFA 4MV3A 5J1YA 1OR7A 1J09A 2EPFA 1QBJA 4ECQA 2JN6A 2KPMA 2VQGA 1TBXA 2EA4A 3E6CC 3V4SA 2JA6A 1E3HA 3A0HC 3J7ZI 2F5FA 1JGSA 1VF9A 2VKDA 3HIFA 1R5GA 3KYDB 3CCLI 3RI4A 2UVVA 3FF5A 3GIJA 3AYHB 2VC0A 1S7AA 3QP5A 4UUSB 2HFHA 2PMHA 1TWHJ 5J2TF 4CYCA 2HQ5A 2WV1A 3DKYA 3S14J 4D7NA 3L4KA 1R00A 1IRZA 1HXDA 2VIXA 3DWLE 2JK3A 3QYFA 3S93A 1WSCA 4OOIA 5JLWA 5IT9K 4R8UB 1D0YA 4L0ZB 2IS4A 2ME6A 2DFEA 4UN8A 4BQQA 3JAMZ 5IYCJ 5IP7J 5EWEA 2EIJH 3GIKA 2VI6A 1W7PD 5FO5A 3DV8A 4KHPH 2VL8A 1ZG5A 2ICWG 3WO0A 4M7EA 4X65H 5KKNB 2F5VA 3TP3A 3VWBA 2R8IA 3JRXA 2DQRA 1G3WA 3KP2A 2FSWA 4ZC3A 3OYCA 1JLLB 5T14A 3CUOA 3M1CA 1SEIA 3ZQIA 1WJCA 2FNAA 3RIZA 2C22A 4F4XA 1W36C 4TUYF 2OLSA 5IWAH 3OHAA 3BTCA 1N78A 1GUUA 1I3QA 3IKTA 3V6KA 2BQRA 2ESHA 1WH2A 1WCMJ 2WA0A 4RUCA 4IRHA 2GLOA 3CC4I 1I1SA 3OYHA 4RNMA 2JZYA 5TISC 2VXDA 4O4IF 2WTFA 1IXRC 3VEPA 3FXJA 1STZA 3H4BA 2XB5A 1MMGA 1F1ZA 3FK6A 2IBDA 4HLYA 4B47A 1DP7P 1WQ2A 4PUSA 1O7LA 3M9AA 2LC2A 1IW7F 3GW2A 4OAZA 1KU7A 3H0DA 5CVVA 2DMQA 2IVMA 4UV9A 4AAGA 2DA1A 2R7KA 3E1SA 2P81A 1QU3A 1B33N 4TQSA 2BXYA 3PO3G 5EYRA 3LP8A 1T95A 4FT8A 3ZMUA 3AL0B 4ME6A 4KIFA 3Q8RB 5E3LA 3CP8A 2CUJA 3JSPA 1JDEA 1B9NA 4NHJA 2YUSA 4E7SA 1U0JA 3IWFA 1UM2A 3U1KA 1ZHFA 2B0LA 3V8LA 3R0JA 3Q8QB 3F8CA 2K02A 2XE0A 1DU6A 3UVFA 4U0VA 4J19A 4C30A 1WI9A 2DT5A 5KT6A 2A68F 2DZDA 4EVIA 2KRHA 2HR3A 5TJJA 4LB6B 5DCFA 5IPAA 2HI3A 3GF2A 3T1BA 2WV0A 4ENMA 4HQ6A 2EINH 5LBQA 4L1KA 4RNNA 3GTPA 3V4GA 3QU3A 3TW6A 4IWYA 4YJ2F 2DYRH 1WVRA 3BPVA 3IKVA 1G3TA 2LK2A 3LSRA 4Z1XA 3K9TA 4KITB 5FRNA 1MNMC 1KYWA 5IYBJ 2XVCA 2KIUA 3EUAA 3ABLH 3E7LA 3GO5A 1MBJA 1BL0A 2ZMEC 4KFCA 4A5MA 5KT4A 1WSUA 5BPDA 2GOMA 1S10A 4NC6A 4A3GG 4ENJA 2PFBA 5L3FA 1EUDB 2F4MB 4KIBA 2VXZA 2QQAA 4A3CJ 3FISA 1DV2A 1VNDA 2MA3A 2W7PA 4B3RH 2DO7A 3CC2I 5EG0A 2W9AA 4EFBA 4G9YA 4ZZLA 1XGOA 3BLYA 5HOOA 3HOXJ 3RB0A 1GVJA 1QNTA 3GV7B 1PJRA 2EV0A 5GPAA 1HNZH 2J5PA 3FM5A 3ULQB 3WU2C 1TWAJ 2EK5A 3SZPA 3BA8A 1IOVA 2W6NA 2RDIA 5A2QK 1HDPA 2A69F 1HSTA 5K7FA 2IT0A 2MC4A 2WWYA 2XF5A 3GIDA 1LQ1A 1BW5A 3KLNA 1VQ4I 3ASOH 1YX5A 1WPKA 1T39A 2RNGA 3HM5A 4BXUA 2FB9A 1U9OA 1Y8RB 4EQQA 1R36A 1YJNI 3X2QH 4XRSG 3IV5A 1Y1WG 2DCHX 2EX5A 1HKQA 2X6OA 5C1PA 3WNZA 2QM3A 2R84A 4EM2A 2BE5F 2X9DA 4YBZB 3H4DA 3RQ4A 4GLXA 3J7YJ 2CV1A 2MLGA 4P5OA 5DS9A 1WZ2A 2BY0A 2FF4A 4BXXJ 5C8YF 3LSMA 2NU8B 4DR1H 5LGNA 4WWCA 1KZHA 1KQ9A 1Y1VA 3C0FB 3P7NA 4U87A 4JI4H 1L0OC 5DLGA 3LAJA 5KK1A 1N75A 2MSYA 3KLOA 5J40A 1TW2A 4L9JA 4M6YA 3E5QA 4CICA 1M6VA 1MGTA 4B43A 3ZQFA 2J6SA 2JUGA 4JI5H 1YS6A 1R22A 1YW7A 4PJNA 1FP2A 1WJBA 3E0JB 5E8IA 3N44B 4AYBA 2JA8G 1A5JA 4LF8H 1XMAA 5C4XG 4Q47A 3PR4A 3MX9A 2Y9ZA 1BOBA 2W1OA 2WY8Q 1S3JA 3JREA 1Y0UA 4CYCB 2BEOA 4OMZA 3QWLA 4JV2A 1GHCA 1ZQ7A 2OTJI 4GC7A 2KSWA 5K5QA 4XR6A 1B8IA 2XSJC 2VBOA 2FP4B 2R3SA 1ETVA 2CW0F 3U9GA 4BYYA 2V6EA 2YX4A 5JH7F 3FXOA 4XICA 1IBMH 1T9JA 4ZDPA 4HYEA 5KFDA 3P9IA 4A69C 2F4LA 1BBYA 2DA7A 3VFZA 3JSNA 1MJAA 2I80A 2QSGX 5DQGA 2K9SA 5DCMA 1Z9CA 1JUPA 1A36A 4EFEA 4YRVA 1ZN2A 3PQKA 5IYBG 4OU0A 3GIIA 1JJ6C 1RUOA 3K2AA 3ERMA 3NARA 1QPIA 2Y31A 1U6GA 2DDBA 2P0AA 1FT9A 3OR1C 2QA4I 3JAMK 1U9NA 3E97A 6PAXA 2FK1A 2ZXJA 3WHBA 1DGWY 2BVMA 4LFCH 3V7RA 1LE8B 4MGRA 4IR1A 4YEJA 1PP7U 3GTLJ 3C7JA 4RGRA 3ESWB 2E2HJ 1Z21A 4F52A 2L7MP 5FLXK 1MSEC 3LWBA 1P8KZ 3G1OA 4HLXA 1XGSA 2DAOA 2QWWA 4Q44A 2HDCA 3CJTB 1XSDA 1VI0A 2ACJA 3Q8SB 4JI7H 1Z05A 2M8GX 1KYZA 1T0FA 4AIJA 4A93J 4Q5SF 3BG9A 5CVJA 4KN4X 1JKPC 3H5RA 2BW3B 2OJED 2R7FA 4BEHA 3M4OJ 2EV6A 5D8DA 2E2IA 3VYTB 1E4FT 2KRCA 3F21A 5D1PA 3WO1A 1TT0A 5FKLA 1APLC 4O3PA 3S1RJ 4KDPA 5D5WB 1LDJA 3QODA 2GPWA 2XCLA 4UCUA 3F6OA 2L4MA 2DA5A 4ZJZA 2MD5A 2X1EA 2P4WA 3DTKA 2KISA 1K4SA 1G9ZA 5GAHJ 2M3AA 4MEXF 1BOAA 3SFIA 3OS2A 4E6KG 3UR3C 3GIPA 2V4JC 3HL2A 3IG0A 3FKJA 1R4NB 3CCQI 2R7QA 3GTMJ 3CJRB 4LG3A 5J2UF 4YR3A 3CVZA 1R7MA 2AXLA 2F48A 3MN2A 2RQQA 2I5UA 1WJEA 4JOMA 4E7HA 2H94A 5KT7A 3ZN1A 2DJNA 1UJ8A 1U5TA 1IBLH 2MW8A 2Z3YA 2LWYA 3GTJA 4RAYA 2A3SA 2WB1E 5L1KA 3PZPA 3OUUA 1HQCA 4I99C 1D5YA 5EJCA 3MFIA 5CB4F 3AG1H 3JRDA 1TL8A 4DL5A 2R93J 5F0FA 3RPQA 4ETSA 1FYKA 3HOYJ 4U0WA 2XE0B 2QQBA 1D1AA 1D8KA 2K40A 3RV3A 5JI6A 2Y0MA 5IP7G 3OSPA 4EG0A 5F04A 4M3GA 4RAGA 3RB4A 3HRTA 3K5IA 3FKIJ 1DDNA 1I5ZA 3KP7A 4RGSA 2NVQJ 2MABA 4EM0B 2KRFA 3GV5B 4LFAH 5CQGA 2EV5A 2EILH 5FJ8J 3FDYA 1PDNC 5IP9J 1RKTA 2OH2A 1PYVA 3GFJA 2V59A 4PDKA 2LKXA 2XHKA 4ZTFA 4ZYGA 4HDUA 3BTLA 4YY3H 1SFUA 4U7BA 4RBOA 4KIGA 2DXIA 4XK4A 2E1NA 3GFLA 4YQWA 3MR6A 1AM2A 4RAZA 2NU7B 3ORQA 4I4TF 4XLEA 2HEOA 3PW5A 4J00A 1JVAA 2QGUA 1W5SA 3KHRA 2EWNA 3M3YJ 1L2ZA 3DTEA 3PUBA 4OWRB 3W6JB 2O8XA 3MXBA 1XC5A 1YG2A 4AAFA 4DV1H 4DBRA 1CS0A 4XRSA 1JX4A 4JBAA 3DBHB 2IXSA 4UVCA 2EZLA 2XB0X 2XDVA 3KCCA 5KFYA 4DR2H 4LOXA 2L4AA 5E1WA 3OL3A 2RDJA 2R7ZJ 1TT5B 4BKXA 3QU6A 3VOEA 1L3LA 2NVXA 1GLNA 2XD4A 4QJFA 4NQWA 3BR2A 3ZGKA 2AQFA 3G6EI 1RIOH 3FD2A 4OMYA 3B73A 2JA6J 2W70A 4C2MJ 1ENHA 3ASNH 3DF8A 3DFGA 4IVNA 3E6DA 3R61A 4B09A 3JRFA 1PP8F 1AKHA 3D0SA 1ZRCA 1AUXA 2XRLA 1MH4A 3DP7A 2O61A 1TW3A 2CYYA 4IF4A 3OYIA 3HZJA 2Y0SE 1FIPA 4BE0A 2LP0A 4M72A 4XLNF 1E4GT 3FIWA 4WXCA 2UVRA 2KP6A 1BJAA 3BPXA 4LG0B 4FTHA 1K1QA 3PUFA 2M05A 3JAMW 2P0WA 1BC8C 3LMMA 1J59A 2XCPA 2M34A 2PVPA 1ITYA 4IL6C 2B9SA 4DV2H 2PG4A 3RCOA 1P6RA 3MZYA 2HU9A 3NQOA 4WCGA 4FS2A 4I01A 3QYBA 3MCZA 4RB1A 2QEXI 3CLOA 2V26A 4P55A 4BHBA 4C2UA 1XS9A 2DK8A 4UV8A 2ID6A 1J9IA 4AYBN 1FBUA 1W5CC 2MYSA 3GZNB 3PNYA 4ITVA 3R6SA 3TP0A 4CCLA 3CCJI 1ZDEA 1PX2A 1WWXA 3S3MA 3RUPA 3VPBA 5CA1F 4BJ5C 4UVBA 2PN1A 3BROA 1D0ZA 1ZG1A 4UVAA 3HKZA 3KHGA 3EPIA 5DM6F 3LQRA 4Q0YA 2JNQA 4X66H 3D5LA 2QUFA 4BQNA 4IOCF 2UV1A 2CFOA 3ML6A 3TMOA 1K61A 1MIJA 1S0MA 4CCOA 2P5LC 3MQ0A 2OU2A 4NXMH 3IUOA 2XROA 2I3QA 3L9FA 4I0BA 4QTRA 2MFZA 2UWMA 4E7ZA 1GGOA 3MFHA 4YFNF 2Y2ZA 4E7LA 2QBYB 4KL5A 4TV9F 1QVTA 3CUQA 4I2OA 2VS8A 3A1YA 3KXYT 1UB9A 2XAGA 5LHGA 1YHQI 1NK2P 1MBFA 2V4QA 1R58A 3BZCA 3GTKJ 4MTEA 2IS6A 5D6EA 1TTYA 3M9OB 5F27A 3VSKA 5DM7F 1WJFA 3U1DA 1AT0A 1TWCA 4DV3H 4MV9A 2PJRB 3GFMA 2WB1A 1V55H 4XKWA 3MIPA 1W0TA 4FISA 2V1UA 1OISA 4XIDA 2UU9H 4JV1A 3KP3A 1VFCA 2DU9A 1W7PA 3LSHA 5IYCG 1AA7A 2K7LA 2YZNA 4E2TA 1UC9A 4IRCA 4XN3A 2QQ9A 3H9GA 1X3ZB 5BS6A 2EBIA 2VONA 4UCOA 5C44J 4X0GA 5JVDF 3QZ7A 1O3QA 2H6BA 2IRFG 4RU9A 3K70C 2AXTC 1XG1A 2ZDQA 5EOYA 1N3EA 1B04A 1LUJB 5IP6A 3QOEA 2R92J 1EA3A 1FX7A 2I87A 4RZQA 3WGIA 5D5XB 1Z2PX 4M9XA 1RYRA 1NG6A 2X1CA 1P9QC 3K69A 2VBLA 2W6QA 3SE7A 2W57A 2DOFA 4LIVA 3FXQA 2ZC2A 1QHGA 1T8IA 1QA6A 3ZOBA 2NS8A 2MC3A 5M3FJ 4ZOLF 1GXPA 1BI0A 1MBHA 5FKKA 2IAIA 3OMYA 4YG2F 3CMMA 5AONA 2FMLA 4A3BG 3KE2A 4HG2A 4A3IJ 1FYMA 4LH7A 2E36A 1V51A 4MV4A 2NXNB 5CLSA 1T33A 3TO9A 2O5RA 4WXHA 3BCBA 3SZTA 1Z6TA 3UKGA 3S1MJ 1YX3A 1TWFJ 3ABKH 1ZK8A 4RB2C 2C35B 2W9BB 5L1IA 3IC7A 5E79C 3OYGA 2IEKA 1ZRDA 3MWDA 4XKCA 3S17J 4CCJA 2C2EA 4G7HF 2O0YA 2YW2A 2OQGA 1CF7A 5KG1A 1KQ0A 3TINA 3GMEA 1Z2OX 2R85A 3HOVJ 1ON1A 4A3EJ 3HUGA 4N4OB 4CCNA 2VBJA 2UUAH 3AL0C 3W6KB 2DMTA 1S68A 1NHAA 4PZJA 3ORRA 4N9IA 2FOKA 4Z6YA 3LA2A 1IXCA 1KEEA 3BAAA 1LDKB 3L00A 2XGEA 4JI8H 1J0RA 4QPQA 3HSRA 5DGBA 1IV6A 2BV6A 5EGOB 3JRHA 2K4JA 5BMVF 2K9QA 3GLLA 4BY7J 1TP4A 3J7AY 2DOEA 5IT9W 1I39A 2JQ7A 3B6AA 3SXYA 2VPSA 3OOLA 1Z77A 1NTCA 5B66C 4CC6A 4O2AF 5LGTA 1JKOC 3HXLA 4D6OA 3GUDA 4OAYA 4U0YA 3C0WA 2QSFX 3LAPA 4ZTJA 5EWFA 3G4SI 3F8MA 1IRXA 1OPCA 2K85A 3WU1B 4EATA 1HKTA 4V19K 2R7NA 5A2QW 2M45A 3CF2A 1P4AA 2KQRA 4WF2A 4A5NA 4GIGA 4A93G 3LL7A 4DUYH 5FB2A 1LFBA 3OIOA 2F5EA 1FSEA 1USTA 1Y1WJ 3V6JA 1IN4A 2CUEA 5AKMA 3V7CA 4IX7A 4II2A 4A0ZA 1SMTA 2ID3A 4XLCA 4LF5H 1Z3XA 3ETHA 1VBHA 2FPIB 4B3TH 3ZN0A 4KMUX 1XB4A 4M3DA 1EF0A 1I50J 3TBIA 3TEDA 4F4ZA 2R7UA 3E5UA 3I56I 3A02A 2R7XA 3GLKA 3T5LA 4B3AA 2HVSA 2A61A 3GTPJ 2IJLA 1MDMB 2NVYJ 1Y39A 4XLHA 2BY2A 3KZYA 2CQXA 2K5CA 1VAJA 4HR7A 3PVXA 5D1OA 2ZSIB 4NNJA 2X51A 1OYIA 2HYJA 2DA6A 3E3VA 1O57A 1OCTC 1N3FA 2ZJTA 3L2QA 2KDZA 4YFXF 2CH0A 2STTA 4ZDOA 1F43A 5IT9Z 2KHMA 2L7KA 1SVOA 3HPGA 4RGXA 4ZYAA 3RYPA 3SZGA 4HYKA 5C1OA 1IN6A 4BBSJ 2P5VA 3DXJF 3FWEA 2QYZA 5KFMA 2VQEH 3ABTA 1KGSA 2L9VA 4GCVA 4NC8A 2PBIA 3KHLA 4I76A 3MEXA 5A72A 4C5BA 2A5WA 4O1RA 2K9MA 4D6NA 3CO6C 5HVQC 5CVUA 2I10A 2VBNB 4ECWA 2L54A 4KT5C 3WG9A 4M74A 2ZDHA 5JVLA 1B4AA 2YPRA 3L2PA 2LR8A 2JA7G 5DV5A 3HOWJ 2Z99A 4XLAA 2K3PA 5KAFC 2NNYA 1RR8C 5E67A 3J80K 4Q8FA 3QP6A 3ZMSA 2XKPA 2WAQA 5LGUA 4QSHA 2UVWA 4IO9F 1B6SA 2W25A 4TV7A 3MXAA 2LF8A 2XV4S 2D2WA 4LFUA 4ZDLA 2GXBA 5A0MA 4HF1A 3ZMDA 2VT3A 4LK1F 1FIAA 3JRAA 1VQPI 3I58A 4P9FA 3QAHA 1I7LA 3HOVG 2K27A 3M1EA 4F55A 5DG8A 5FFZA 3MVPA 3BG6A 2ASDA 3VB2A 2P7CB 1SD4A 2BY1A 4M3EA 3RIRA 3EPGA 5C4XJ 1TNTA 4A3LJ 2L7FP 1YRNA 5KFAA 1X58A 3V6HA 2W00A 2V9WA 3TDUC 5M3MJ 3GX4X 1MD0A 3DPTA 3E5XA 1ZH5A 4DR5H 2UUCH 3DEUA 3HSFA 4QIWN 4F4WA 4YAJB 3IL2A 4W97A 2VS7A 2W82A 1V5GA 1YI2I 2L9RA 4A3IG 5L3EA 4EV0A 5D1OB 4IRGA 3HOXG 4O3QA 1S9HA 3DEEA 5AKFA 4ED8A 4BBRJ 2V6CA 4AIDA 4QWEA 2W84A 3H3ZA 4A3CG 5A74A 3EUHA 1J5YA 1W1WE 1V54H 2CUFA 5JQWA 4YIIA 3BOQA 2JEFA 2KIMA 1KJQA 3K70D 1IF1A 2JWTA 2VLAA 3EQLF 4AVZA 4YAKB 1X1CA 1G3SA 1E17A 4D9JA 4XX0B 3TIGA 4XOPA 5IOYA 5FLMG 4G6DA 1IXSB 5J3LA 1BA5A 3ZRGA 4Y13A 5F0CA 3F22A 1XMXA 2AQ4A 2M5WA 1JUSA 1X2MA 1HSJA 3I4NG 1G3YA 2HZDA 3MD2A 4AQUA 1IJWC 1P4WA 2FLLA 1XGNA 1FOWA 4HQEA 2WBMA 3GTOA 1R71A 3GIMA 3D5RC 3SEQA 2EZKA 2G0EA 4JI6H 3ECOA 1LNWA 2DOAA 2HGCA 4BDZA 2M8EA 5ILSA 2O8KA 1IRGA 2W7NA 4A6DA 3ZQHA 1IV8A 2M0MA 4HQMA 1XNQH 2PMZA 1OCPA 3PW4A 1SFOA 1ZELA 2LRDA 2DTRA 4A3FG 3OIQA 1EH6A 2VE8A 2RN7A 2Z33A 2R5ZB 1BI1A 5FLXW 1HW1A 3ERED 1U0CA 3MKLA 4XKVA 1Y1WA 2JVHA 3K3VA 3I0TA 3IWZA 3S32A 2O6GE 3TL4X 5J47A 1TNSA 2COBA 3H36A 2OQRA 2E60A 2HZTA 4H0EA 2W6PA 4DL3A 3J80W 5I47A 4HAMA 2WAQE 2HVQA 3G8CA 1H9GA 1R9TA 2DLNA 3KETA 3W6VA 1CE8A 5IYZF 1ZQ3P 1GSAA 2KIFA 4MNUA 5ICGA 2OA4A 5EZGA 5I0AA 5DQHA 2M2EA 4O6JA 3A01A 5E63A 3DBRB 5KG5A 2Z16A
chains in the Genus database with same CATH topology
1SAUA 4JI7H 4CUGA 4I7HA 5HNFA 2F6CA 4Z20A 3A4CA 4B3SH 1R6RA 2WAFA 3OL4A 1D1BA 3RTXA 4G6TB 2IN9A 1LWTA 2HPIA 2HHHH 3H5RA 2BW3B 2K9LA 4BEHA 3K4BA 4PSXA 3VYTB 5FD6A 1E4FT 2KRCA 5D1PA 4DR7H 4F93B 1TT0A 3OWTA 1VZ0A 2HVRA 2X6YA 3PSFA 2VPLA 3QODA 3HG9A 4N4NB 3EUKL 3SEZA 4RB0A 3VYUB 4UCUA 3J80W 3F9KA 2L9NA 4NQWB 4UT0A 3BA9A 1M0WA 3N6XA 1XNRH 3VYRB 2R7WA 4KT6A 3SDBA 4ZJZA 2X1EA 4PJLA 1X1AA 3DTKA 3SYTA 3OYFA 1G9ZA 2M3AA 3OS2A 1BJTA 4X62H 4E6KG 3M4IA 3UR3C 2VBNA 2V4JC 3HL2A 3OYEA 3IG0A 3FKJA 2R7QA 3CJRB 4LG3A 4UN9G 1G59A 1R7MA 3CVZA 2RQQA 3DQVC 1WJEA 4JOMA 4E7HA 4UN9A 3DTIA 4XKBA 3LSGA 1IBLH 2LWYA 3RTRA 2DT7B 2UXBH 4AQXA 4RAYA 4LF6H 2ZSHB 4BE2A 2VQHA 3NWTA 4P1WA 3W2VA 2ZM6H 3HOTA 2OWOA 3MMYB 1N36H 4JYAH 2UUBH 3BCAA 1ZD7A 3IP4B 4PSWA 3HUGB 3PL8A 4ETSA 2IGOA 2X6WA 2XE0B 1D1AA 2UXCH 3ZR8X 2L9SA 2Z2SB 3OYLA 1P8LA 1FKAH 2WY7Q 5HNHA 1MOWA 4UCTA 4AAEA 4BXFA 5A77A 4KHPH 2M4GA 1BR1A 2MABA 2JVGA 4PK4A 4LIUA 3PFYA 2HPMA 4BWSC 1VDEA 3N43B 4YHXA 2NOJB 4LFAH 1FMWA 5CQGA 3ZQQA 4CCMA 1MMNA 2VBOB 1SFKA 4IZZA 1X9NA 5CPRB 4DV7H 3FDYA 1T9IA 2I8DA 3RF2A 4UNAA 1DQUA 3KYLA 3FHNA 1PYVA 2JMZA 2VASA 4PJJA 4DGWB 3LFUA 1WFXA 5BR8H 4ZTFA 2CW8A 4YY3H 3KO2A 3DPLC 4U7BA 1BR2A 3UQ8A 3EPZA 2DXIA 3NZMA 2L5QA 1AM2A 4RAZA 5FPRA 4II3A 2XF6A 4LH6A 4XLEA 4HNUA 2V9KA 4XORA 1ERDA 4CH7A 4J00A 4CZCA 2FUG2 1JVAA 2RGRA 2BOLA 4UNBA 3HOSA 4IKFA 2XF7A 4UCVA 4E4HA 4DJAA 1L2ZA 4F91B 3OY9A 3DTEA 3PUBA 4OWRB 4LMYA 1XMQH 2CV0A 5AK9A 2VJ4A 3D5SC 3MXBA 1M0TA 1SYXB 2OV7A 3DF7A 4DV6H 4AAFA 4DV1H 4DBRA 4DV4H 2AQEA 2IXSA 1GYFA 4HSRA 2XDVA 4DR2H 4LOXA 3I3LA 4UNCA 1X4PA 1LWSA 3OL3A 1HNXH 1X4OA 1GLNA 3N05A 2AB5A 3PNTA 3CP2A 3ZGKA 2AQFA 2QKLB 4PFOA 2JA2A 3FD2A 2Q1ZB 4XMYA 3N42B 2IMZA 2KZVA 4OZ6A 4LSAA 5AKMA 3ONQA 2I3PA 1ZHSA 4HRIA 5E5SA 2BW3A 4BEHB 4FM9A 4F92B 2HNHA 3OYIA 4RM2A 3U21A 4BE0A 4LSXA 1MMAA 3RSNA 1E4GT 2E5NA 2KP6A 4BJ6C 1S03G 2IS1A 2P0WA 3G2BA 3JAMW 2M7AA 3LMMA 2M4KA 5FD5A 1B24A 2O7MA 3OR2C 3MKYB 3S3OA 1T0FC 4DV2H 2R7RA 3RCOA 4O1SA 2HU9A 3BG7A 4XONA 5TGTA 4UFZA 3PNVA 4Y3OA 3N41B 4C9YA 3QYBA 4RM3A 4RB1A 3T1YH 2V26A 4LF4H 4B48A 4BU2A 4C2UA 3MXBB 4DV0H 2VQFH 3CZ6A 3H5AA 3AFHA 1MI8A 4IAJA 4JI0H 2UXDH 2QOJZ 4MTDA 4CSWA 2WE6A 4BL0B 4ITVA 2MYSA 3PNYA 1ZDEA 4CCLA 3BABA 3S3MA 3J7AK 3V42A 2Z1DA 4BJ5C 3K4NA 3HC7A 4NUBA 1D0ZA 4XQFA 2R7VA 2RGVA 3HKZA 2X1DA 1GPPA 4Q0YA 2JNQA 4X66H 3D5LA 4BQNA 1G9YA 2UV1A 2CFOA 3TMOA 3L2WA 4CCOA 4KL6A 1I94H 4NXMH 3IUOA 2I3QA 4BS9A 2MFZA 2UWMA 4E7ZA 3L2RA 2LG4A 4E7LA 4EFJA 4KL5A 4EEQA 3FBNB 2VS8A 3A1YA 4RLQA 3KXYT 1J5EH 3MKZA 2JSPA 1A0IA 2R7TA 4Z1ZA 1MW7A 5LFAA 2LCJA 4UCRA 3J81W 4MTEA 2IS6A 4B44A 3DPUA 4JI2H 4E7JA 3VSKA 1N77A 1WJFA 1AT0A 4DV3H 4MV9A 3K4KA 1OR7C 1N34H 2PJRB 1LVKA 4J01A 5AKNA 2WB1A 4XKWA 1FMVA 3MIPA 2VUGA 3KEYA 4RB3C 3QYEA 2KMUA 2Q2TA 4ANJA 1JI8A 4Y4RA 2VBLB 3FBIB 4LQ0A 3CESA 4PJMA 4A2AA 2UU9H 4DR4H 3LSHA 1AA7A 4E2TA 4XN3A 1HA8A 2HGSA 4E7KA 3H9GA 5LL6b 2E5LH 1TA8A 4XN0A 4UCOA 4A2BA 4X0GA 5LMUH 1NG7A 3HPHA 4HNTA 4C2TA 1MZBA 4DR6H 5HLTA 3K70C 3M8JA 5EOYA 2ZFUA 1N3EA 1B04A 1DGSA 4PDBA 4FETA 3QOEA 4D1QA 3OTOH 1EA3A 1U0DA 4RZQA 1BR4A 3IFJA 1Z2PX 1DFAA 4NC7A 1NG6A 2E1MB 1P9QC 2X1CA 2X6XA 3K4JA 2KLOA 4LIVA 4BDYA 2VBLA 2W57A 1QHGA 3R7PA 3L2UA 4YHHH 2KL4A 1Z7LA 4E7IA 2XC7A 3K4LA 4BQOA 1OLTA 3OMYA 2IN8A 3CMMA 1UG0A 3EH8A 2E1MC 5FROA 3AKZA 1HNWH 4HG2A 4LH7A 5CKTA 2Q2EB 4XLFA 3H5NA 2O5RA 2VJIA 1J09A 3BCBA 4FASD 2VBJB 2WAEA 1YX3A 2RREA 3OS1A 2KPMA 3KAJA 2LBFA 2VQGA 3RGXA 4RB2C 3OYGA 2OC6A 2DT6A 4XKCA 2VKDA 1HR0H 4CCJA 1V5EA 3OORA 4IQJA 1WJDA 4NXNH 4UN7A 4DV5H 1D0XA 4YELA 3EUHC 3DKYA 3NWSA 5FRMA 1Z2OX 3L4KA 3DWLE 2VIXA 3QYFA 4N4OB 3S93A 4CCNA 2VBJA 2UUAH 3AL0C 1D0YA 2IS4A 1LFPA 1UELB 3HYJA 1O75A 4UN8A 4BQQA 1S68A 1V9PA 4MV7A 1FVIA 4XNFA 3W2WA 1LDKB 4BE1A 3BAAA 4JI8H 2VL8A 1DP3A 2E5ZA 4QPQA 4GKKH 3I9V2 4M7EA 3KALA 4X65H 2VJ5A 2F5VA 1N32H 3EYYA 1MMDA 3VYSB 3VWBA 2XIGA 4X64H 2WADA 1Z2NX 2LH9A 3J7AY 4GRIA 4ZC3A 2VB6A 2CS3A 3OYCA 2L8LA 5IT9W 2VPSA 3OOLA 2LOOA 4MLOA 3M1CA 1SEIA 1WJCA 4CC6A 3RIZA 3HXLA 4D6OA 1W36C 4OAYA 3C0WA 4ZTJA 3K4MA 5CQEA 5IWAH 1N78A 1IRXA 1WH2A 2WA0A 2UUZA 4EATA 1FJGH 2HQAA 3OYHA 2IGNA 3K10A 5A2QW 4H4KC 4GIGA 2IGKA 2KQRA 2VXDA 3CF2A 3ZCOA 2ELJA 5K08A 3LL7A 3E54A 1TAEA 4DUYH 1IBKH 3H20A 4IX7A 1MMGA 2O03A 4II2A 3H9QA 4B47A 4HSTA 4XLCA 1Z3XA 4PUSA 4DR3H 4LF5H 5A0MB 4B3TH 2LC2A 4OAZA 3KAKA 3H0DA 1EF0A 3TBIA 3UNGC 2R7UA 5JHFA 2R7XA 4AAGA 1LKXA 2HVSA 3E1SA 4HEA2 5LD2C 1QU3A 3OYAA 5E5OA 1T95A 3F8NA 4UCSA 4DIQA 4XLHA 3AL0B 3PN1A 3K6GA 1BP7A 4IQ4A 2K5CA 3CP8A 3KX2A 2CUJA 2FLDA 5D1OA 2ZSIB 4NNJA 2X51A 4AQYH 4E7SA 2KEQA 4JV5H 1DQ3A 1U0JA 4B3XA 1UM2A 1N3FA 5A78A 2ZJTA 3DLAA 3FMAA 2M7BA 3L2QA 2XE0A 3UVFA 2CH0A 4C30A 4ZDOA 4UN8G 2KRHA 1G8XA 2KHMA 2L7KA 3SZGA 3HPGA 4ZYAA 3PJRA 2IN0A 4XL9A 4KJZA 2LQMA 1W36D 3OYDA 4LF7H 2WYOA 4Z1XA 4LF9H 4KITB 5FRNA 1WJ5A 2BVLA 3PSIA 3EUAA 4AADA 3LMLA 4APMA 3RJ0A 2VQEH 4LITA 1X1DA 3ZXSA 4NC8A 3IAM2 4CC5A 5A72A 2A5WA 2GOMA 4AU7A 2ZXIA 2K9MA 5KHDA 1TZLA 3W2AA 4O1RA 4D6NA 5HVQC 4YITA 2VBNB 3OYBA 3L4JA 2VXZA 4B3RH 2VQCA 2CUZA 1Y56A 4EFBA 2CW7A 3MWMA 3L2PA 4E2UA 3LSKA 5HOOA 3BLYA 5KNLA 3S8PA 3OYKA 3OYJA 4XLAA 2K3PA 2VJJA 1E0EA 3RGZA 1PJRA 5FPOA 1HNZH 2W4SA 4J0MA 5E67A 3OS0A 1ZHQA 3GBGA 2WAQA 5LMNH 2Q2UA 1YE9A 4GKJH 3BA8A 2A6TA 3S3NA 2HDWA 3LSIA 2V1NA 4R7RA 3MXAA 3N40P 2XAUA 4YISA 1X1BA 1Y6IA 4ZDLA 2MC4A 5A0MA 1QHHD 1AF5A 2XF5A 4AABA 1YX5A 2RNGA 1Z3YA 2FE3A 2LREA 4F55A 2IS2A 3BG6A 2CV2A 2DCHX 2EX5A 1N33H 4BACA 2DCEA 2KDOA 4GLXA 4BUPA 2W00A 2IGMA 4PFPA 1WJAA 3RQ4A 2CV1A 3L2VA 3DPTA 2YCHA 4P5OA 4K0KH 4DR5H 2UUCH 3IGDA 3OYNA 2LY1A 4UN7G 4Y33A 3LSMA 3DU5A 2VQLA 1BGWA 4DR1H 2MCTA 2Y0SA 2VS7A 2W82A 1V5GA 4U87A 3C0FB 4JI4H 2F4VH 3W3CA 4DOZA 1N75A 5D1OB 1D1CA 3BC8A 4LFBH 3DU6A 4XOTA 1S9HA 3DEEA 4B43A 1VS0A 5AKFA 4JI5H 3H9JA 2JUGA 4RLFA 2PJRA 3JSLA 2F4IA 4HPQA 4PJNA 1UAAA 3QQYA 2DJIA 4CCKA 1WJBA 3E0JB 4CA0A 5A74A 3K4CA 2LY2A 3N44B 3H35A 4AYBA 3C2HA 4RMNA 3K70D 4LF8H 2VLAA 4AVZA 3MX9A 1BOBA 1X1CA 2MD0A 2W1OA 2WY8Q 4D9JA 2VOBA 4R79A 4XM3A 4XOPA 3VSLA 2LYCA 3ZRGA 1DGRM 4B3MH 1V5FA 1I6UA 2R4GA 1M5XA 2KSWA 3MISA 1X19A 4XR6A 3T1HH 3HYIA 1K6YA 2HZDA 2XSJC 3MD2A 2LBFB 2VBOA 4AQUA 2R7OA 2WBMA 2V7FA 2V6EA 3D5RC 1IBMH 1T9JA 4ZDPA 4JQFA 3SEQA 3IAS2 2VKHA 2GOXB 2DOAA 3JSNA 4JI6H 4BDZA 4JI3H 5KCMA 4EFEA 3MKWB 3VDXA 4YRVA 1MNDA 2W7NA 3OOUA 4KISA 2M0MA 2QKMB 2R7SA 2X85A 3RPUD 2PMZA 1AN7A 1XNQH 1ZELA 2LRDA 3OIQA 1MNEA 2CMPA 4QPOA 3C2GA 4DBQA 4JI1H 3OR1C 5FLXW 1U0CA 4XKVA 3OIPA 4DUZH 2JVHA 3K3VA 1DGWY 2BVMA 2OUMA 1KONA 3OYMA 3S32A 4LFCH 3TL4X 2ZXHA 5A0WA 2WDTA 2E60A 4YEJA 3DKXA 3A2KA 1Z21A 4F52A 2HVQA 2L2OA 1P8KZ 5I0AA 3C0XA 1XDNA 1XMOH 5E63A 4OX9H 4F3QA 4BJTA 3CJQB 4BGDA 2Z16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OZ6 A;  5AKM A;  2I3P A;  4Z20 A;  2CW7 A;  5E5S A;  4E2U A;  2IN9 A;  2IMZ A;  1LWT A;  2VBJ B;  5E67 A;  3OOR A;  4UN7 A;  3MXA A;  4UT0 A;  4YIS A;  2VBJ A;  1B24 A;  2O7M A;  5A0M A;  3HYJ A;  1AF5 A;  4UN8 A;  1G9Z A;  4O1S A;  4AAB A;  2VBN A;  4UN9 G;  1R7M A;  3MXB B;  2DCH X;  2EX5 A;  1MI8 A;  2L8L A;  2QOJ Z;  4UN9 A;  3OOL A;  1ZDE A;  3IGD A;  2LWY A;  4UN7 G;  4AQX A;  4D6O A;  3C0W A;  2VS7 A;  1GPP A;  1ZD7 A;  2JNQ A;  4GIG A;  5K08 A;  5AKF A;  3E54 A;  1G9Y A;  2XE0 B;  4KL6 A;  3QQY A;  5A74 A;  2I3Q A;  4EFJ A;  1MOW A;  4AAE A;  4KL5 A;  5A77 A;  5A0M B;  2VS8 A;  3MX9 A;  1VDE A;  4YHX A;  1EF0 A;  2VBO B;  4Z1Z A;  2LCJ A;  4AAG A;  5E5O A;  1T9I A;  4UNA A;  1M5X A;  1AT0 A;  3MIS A;  2JMZ A;  3HYI A;  2VBO A;  4AQU A;  5AKN A;  1BP7 A;  2CW8 A;  3KO2 A;  3MIP A;  2FLD A;  1T9J A;  3NZM A;  2KEQ A;  2VBL B;  4LQ0 A;  1DQ3 A;  1AM2 A;  1UM2 A;  1N3F A;  5A78 A;  4E2T A;  2XE0 A;  3UVF A;  1JVA A;  4UN8 G;  4UNB A;  2LQM A;  5AK9 A;  1N3E A;  2IN0 A;  3MXB A;  4AAF A;  1U0C A;  4Z1X A;  1U0D A;  3IFJ A;  4LOX A;  5A0W A;  4UNC A;  1DFA A;  4AAD A;  2VBL A;  1LWS A;  3R7P A;  1P8K Z;  2AB5 A;  5I0A A;  3C0X A;  5A72 A;  4O1R A;  5E63 A;  2IN8 A;  4D6N A;  3FD2 A;  3EH8 A;  4YIT A;  2VBN B; 
#chains in the Genus database with same CATH topology
 1SAU A;  2Q8K A;  4AVP A;  2BHY A;  4Z20 A;  2GZW A;  2ZJP F;  2CKZ B;  1SAX A;  2WAF A;  3OL4 A;  5KG3 A;  2IN9 A;  2FMY A;  1PVE A;  1LWT A;  5E20 A;  2R7L A;  4RUA A;  2R92 G;  1R1U A;  1ZR4 A;  5KAI C;  4YJ3 F;  1EHI A;  2HVR A;  3PSF A;  4ED6 A;  3H3V K;  3FMR A;  3M07 A;  1RET A;  3VPD A;  3LA7 A;  2NVX J;  5C3E J;  3CMA I;  1GSO A;  1ETX A;  4UT0 A;  3BA9 A;  3JRG A;  3VYR B;  4W1U A;  1XGM A;  4KT6 A;  2VN2 A;  2R7W A;  5L9X A;  3SYT A;  3OYF A;  5EZH A;  2D45 A;  2R6F A;  3HOY G;  5HV6 A;  1OWT A;  2FMA A;  2CRG A;  2O3F A;  4XBF A;  5L3B A;  1B72 B;  3HOU G;  4UN9 G;  1G59 A;  4OIR F;  2EA2 A;  5C5J A;  2M1B A;  4M6V A;  4EMS A;  3OV8 A;  4ECZ A;  3C3W A;  3Q3S A;  3M9M B;  1RPW A;  2M0C A;  1T3N A;  2HXI A;  1OQY A;  1KJJ A;  3FDS A;  3GQC A;  2GIV A;  2UXB H;  2ZCW A;  4AQX A;  4ESF A;  3GZ6 A;  3KEO A;  4DZJ A;  4O3O A;  1AOY A;  2R92 A;  2BBY A;  2LD5 A;  3HOT A;  2YU9 J;  1AWC A;  1AUV A;  3MAJ A;  4IXA A;  4JYA H;  2STW A;  1WCM G;  4PSW A;  3PL8 A;  1PUF A;  3CD6 I;  1FP1 D;  2JSC A;  1ZGW A;  1U78 A;  2VA2 A;  1BIB A;  4FHT A;  5M5X J;  2W6M A;  1Y1V J;  2Z2S B;  1IC8 A;  2WY7 Q;  3H92 A;  2DBB A;  4UCT A;  4BXF A;  5A77 A;  4EJV A;  2M4G A;  2ZJR F;  1BR1 A;  1Y8Q B;  2JVG A;  2HJW A;  3ETJ A;  1YW9 A;  4BWS C;  2FU4 A;  4YHX A;  2NOJ B;  4U7D A;  5L1J A;  1FMW A;  3ZQQ A;  4CCM A;  1RJP A;  1X9N A;  1SD6 A;  1SFK A;  2XAQ A;  5D8K B;  4IZZ A;  5CPR B;  2CQY A;  1ZRE A;  3BJY A;  1H9T A;  3DLL F;  1T9I A;  5J8F A;  1JDB B;  2ZB9 A;  1MKM A;  3FHN A;  1Z67 A;  2L7Z A;  2UXX A;  5KFL A;  2E19 A;  5KFB A;  3LFU A;  1RJR A;  2CW8 A;  3I4P A;  4OIN F;  3KO2 A;  4D5F A;  3EPZ A;  1E4E A;  1ZGJ A;  2G9W A;  3ECH A;  4I98 B;  4II3 A;  4HNU A;  1TWA A;  3ISP A;  3T8R A;  4MFD A;  1B6A A;  4E4T A;  5KG4 A;  2BOL A;  1ZYR F;  2XF7 A;  3LSJ A;  3TQN A;  1A35 A;  2GLT A;  2X4H A;  4BHC A;  2ETH A;  2NS0 A;  2Z5U A;  3K3P A;  2VJ4 A;  3D5S C;  2K4B A;  2KJB A;  2A05 A;  2OV7 A;  1M0T A;  1SYX B;  3PM1 A;  2FPP B;  4DV4 H;  3I4M J;  5KT5 A;  4HSR A;  3KEQ A;  2VE9 A;  3S15 J;  3OSF A;  3CC7 I;  5LHI A;  3Q2O A;  2ZJQ F;  1SFO J;  1X4O A;  2ZME B;  5HS9 A;  2AB5 A;  3BTI A;  3KTM A;  3CP2 A;  2ZNZ A;  1S72 I;  4M3F A;  3GIL A;  5K7Z A;  1HOM A;  3JTG A;  1S9F A;  1QZZ A;  4MEY F;  2W6Z A;  3BQ0 A;  4OZ6 A;  3K1P A;  3TDZ C;  4HRI A;  4U7C A;  1HC8 A;  2AGQ A;  1QZY A;  3TO7 A;  2HNH A;  3BWG A;  4V2F A;  4RM2 A;  3U21 A;  2B7E A;  4QWD A;  1BJZ A;  2E5N A;  4BJ6 C;  1K79 A;  2R5Y A;  4JX4 A;  2XKO A;  4FS1 A;  1P7I A;  1R7J A;  3OR2 C;  5D5U B;  2R87 A;  1T0F C;  1UFM A;  4LOC A;  3R4K A;  3AG3 H;  5DG9 A;  4XON A;  5TGT A;  2LNB A;  3PNV A;  4Y3O A;  4EM1 A;  1I7N A;  4ESB A;  4MV6 A;  3ZMV A;  4C9Y A;  2K86 A;  1RKW A;  3MXB B;  2E34 A;  3CZ6 A;  1ORK A;  2CO5 A;  3C2B A;  3H5A A;  1U8R A;  4O4H F;  2PMZ E;  2QOJ Z;  5ICE A;  2NYX A;  4I6Z A;  2R7Z A;  2Q0O A;  3V42 A;  2Z1D A;  1EUC B;  5KG6 A;  2K9N A;  4IHV A;  2LF7 A;  3SDG A;  5A2Q Z;  4P9U A;  2FRH A;  3JW4 A;  2R7V A;  2QCO A;  3KP5 A;  2E2J J;  4PJ0 C;  2X1D A;  3BJA A;  4RAF A;  2HOT A;  1GPP A;  4ZHQ F;  1RZ4 A;  2IP2 A;  2JA7 J;  1UHM A;  4ZH4 F;  1G9Y A;  1XDS A;  2XAJ A;  4B4C A;  3L2W A;  5TRD A;  1I6H J;  5KFW A;  4O5V A;  3Q9S A;  1VQ9 I;  1KQ8 A;  4C5C A;  1HBX G;  5KVR A;  4EFJ A;  4EEQ A;  5CVI A;  4RA2 A;  1JKR C;  3BR1 A;  1JGG A;  3MKZ A;  1MH3 A;  3LFK A;  3F8B A;  4ESJ A;  2J6U A;  1K83 J;  2PMZ N;  3TGN A;  4QWB A;  4AWX B;  3L7W A;  3GEZ A;  3F3X A;  4B44 A;  1P92 A;  4E7J A;  3BG3 A;  1N77 A;  3KYC B;  4IOA F;  2LDU A;  4ENN A;  1LVK A;  3GLX A;  4J01 A;  5AKN A;  3WTS C;  4M9S A;  3CF5 F;  3KEY A;  4CHU A;  3I55 I;  2KMU A;  5IT3 A;  4LD5 A;  3BR5 A;  4Y4R A;  2VBL B;  3L09 A;  4PJM A;  4YB8 B;  3HJE A;  4L5E A;  5D8L B;  3PW0 A;  3J7A O;  1LEA A;  4S05 A;  1RK6 A;  2V79 A;  5B1B H;  3V8K A;  3MR3 A;  1N25 A;  2PEX A;  4A2B A;  5C4J J;  4Y52 J;  2JA5 A;  3SJM A;  1IZ1 A;  1XX5 A;  3GFI A;  5KFR A;  3RKW A;  5HLT A;  4A3M J;  3FKI A;  4DR6 H;  2ZFU A;  3WGG A;  3M8F A;  2DA2 A;  2YS9 A;  1ACI A;  4PDB A;  2LKP A;  4FET A;  1KBL A;  2PJP A;  3WGH A;  2QQ8 A;  3P9C A;  1U0D A;  3HKZ E;  1RI7 A;  2O7O A;  3IFJ A;  4HBL A;  2E1M B;  3JRB A;  4F50 A;  2X6X A;  3K4J A;  2KLO A;  1K7A A;  3ZPL A;  1I3A A;  1X3W B;  3O8H A;  2NVT J;  4MA0 A;  1Z7L A;  1IGN A;  4AYB E;  3K4L A;  3CCS I;  1TC3 C;  2IN8 A;  2VBZ A;  3GTJ J;  5J1U A;  1HNW H;  3AKZ A;  5CKT A;  2TRT A;  2YR2 A;  2JRT A;  3FM3 A;  1BNC A;  5KFK A;  4QW8 A;  2IMW P;  4AUX A;  2VBW A;  4FAS D;  2WAE A;  3OS1 A;  2RRE A;  1Q1V A;  3H0G A;  3RGX A;  2LBF A;  1QGP A;  2OC6 A;  1E3O C;  2R8H A;  2H1L A;  3OOR A;  3GV8 B;  1OMI A;  1LPQ A;  4IQJ A;  3HRU A;  4DV5 H;  3EUH C;  5DGA A;  5KFT A;  1USS A;  1GV2 A;  2I8C A;  2C2R A;  1O75 A;  1LFP A;  1UEL B;  3HYJ A;  2R0Q C;  2SCU B;  2R7D A;  1O3S A;  3RAQ A;  5E3M A;  1MBE A;  4DYR A;  5DUK A;  4MV7 A;  1YIO A;  4HDV A;  3PO3 J;  1LE8 A;  5B5E C;  1DP3 A;  2E5Z A;  3ABM H;  1U8B A;  3I9V 2;  3KAL A;  2DW4 A;  1JTY A;  2FK2 A;  1XCB A;  2V9P A;  3VYS B;  3D1N I;  2XIG A;  1ETW A;  5FGM A;  4X64 H;  4ECU A;  1Z2N X;  2R7M A;  2L0K A;  1OCC H;  2L8L A;  5KT2 A;  2MLK A;  4MLO A;  5H20 A;  1GSH A;  4IPA A;  1ETQ A;  4L5J A;  1O3T A;  1XDU A;  4HX4 A;  2PQ8 A;  2VQD A;  2JA6 G;  4IHS A;  1FJG H;  2HQA A;  3K10 A;  3FXK A;  2IGK A;  4LJZ F;  3E54 A;  4J9Q A;  2ELJ A;  1HKS A;  1B8I B;  2RNJ A;  1TAE A;  1TWG J;  4LG0 A;  3EET A;  3H20 A;  2KKO A;  4ZYE A;  3ZP5 A;  4A3B J;  4XYM B;  2V1D A;  2FQ3 A;  2GA2 A;  4IZO A;  3IH4 A;  3N4M A;  1BI2 A;  3GIQ A;  2QVO A;  5K2M A;  4EGJ A;  3KAK A;  3I53 A;  3WHC A;  2XGP A;  5JHF A;  1IO2 A;  1YYV A;  2VT2 A;  4YIR X;  1LKX A;  5LP6 F;  2E35 A;  5L3D A;  5LD2 C;  1J75 A;  5E5O A;  1BW6 A;  1Z0X A;  3WTW C;  3OUZ A;  2DQL A;  3F8N A;  2BXZ A;  1JKQ C;  4ED0 A;  4V2G A;  4DIQ A;  4XRM A;  4LK0 F;  4YFK F;  4IRD A;  3K6G A;  1UCR A;  4IQ4 A;  1MBG A;  3JR9 A;  4UNO A;  3KX2 A;  3OOP A;  3QPH A;  3U9T A;  5ILV A;  5KG7 A;  1ZR2 A;  2KEQ A;  2DPD A;  4O3M A;  1DQ3 A;  1EKE A;  4J9R A;  1K6O A;  1WHU A;  2DMN A;  4ECX A;  3DLA A;  3A01 B;  3FMA A;  5KFE A;  1KU3 A;  3A0B C;  2PMU A;  3RKQ A;  2IA2 A;  4MA5 A;  4O4L F;  5LRS A;  2LQM A;  2IN0 A;  4XL9 A;  4KJZ A;  3OYD A;  3BJ6 A;  3BQY A;  3PO2 G;  3WG7 H;  2WYO A;  3QQA A;  4GYG A;  3RFC A;  4LF9 H;  3F0C A;  1SD5 A;  3PSI A;  4AAD A;  3H3V H;  3LML A;  1T6S A;  2W71 A;  4QIW E;  4LIT A;  1X1D A;  3ZXS A;  3GTG A;  2FK3 A;  4M9Z A;  1OCZ H;  1SFX A;  5FFX A;  4EEF G;  4CC5 A;  1LB2 A;  2ZXI A;  1ETY A;  2FQ4 A;  1TZL A;  2CGP A;  5KG0 A;  2VQC A;  2OF7 A;  1O4X A;  3K7A J;  2IPQ X;  1Y56 A;  3MWM A;  2XSD C;  3HDD A;  1K83 A;  5KNL A;  3OYK A;  3S8P A;  3RGZ A;  3OYJ A;  2VJJ A;  1EJ9 A;  1S29 A;  1E0E A;  4J0M A;  3HOZ J;  4BHP A;  3GBG A;  3NRV A;  2H27 A;  1YE9 A;  4IEJ A;  4PGH A;  4GKJ H;  3S3N A;  2HDW A;  2FX0 A;  2V1N A;  3LSI A;  1JJ8 C;  2L01 A;  2JA8 J;  2XAU A;  4BAY A;  4IHW A;  1X1B A;  1Y6I A;  1SAN A;  2DFH A;  4LB5 A;  3BZK A;  3TQT A;  4J9S A;  5LEK A;  4AIK A;  2KZG A;  1SEU A;  2EZI A;  4RNO A;  3G1M A;  2XGD A;  1Z3Y A;  3P9K A;  2FE3 A;  3S16 J;  5FKO A;  2LVS A;  1FTZ A;  5KFJ A;  4G6Q A;  5D6F A;  4LX3 A;  2CV2 A;  4Q4Z F;  2P8T A;  2ZME A;  2YS6 A;  1KJ9 A;  5KFI A;  1S97 A;  2DCE A;  4L9N A;  1FNN A;  2EJR A;  1F9N A;  4HF0 A;  4PFP A;  1WJA A;  4BUP A;  2YCH A;  3L2V A;  2NRA C;  1G6N A;  2QZ8 A;  4UN7 G;  1OFC X;  2HYF A;  2VQL A;  2VC1 A;  4EJT A;  4RGU A;  3JRC A;  3H1C A;  3FXR A;  1XTA A;  2Y30 A;  1GV5 A;  1ZGA A;  2F4V H;  3K0L A;  3W3C A;  1AU7 A;  3BY6 A;  3FKI G;  1YJ9 I;  4LFB H;  1S5L C;  3DU6 A;  1VTN C;  1FOY A;  4UY8 I;  4RLF A;  3CCV I;  2PJR A;  2F4I A;  4GC6 A;  1SMY F;  1UAA A;  3IHU A;  4HOB A;  2DJI A;  3O2P E;  4CCK A;  3DKW A;  3RDI A;  1OCO H;  4CA0 A;  4GDF A;  4A3D J;  2ASL A;  3K4C A;  2EFW A;  1E4E B;  3C2H A;  5CJ9 A;  4EYH B;  2HQN A;  4J9N A;  5JUM A;  1WRJ A;  4R79 A;  4Q45 A;  2A6E F;  1KC7 A;  3MR2 A;  1UG2 A;  2LMD A;  1DGR M;  4AIH A;  2R82 A;  4B3M H;  4FQG A;  3H3U A;  5K1Y A;  4PWQ A;  4HX8 A;  1BC7 C;  3MIS A;  1JT0 A;  3JRW A;  3T1H H;  3HYI A;  1K6Y A;  5FLX Z;  2LBF B;  3H0G G;  1KA8 A;  1FC3 A;  1OKR A;  2CU7 A;  2F4O B;  3AAF A;  1S8N A;  1CQJ B;  3CQZ A;  2DN0 A;  2NNN A;  5KCM A;  3HRS A;  5HLH A;  1U3E M;  4TV8 F;  2DMU A;  5E1Z B;  3VDX A;  1MND A;  3CLQ A;  3OOU A;  4KIS A;  3VMM A;  2HWV A;  2X85 A;  4ZYD A;  2R7S A;  4ASN A;  2VOD A;  3GTO J;  1B6R A;  3HOW G;  2EB7 A;  2CMP A;  4QPO A;  4DBQ A;  5KFH A;  3HGG A;  4JI1 H;  4NLG A;  1YLF A;  1H88 C;  3OIP A;  1SD7 A;  2FEZ A;  3V8J A;  2OUM A;  4N9H A;  3SI8 A;  2ADU A;  1RYS A;  2OCE A;  2ZXH A;  5A0W A;  4EJW A;  1KU2 A;  2EIM H;  2FNP A;  2RKH A;  3PQJ A;  4I0A A;  1VQM I;  2ME0 A;  3KZI C;  3TQ1 A;  2L2O A;  5E3N A;  2J9G A;  3O6B B;  3I64 A;  3UFX B;  5DUI A;  2XAS A;  1B72 A;  1T94 A;  2HOE A;  1XDN A;  1YOV B;  3WTV C;  4F3Q A;  1REP C;  4BJT A;  2FJZ A;  3MWE A;  1VQK I;  4BGD A;  4D0P A;  4RZR A;  1T56 A;  4CUG A;  3IH3 A;  4I7H A;  4RDU A;  2W8K A;  5HNF A;  3G73 A;  4B3S H;  4DQ2 A;  2BYV E;  3RKX A;  1R6R A;  1IUF A;  4G6T B;  3SFZ A;  2K9L A;  3QRF F;  4BY1 J;  3K4B A;  1IOW A;  2FBI A;  5IP9 G;  2IA0 A;  2MH2 A;  1PUE E;  4DR7 H;  3CUQ C;  3REO A;  4FE7 A;  2VPL A;  1IUY A;  3HG9 A;  4FBT A;  2EQR A;  3EUK L;  3BJO A;  4RB0 A;  3SEZ A;  3VYU B;  1ODD A;  2FA5 A;  5KFU A;  3F9K A;  4IJA A;  2F5C A;  2L9N A;  4NQW B;  4I09 A;  5H6R A;  2BZT A;  1JUM A;  3RZD J;  3N6X A;  3SDB A;  1DUX C;  1HW5 A;  4PJL A;  5IOZ A;  1X1A A;  2KFD A;  1HF0 A;  1FOX A;  3WTY C;  1FZP B;  1BJT A;  2YU9 A;  3RB3 A;  1YQA A;  5ILU A;  4R8H A;  2EIK H;  1DPR A;  4A3D G;  1M1E B;  4J9P A;  5GAE J;  1EV7 A;  2FKL A;  3LQQ A;  5LRR A;  5B1A H;  3DQV C;  4QLC U;  3HSE A;  2NU6 B;  1ZET A;  4UN9 A;  3BR3 A;  3DTI A;  4XKB A;  4I55 F;  2XCA A;  3MZ8 A;  1RUN A;  1Y14 B;  1Y1V G;  4ED3 A;  3RTR A;  2DT7 B;  1YO5 C;  1ZRF A;  3JTH A;  5CVR A;  4LF6 H;  1ETO A;  2F5D A;  2NOG A;  3NWT A;  2OWO A;  2ZM6 H;  3O8G A;  3MMY B;  1SFE A;  2YL2 A;  5GP9 A;  3L2C A;  5HS7 A;  3FXM A;  3HUG B;  2WTE A;  3GTM A;  1QPM A;  1JTX A;  2CSO A;  1GDT A;  1FBQ A;  3FXU A;  1IG7 A;  1TLH B;  4IRK A;  3NAU A;  2L9S A;  3Q9V A;  3ZR8 X;  5HS8 A;  3Q0W A;  3OYL A;  5HLG A;  1P8L A;  5KFF A;  4YP3 A;  5HNH A;  2FJ1 A;  1MOW A;  2W85 A;  4A3K G;  1FKA H;  2KIQ A;  2ZNY A;  3KHH A;  4LIU A;  1NH3 A;  2JEJ A;  2P7V B;  5M5Y J;  2HPM A;  3N43 B;  3KPH A;  1MMN A;  5F08 A;  5KX5 F;  1DV1 A;  5KFZ A;  1X3U A;  5HBR B;  2OCC H;  3JRI A;  2I8D A;  2OZ6 A;  5ED4 A;  1DQU A;  3T0Y A;  1KJI A;  2IA6 A;  4DL2 A;  1WGX A;  4L9T A;  4M73 A;  2MG4 A;  4DGW B;  5K5O A;  1WFX A;  2ECB A;  2YSR A;  2FBH A;  1K78 A;  2R86 A;  1BR2 A;  3UQ8 A;  3C18 A;  3NZM A;  4DL4 A;  4MFE A;  5GON F;  1WH7 A;  5ICF A;  3RB6 A;  3FZV A;  1FJL A;  4IR9 A;  4RS8 A;  5FPR A;  4Q8E A;  1W0U A;  4JV0 A;  2HYG D;  2JRM A;  3J81 K;  2Y75 A;  4XOR A;  1ERD A;  3WE3 A;  2H1K A;  1FBS A;  5KFS A;  3F72 A;  2RGR A;  3COA C;  4CZC A;  2FUG 2;  1FOK A;  4QWQ A;  1EH8 A;  4UNB A;  3S2W A;  4IKF A;  2IA1 A;  4DJA A;  2M87 A;  3OY9 A;  1XMQ H;  4JX5 A;  3TOA A;  2ZXW H;  2CV0 A;  2PLY A;  5AK9 A;  3HOZ G;  4G3I A;  4HV6 A;  3QPS A;  5IYD J;  1GYF A;  1FSH A;  4Y8V B;  2FBK A;  1IAW A;  5DD8 A;  3I3L A;  5JVT A;  1F5T A;  1R1T A;  3PO2 J;  1UNN C;  1S0N A;  4J9M A;  1LWS A;  1NK3 P;  1YRN B;  4IHJ F;  5EEG A;  4KN7 X;  3N05 A;  1QZE A;  1N48 A;  3AG4 H;  3R0A A;  3ZQL A;  1BIA A;  4EGQ A;  1A04 A;  2MGQ A;  2QKL B;  1BN5 A;  1WKM A;  5F9L A;  3LNQ A;  2Q1Z B;  2VKV A;  4XMY A;  1V3F A;  5FKN A;  1R23 A;  2HOS A;  4KIC A;  4XSZ F;  4LSA A;  4L5I A;  2I3P A;  3ONQ A;  4UB8 C;  2HS5 A;  3H0G J;  1XN7 A;  5L1L A;  3T5K A;  5E5S A;  2BW3 A;  4BEH B;  4MO7 A;  2XGX A;  4G7O F;  1W4M A;  5FLM J;  2OPT A;  4F92 B;  5JR3 A;  3R60 A;  2GIZ A;  2E1O A;  2LKS A;  5DYM A;  3HEF A;  3RSN A;  4FX4 A;  3FK7 A;  4BXX G;  1E2X A;  4JX6 A;  3CJN A;  3GYH X;  3G2B A;  1LDD A;  4YIF A;  1MJB A;  1BI3 A;  1B24 A;  2JT1 A;  3S3O A;  3CUQ B;  2JA5 G;  2R7R A;  1S6L A;  2QBY A;  5DTD A;  4ON0 A;  4O1S A;  3QPL A;  5CA0 F;  2ZBK A;  5BQT A;  4BNC A;  3N41 B;  2NVU B;  3CCR I;  4UFZ A;  5J1R A;  2RV8 A;  3T1Y H;  5JVG F;  5AIP A;  2YZM A;  4L9V A;  4BU2 A;  4HZF A;  1ZTR A;  3I59 B;  1OJL A;  2JA5 J;  2H6C A;  1MI8 A;  4IAJ A;  1Z6R A;  4JI0 H;  2EFN A;  4BL0 B;  1U2W A;  2V1X A;  3MR5 A;  2M30 A;  2Y9Y A;  3HC7 A;  4NUB A;  1EZ1 A;  3BZ6 A;  3CCE I;  1SVM A;  2CQ7 A;  2ZJ2 A;  4HW0 A;  2XRN A;  3RKY A;  4XQF A;  3RYR A;  3R5H A;  5E3O A;  4R8U A;  1M7J A;  1RRJ A;  1C30 A;  2R93 A;  1FPQ A;  2QLZ A;  3ROU A;  5KT3 A;  3L1P A;  3HB9 A;  5EWG A;  1I94 H;  4UUS A;  3N97 A;  4UUV A;  4ENK A;  4A3G J;  4S04 A;  1J2X A;  4B8X A;  5EDN A;  3G6Y A;  4HNV A;  4RLQ A;  4EGZ A;  4KUM A;  1EH7 A;  2JA7 A;  2JSP A;  2R7T A;  1XD7 A;  4Z1Z A;  1MW7 A;  4XYL B;  2Y0S N;  5LFA A;  2PI0 A;  1AKH B;  2LCJ A;  2D1H A;  2Q2E A;  3RPU A;  1MDM A;  4UCR A;  4JI2 H;  3DPU A;  4P96 A;  2F2E A;  3CCU I;  3R23 A;  2B63 G;  4G94 A;  5AIQ A;  3BTJ A;  3K4K A;  1IN5 A;  3JZI A;  5L3C A;  5H2F C;  4BY1 G;  2VUG A;  1WR2 A;  2JPB A;  4LQ0 A;  4A2A A;  3FBI B;  3CES A;  1ETK A;  1R1V A;  4M6X A;  4EYI B;  3E5N A;  2IBK A;  2VR1 A;  1DPU A;  2HGS A;  1I50 A;  4E7K A;  1YFH A;  5LL6 b;  5LMU H;  1TWG A;  1NG7 A;  5BMZ A;  2DYS H;  4C2T A;  1YIT I;  1IDZ A;  2FOW A;  3FXL A;  3M8J A;  3KZZ A;  1TWC J;  3WTT C;  2GBY A;  3K2Z A;  3ABU A;  1ZLJ A;  4M71 A;  2DK5 A;  4D1Q A;  3M7G A;  3OTO H;  3DBL B;  3F8F A;  1BR4 A;  2MBF A;  4I02 A;  4ZYH A;  4EBD A;  2R5Z A;  1RK5 A;  3K1N A;  1JI8 A;  2BQU A;  3GZ5 A;  1UMQ A;  4C3J J;  4YHH H;  2TCT A;  3L2U A;  2NU9 B;  4FE4 A;  5F1R A;  2X0L A;  4E7I A;  3IN5 A;  3Q0U A;  2DPJ A;  1OLT A;  3MJF A;  5KFP A;  3T5X A;  2E1M C;  5FRO A;  3EH8 A;  2VPR A;  4ED7 A;  4DYC A;  2E1C A;  2J5O A;  2RDP A;  2UXN A;  4A12 A;  4ECR A;  2LLK A;  4FU0 A;  4GYI A;  3H5N A;  2DA4 A;  2VJI A;  2VBJ B;  1VQ6 I;  3KAJ A;  4MV1 A;  4Z2Y A;  2XPW A;  1RR7 A;  2R5Y B;  4Y15 A;  1VKZ A;  4ZQI A;  2DPI A;  2DT6 A;  3PW2 A;  3BG5 A;  4ECY A;  1HR0 H;  1V5E A;  2Y48 A;  4NXN H;  1WJD A;  2NAZ A;  4UN7 A;  2CQK A;  1D0X A;  4YEL A;  2VUM J;  3GTQ J;  3NWS A;  5K5R A;  5FRM A;  1W96 A;  2CJJ A;  4AD9 A;  1YW8 A;  3OSG A;  3LA3 A;  2ASJ A;  2ZFW A;  1V9P A;  1FVI A;  1ULZ A;  4XNF A;  5JFR A;  3W2W A;  2HTS A;  5H6Q A;  3IRR A;  4BE1 A;  4GKK H;  1D3Y A;  4L0Y B;  5HDG A;  4DZP A;  2VJ5 A;  1HW2 A;  3CCY A;  1DIK A;  1N32 H;  3EYY A;  1MMD A;  4C5A A;  3I4N J;  2W8L A;  2WAD A;  2LH9 A;  5LHH A;  4GRI A;  1FTT A;  2VB6 A;  2CS3 A;  3F6V A;  3FMS A;  4JP0 A;  3G6V A;  5HDN A;  4O3R A;  2LOO A;  1XMK A;  1XSV A;  5F64 A;  4M3B A;  1LVA A;  3QFF A;  2W9C B;  4LLN A;  3J81 Z;  2VBX A;  2E7X A;  1EYZ A;  4PCQ A;  4G7Z F;  3K4M A;  5CQE A;  3CMY A;  4S0H B;  2R93 G;  5J8C A;  2R8K A;  2BQ3 A;  2UUZ A;  1VQN I;  1MMS A;  5BPI A;  2IGN A;  4H4K C;  5K08 A;  4NBQ A;  1FWZ A;  3ZCO A;  5E17 F;  4X1E A;  2HDD A;  1JXS A;  4BBR G;  2COM A;  2GQQ A;  1IBK H;  2OZU A;  5GAG J;  1QVU A;  4ECT A;  4MQ9 F;  2XPU A;  3G6X A;  2O03 A;  3ELK A;  2W48 A;  3H9Q A;  3GTG J;  4HST A;  1OYW A;  2ESN A;  4DR3 H;  2C2D A;  3Q5F A;  1HDD C;  5A0M B;  2X48 A;  4XLP F;  4ABZ A;  1DU0 A;  3GCM A;  1T08 B;  3UNG C;  2VKE A;  3PIO F;  2GXG A;  4CO8 A;  3EYI A;  1TWF A;  4A3J G;  4HEA 2;  1MSF C;  1TQP A;  1I3Q J;  3OYA A;  4L18 B;  4CGZ A;  2C00 A;  5EEH A;  3OSN A;  4UCS A;  3KFW X;  2ECC A;  3RBE A;  3PN1 A;  3IH2 A;  2PX9 A;  3TOB A;  1BP7 A;  3CDL A;  1C0W A;  2V5A A;  4ZI7 F;  4A3E G;  2FLD A;  2DPU A;  4EBE A;  2GAU A;  4AQY H;  1S0O A;  3HHH A;  5KFC A;  3B6C A;  4JV5 H;  4BBS G;  4CDG A;  4B3X A;  1JE8 A;  3HGY A;  4I50 F;  5A78 A;  4DL6 A;  2OBP A;  2OTL I;  2DTZ A;  4D5C A;  1A31 A;  1R5H A;  2M7B A;  1O7F A;  5F1J A;  5EEA A;  1PUF B;  3HHG A;  1JT6 A;  4UN8 G;  4UHT A;  2VBY A;  1LEB A;  3RBD A;  1IN7 A;  3E6M A;  1G8X A;  3GVA A;  4C3H J;  3PJR A;  3LOC A;  1YS7 A;  1W36 D;  2CFX A;  3CTA A;  4LF7 H;  1VQO I;  1TWH A;  3Q1K A;  2OD5 A;  5DDG A;  5C44 G;  2YU3 A;  3I4M G;  1WJ5 A;  5GPC A;  1RES A;  2BVL A;  2W7O A;  4APM A;  3RJ0 A;  1SVL A;  2ELK A;  1SCU B;  1EF4 A;  4Y7N J;  5L3G A;  3GTQ A;  2VUM A;  3BP8 A;  3IAM 2;  2LSO A;  5BNG A;  4AU7 A;  3W2A A;  4UB6 C;  2XGC A;  5KHD A;  4YIT A;  3I71 A;  3OYB A;  2JJ7 A;  2AHQ A;  3L4J A;  1UZC A;  2CUZ A;  3G71 I;  2LTP A;  1ZHS A;  4DL7 A;  5E1X A;  2B63 J;  5J4Y A;  2CW7 A;  3BQ1 A;  4E2U A;  1RC9 A;  3LSK A;  2IMZ A;  1KJ8 A;  1TQM A;  3CCM I;  3G1L A;  3DEW A;  1J7K A;  4WX9 A;  1HCR A;  5FPO A;  2E7W A;  2D1V A;  2W4S A;  2DFF A;  5J4V A;  4A3K J;  3OS0 A;  4AM3 A;  1MJ9 A;  1ZHQ A;  2Q2U A;  5LMN H;  4O3N A;  1P7J A;  5KFQ A;  2A6T A;  1KU9 A;  2RAE A;  2WAQ N;  3HRM A;  3WE2 A;  3HOU J;  4R7R A;  5E18 F;  4DW6 A;  1R9T J;  4WD3 A;  1XSX A;  3BQ2 A;  3N40 P;  4YIS A;  2R8J A;  3WTX C;  1QHH D;  3E6B A;  4KA4 A;  1AF5 A;  4ECV A;  3WU0 A;  4U6P A;  3ZQC A;  4AAB A;  4EEY A;  2B63 A;  1JXL A;  2FXA A;  2JUC A;  5KFV A;  2LRE A;  4LGW A;  2IS2 A;  2VOP A;  1VQL I;  2GXA A;  2YX7 A;  4B1R A;  2FLP A;  1VQ7 I;  1N33 H;  4BAC A;  1OYY A;  2DWC A;  1K4T A;  1T36 A;  2VPQ A;  5LA6 F;  2KDO A;  2IGM A;  2D5V A;  4K0K H;  1GVD A;  2HTJ A;  3OYN A;  2LY1 A;  3IGD A;  4MV8 A;  2UVU A;  4Y33 A;  1BGW A;  3DU5 A;  4A3J J;  1T38 A;  2MCT A;  5LYJ F;  2Y0S A;  3TII A;  3JCU C;  2M9H A;  4QIW A;  3TW7 A;  1Z1D A;  3BDD A;  4ECS A;  4DOZ A;  3EDP A;  3S2H J;  2A07 F;  4GFB A;  1D1C A;  1R4M B;  3BC8 A;  2TDX A;  4XOT A;  1VS0 A;  2DIK A;  2ZKZ A;  2XAH A;  3T8T A;  5DQI A;  3JSO A;  3H9J A;  5EGO A;  2CG4 A;  1T2K A;  3JSL A;  1F36 A;  4CYD A;  4HPQ A;  3K1M A;  4MIM A;  2H09 A;  4F4Y A;  1GT0 C;  2LY2 A;  3H35 A;  1IRF A;  4RMN A;  2BHZ A;  1D5V A;  1N56 A;  1UHS A;  1I1G A;  2VOB A;  2MD0 A;  4PGG A;  1OCR H;  1SC7 A;  4XM3 A;  3VSL A;  2LYC A;  5E8G A;  5GTI C;  4IHX A;  4ED1 A;  1I6U A;  1V5F A;  4C2M A;  2R4G A;  1M5X A;  3I5U A;  3MZH A;  3CO7 C;  1X19 A;  3S1N J;  3H40 A;  2HKX A;  2W9B A;  4HA8 A;  3K5H A;  2R7O A;  2V7F A;  4J9L A;  2BGC A;  2PN6 A;  4LLL A;  4EJO A;  5B3S H;  2PBZ A;  4X6A J;  3T5J A;  1WI3 A;  4JQF A;  2VA3 A;  3IAS 2;  1D8J A;  1B59 A;  2VKH A;  1I6X A;  2GOX B;  5J6X A;  1BXR A;  2ZO4 A;  1QRY A;  1PK8 A;  5DLF A;  4JI3 H;  3ZMT A;  4R1H A;  3MKW B;  2JEI A;  1U5T C;  3A03 A;  2W9C A;  5DG7 A;  1Z7U A;  2QKM B;  1B9M A;  4GO1 A;  1AN7 A;  4WK8 F;  3RPU D;  5ERI A;  2HOA A;  5C3E G;  5BPH A;  4J9O A;  1MNE A;  2YS7 A;  3KP4 A;  3C2G A;  4ED2 A;  2HQR A;  1Q1H A;  4DUZ H;  2A6H F;  3SQN A;  3OYM A;  1KON A;  1GO3 E;  4KZS A;  2ALZ A;  1VQ8 I;  4MQV A;  2WDT A;  2LFB A;  4EJU A;  3DKX A;  3A2K A;  2QSH X;  4NB5 A;  3N8D A;  4JUZ A;  3RV4 A;  4BH9 A;  2FLN A;  4QFQ A;  4QWC A;  1ON2 A;  4A3F J;  3C0X A;  1QO0 D;  1XMO H;  3I12 A;  1RNL A;  2AU0 A;  3CJQ B;  1CQI B;  1W7P B;  3TO6 A;  2CQQ A;  5F9N A;  3QQY A;  2F6C A;  1MBK A;  3A4C A;  4MHG A;  2QEN A;  4A0Y A;  5BPF A;  2XUB A;  4MAM A;  3V7S A;  1D1B A;  2QYO A;  1ZLK A;  2RF4 A;  3RTX A;  4DLK A;  2HPI A;  4AC0 A;  2P5K A;  2HHH H;  1E3P A;  4PSX A;  2FPG B;  3GXO A;  5D5V B;  1GLV A;  5FD6 A;  4F93 B;  3OWT A;  1VZ0 A;  2AS5 F;  4KNY A;  2X6Y A;  1BM9 A;  5KFN A;  4N4N B;  5M5W J;  1XNR H;  3M9N B;  1M0W A;  1JHF A;  3B02 A;  2HKO A;  4EBC A;  4A6E A;  4ZZD A;  5JLX A;  4GXO A;  2G7H A;  4UUT A;  1HLV A;  4X62 H;  3M4I A;  2VBN A;  2RQP A;  3OYE A;  5H80 A;  1VQ5 I;  1FLI A;  4QW9 A;  1IN8 A;  2E2I J;  5KG2 A;  4KYW A;  2ISY A;  1YIJ I;  3I54 A;  4UXN A;  3ZMZ A;  3WTU C;  1FYL A;  5GTH C;  3J80 Z;  4E70 A;  3LSG A;  2EZH A;  2L02 A;  3BR6 A;  3Q8P B;  3LST A;  4BY7 G;  2ZSH B;  3R5X A;  2R8G A;  4BE2 A;  2VQH A;  4P1W A;  3W2V A;  5JHU A;  1Y0N A;  3Q0V A;  3BQZ A;  4DYQ A;  5D4R A;  4BQA A;  4IRI A;  3ZQ7 A;  2UUB H;  3BCA A;  4OIP F;  1ZD7 A;  3IP4 B;  1A6Q A;  4A2U A;  2IGO A;  2X6W A;  3PR5 B;  4OIQ F;  2UXC H;  4FCY A;  5DCM B;  2GA1 A;  1W93 A;  2NS7 A;  3FHZ A;  2DA3 A;  4AAE A;  4PK4 A;  4NDL A;  4IHT A;  2VUM G;  1XPX A;  3PFY A;  1VDE A;  1GXQ A;  2VBO B;  4DNC A;  1POG A;  2DDA A;  4DV7 H;  4O2B F;  1R5I D;  3QOP A;  3RF2 A;  3VPC A;  4UNA A;  3KYL A;  2BY3 A;  5FLV A;  1Z91 A;  1K1S A;  2YYA A;  4FX0 A;  2VAS A;  5DEQ A;  4EGY A;  2JMZ A;  4PJJ A;  1QQI A;  5BR8 H;  2MH9 A;  3IRQ A;  4HF2 A;  3DPL C;  2WB1 N;  4A3M G;  2NUA B;  2C28 A;  2L5Q A;  3R5F A;  1V4Y A;  1FY7 A;  3DCF A;  2XPV A;  3GTL A;  1XCV A;  5IYD G;  1H0M A;  2XF6 A;  2AGP A;  4LH6 A;  2JPC A;  2V9K A;  4QWA A;  4CH7 A;  2GM4 A;  3QPT A;  3HOS A;  2YRX A;  4UCV A;  4E4H A;  3S1Q J;  3NGD A;  4F91 B;  4FBU A;  4LMY A;  3I59 A;  1N36 H;  4JK1 X;  1G4D A;  3DF7 A;  1S7O A;  4DV6 H;  4LLG F;  5HDK A;  2UZK A;  4F7Z A;  4G12 A;  2YZG A;  1S7E A;  2AQE A;  1O3R A;  3C1D A;  1UC8 A;  2V58 A;  1WH5 A;  4UNC A;  1JKJ B;  1ZAO A;  1X4P A;  1HNX H;  4XSX F;  2DMP A;  3PNT A;  3HBL A;  2V9V A;  4IWX A;  1YTY A;  1V4R A;  4PFO A;  2JA2 A;  1B1B A;  1CGP A;  3N42 B;  4YR0 A;  3VOD A;  1ZKG A;  1ULY A;  2KZV A;  2R7Z G;  2FD5 A;  4CZZ A;  1TQI A;  1P2F A;  2DFI A;  3F23 A;  3S2D J;  4KMF A;  4FM9 A;  3RJP A;  3U9S A;  2RC4 A;  2J6T A;  2X0S A;  2CQN A;  2W6O A;  2V4R A;  4JYK A;  4D7M A;  1W5T A;  1C3O A;  5EDW A;  4GGG A;  3P5J A;  3U2R A;  1CF7 B;  4LSX A;  1X2N A;  1MMA A;  1UHW A;  2HXO A;  3NEU A;  5LEJ A;  3PIP F;  1S03 G;  2K3F A;  3PFI A;  2IS1 A;  1RJQ A;  3OHB A;  2P6S A;  2M7A A;  3HKZ N;  2M4K A;  5FD5 A;  5F0H A;  2O7M A;  3RZO J;  2G7U A;  3MKY B;  3MFK A;  3BT9 A;  5DD4 A;  5HLI A;  4CXF A;  4HV5 A;  5EG0 B;  5EZY F;  1A6I A;  3BG7 A;  5LXT F;  5KFX A;  2DI3 A;  5F6F A;  3ZQG A;  3WTZ A;  2L3D A;  4RM3 A;  1R49 A;  3BR0 A;  1G2H A;  4LF4 H;  4B48 A;  3KIO A;  1AHD P;  1F4K A;  2YRW A;  2QF7 A;  5CAE B;  2RVC A;  2VQF H;  4DV0 H;  3AFH A;  5LOV F;  4C3I J;  3O3K A;  2UXD H;  4MTD A;  4CSW A;  4IHY A;  2WE6 A;  5CYV A;  2AGO A;  4K2E A;  5ICC A;  5FJ8 G;  3BAB A;  3KP6 A;  2H8R A;  3J7A K;  4XZ3 B;  1U5T B;  3K4N A;  2E2H A;  4A3L G;  3CQZ J;  1ZAR A;  2BR0 A;  3CDH A;  2EFO A;  3VPR A;  5KFG A;  2RGV A;  4U88 A;  3AG2 H;  5HOD A;  1K78 B;  1YJW I;  2OAZ A;  4KL6 A;  4J9K A;  2QK4 A;  4OX9 H;  3GTK A;  4BS9 A;  1T98 A;  1H8A C;  3L2R A;  2LG4 A;  4YR2 A;  3PW7 A;  3WOD F;  1X1P A;  2A5Y B;  2KJC A;  2JMW A;  2WC2 A;  3FBN B;  4Q43 A;  1LJ9 A;  1J5E H;  2LY9 A;  4Q48 A;  1A0I A;  4TQR A;  4O3S A;  1ONV A;  2XAF A;  2GWR A;  3J81 W;  1ZG3 A;  4A0X A;  3RAX A;  2CWE A;  2NVY A;  2EFP A;  3GWZ A;  2C6Y A;  3FMQ A;  4XRF A;  4Y17 A;  1OR7 C;  1N34 H;  1I27 A;  1FMV A;  3QZ8 A;  4RB3 C;  2E71 A;  3QYE A;  2Q2T A;  2W24 A;  4ANJ A;  5EF6 A;  3HTU A;  2JEG A;  3TKY A;  4DR4 H;  1VBG A;  2DLL A;  5KFO A;  5BOX A;  3HTS B;  5D4S A;  3CDI A;  3CME I;  1HA8 A;  2E5L H;  3M8E A;  3RQI A;  3FX3 A;  1TA8 A;  4XN0 A;  1FEX A;  2ELH A;  1CQT A;  9ANT A;  2CZG A;  2GPS A;  3LSP A;  4WBN F;  3HPH A;  2KT0 A;  4HNT A;  1MZB A;  4HX7 A;  2Y69 H;  3V4Z A;  5IY5 H;  4N0B A;  2ISZ A;  1DGS A;  1JHH A;  2XC9 A;  4M9U A;  2IW5 A;  1JIH A;  2EFQ A;  5LLQ A;  1LFU P;  2Z9O A;  1DFA A;  4G8X A;  4NC7 A;  2XGQ A;  2ATL A;  2P6T A;  4BDY A;  1WCM A;  4WXD A;  1IDY A;  2N8G A;  1P4X A;  3R7P A;  1A9X A;  3T5H A;  2KL4 A;  3LWF A;  2IP4 A;  2JTV A;  2VOO A;  2XC7 A;  2DOD A;  1H89 C;  4BQO A;  4OIO F;  5K7H A;  2AO9 A;  2H8W A;  1UG0 A;  2ZDG A;  2EH3 A;  5GAD J;  2O9L A;  3SHF A;  3G3Z A;  2Q2E B;  5FKM A;  4XLF A;  4MV3 A;  5J1Y A;  1OR7 A;  1J09 A;  2EPF A;  1QBJ A;  4ECQ A;  2JN6 A;  2KPM A;  2VQG A;  1TBX A;  2EA4 A;  3E6C C;  3V4S A;  2JA6 A;  1E3H A;  3A0H C;  3J7Z I;  2F5F A;  1JGS A;  1VF9 A;  2VKD A;  3HIF A;  1R5G A;  3KYD B;  3CCL I;  3RI4 A;  2UVV A;  3FF5 A;  3GIJ A;  3AYH B;  2VC0 A;  1S7A A;  3QP5 A;  4UUS B;  2HFH A;  2PMH A;  1TWH J;  5J2T F;  4CYC A;  2HQ5 A;  2WV1 A;  3DKY A;  3S14 J;  4D7N A;  3L4K A;  1R00 A;  1IRZ A;  1HXD A;  2VIX A;  3DWL E;  2JK3 A;  3QYF A;  3S93 A;  1WSC A;  4OOI A;  5JLW A;  5IT9 K;  4R8U B;  1D0Y A;  4L0Z B;  2IS4 A;  2ME6 A;  2DFE A;  4UN8 A;  4BQQ A;  3JAM Z;  5IYC J;  5IP7 J;  5EWE A;  2EIJ H;  3GIK A;  2VI6 A;  1W7P D;  5FO5 A;  3DV8 A;  4KHP H;  2VL8 A;  1ZG5 A;  2ICW G;  3WO0 A;  4M7E A;  4X65 H;  5KKN B;  2F5V A;  3TP3 A;  3VWB A;  2R8I A;  3JRX A;  2DQR A;  1G3W A;  3KP2 A;  2FSW A;  4ZC3 A;  3OYC A;  1JLL B;  5T14 A;  3CUO A;  3M1C A;  1SEI A;  3ZQI A;  1WJC A;  2FNA A;  3RIZ A;  2C22 A;  4F4X A;  1W36 C;  4TUY F;  2OLS A;  5IWA H;  3OHA A;  3BTC A;  1N78 A;  1GUU A;  1I3Q A;  3IKT A;  3V6K A;  2BQR A;  2ESH A;  1WH2 A;  1WCM J;  2WA0 A;  4RUC A;  4IRH A;  2GLO A;  3CC4 I;  1I1S A;  3OYH A;  4RNM A;  2JZY A;  5TIS C;  2VXD A;  4O4I F;  2WTF A;  1IXR C;  3VEP A;  3FXJ A;  1STZ A;  3H4B A;  2XB5 A;  1MMG A;  1F1Z A;  3FK6 A;  2IBD A;  4HLY A;  4B47 A;  1DP7 P;  1WQ2 A;  4PUS A;  1O7L A;  3M9A A;  2LC2 A;  1IW7 F;  3GW2 A;  4OAZ A;  1KU7 A;  3H0D A;  5CVV A;  2DMQ A;  2IVM A;  4UV9 A;  4AAG A;  2DA1 A;  2R7K A;  3E1S A;  2P81 A;  1QU3 A;  1B33 N;  4TQS A;  2BXY A;  3PO3 G;  5EYR A;  3LP8 A;  1T95 A;  4FT8 A;  3ZMU A;  3AL0 B;  4ME6 A;  4KIF A;  3Q8R B;  5E3L A;  3CP8 A;  2CUJ A;  3JSP A;  1JDE A;  1B9N A;  4NHJ A;  2YUS A;  4E7S A;  1U0J A;  3IWF A;  1UM2 A;  3U1K A;  1ZHF A;  2B0L A;  3V8L A;  3R0J A;  3Q8Q B;  3F8C A;  2K02 A;  2XE0 A;  1DU6 A;  3UVF A;  4U0V A;  4J19 A;  4C30 A;  1WI9 A;  2DT5 A;  5KT6 A;  2A68 F;  2DZD A;  4EVI A;  2KRH A;  2HR3 A;  5TJJ A;  4LB6 B;  5DCF A;  5IPA A;  2HI3 A;  3GF2 A;  3T1B A;  2WV0 A;  4ENM A;  4HQ6 A;  2EIN H;  5LBQ A;  4L1K A;  4RNN A;  3GTP A;  3V4G A;  3QU3 A;  3TW6 A;  4IWY A;  4YJ2 F;  2DYR H;  1WVR A;  3BPV A;  3IKV A;  1G3T A;  2LK2 A;  3LSR A;  4Z1X A;  3K9T A;  4KIT B;  5FRN A;  1MNM C;  1KYW A;  5IYB J;  2XVC A;  2KIU A;  3EUA A;  3ABL H;  3E7L A;  3GO5 A;  1MBJ A;  1BL0 A;  2ZME C;  4KFC A;  4A5M A;  5KT4 A;  1WSU A;  5BPD A;  2GOM A;  1S10 A;  4NC6 A;  4A3G G;  4ENJ A;  2PFB A;  5L3F A;  1EUD B;  2F4M B;  4KIB A;  2VXZ A;  2QQA A;  4A3C J;  3FIS A;  1DV2 A;  1VND A;  2MA3 A;  2W7P A;  4B3R H;  2DO7 A;  3CC2 I;  5EG0 A;  2W9A A;  4EFB A;  4G9Y A;  4ZZL A;  1XGO A;  3BLY A;  5HOO A;  3HOX J;  3RB0 A;  1GVJ A;  1QNT A;  3GV7 B;  1PJR A;  2EV0 A;  5GPA A;  1HNZ H;  2J5P A;  3FM5 A;  3ULQ B;  3WU2 C;  1TWA J;  2EK5 A;  3SZP A;  3BA8 A;  1IOV A;  2W6N A;  2RDI A;  5A2Q K;  1HDP A;  2A69 F;  1HST A;  5K7F A;  2IT0 A;  2MC4 A;  2WWY A;  2XF5 A;  3GID A;  1LQ1 A;  1BW5 A;  3KLN A;  1VQ4 I;  3ASO H;  1YX5 A;  1WPK A;  1T39 A;  2RNG A;  3HM5 A;  4BXU A;  2FB9 A;  1U9O A;  1Y8R B;  4EQQ A;  1R36 A;  1YJN I;  3X2Q H;  4XRS G;  3IV5 A;  1Y1W G;  2DCH X;  2EX5 A;  1HKQ A;  2X6O A;  5C1P A;  3WNZ A;  2QM3 A;  2R84 A;  4EM2 A;  2BE5 F;  2X9D A;  4YBZ B;  3H4D A;  3RQ4 A;  4GLX A;  3J7Y J;  2CV1 A;  2MLG A;  4P5O A;  5DS9 A;  1WZ2 A;  2BY0 A;  2FF4 A;  4BXX J;  5C8Y F;  3LSM A;  2NU8 B;  4DR1 H;  5LGN A;  4WWC A;  1KZH A;  1KQ9 A;  1Y1V A;  3C0F B;  3P7N A;  4U87 A;  4JI4 H;  1L0O C;  5DLG A;  3LAJ A;  5KK1 A;  1N75 A;  2MSY A;  3KLO A;  5J40 A;  1TW2 A;  4L9J A;  4M6Y A;  3E5Q A;  4CIC A;  1M6V A;  1MGT A;  4B43 A;  3ZQF A;  2J6S A;  2JUG A;  4JI5 H;  1YS6 A;  1R22 A;  1YW7 A;  4PJN A;  1FP2 A;  1WJB A;  3E0J B;  5E8I A;  3N44 B;  4AYB A;  2JA8 G;  1A5J A;  4LF8 H;  1XMA A;  5C4X G;  4Q47 A;  3PR4 A;  3MX9 A;  2Y9Z A;  1BOB A;  2W1O A;  2WY8 Q;  1S3J A;  3JRE A;  1Y0U A;  4CYC B;  2BEO A;  4OMZ A;  3QWL A;  4JV2 A;  1GHC A;  1ZQ7 A;  2OTJ I;  4GC7 A;  2KSW A;  5K5Q A;  4XR6 A;  1B8I A;  2XSJ C;  2VBO A;  2FP4 B;  2R3S A;  1ETV A;  2CW0 F;  3U9G A;  4BYY A;  2V6E A;  2YX4 A;  5JH7 F;  3FXO A;  4XIC A;  1IBM H;  1T9J A;  4ZDP A;  4HYE A;  5KFD A;  3P9I A;  4A69 C;  2F4L A;  1BBY A;  2DA7 A;  3VFZ A;  3JSN A;  1MJA A;  2I80 A;  2QSG X;  5DQG A;  2K9S A;  5DCM A;  1Z9C A;  1JUP A;  1A36 A;  4EFE A;  4YRV A;  1ZN2 A;  3PQK A;  5IYB G;  4OU0 A;  3GII A;  1JJ6 C;  1RUO A;  3K2A A;  3ERM A;  3NAR A;  1QPI A;  2Y31 A;  1U6G A;  2DDB A;  2P0A A;  1FT9 A;  3OR1 C;  2QA4 I;  3JAM K;  1U9N A;  3E97 A;  6PAX A;  2FK1 A;  2ZXJ A;  3WHB A;  1DGW Y;  2BVM A;  4LFC H;  3V7R A;  1LE8 B;  4MGR A;  4IR1 A;  4YEJ A;  1PP7 U;  3GTL J;  3C7J A;  4RGR A;  3ESW B;  2E2H J;  1Z21 A;  4F52 A;  2L7M P;  5FLX K;  1MSE C;  3LWB A;  1P8K Z;  3G1O A;  4HLX A;  1XGS A;  2DAO A;  2QWW A;  4Q44 A;  2HDC A;  3CJT B;  1XSD A;  1VI0 A;  2ACJ A;  3Q8S B;  4JI7 H;  1Z05 A;  2M8G X;  1KYZ A;  1T0F A;  4AIJ A;  4A93 J;  4Q5S F;  3BG9 A;  5CVJ A;  4KN4 X;  1JKP C;  3H5R A;  2BW3 B;  2OJE D;  2R7F A;  4BEH A;  3M4O J;  2EV6 A;  5D8D A;  2E2I A;  3VYT B;  1E4F T;  2KRC A;  3F21 A;  5D1P A;  3WO1 A;  1TT0 A;  5FKL A;  1APL C;  4O3P A;  3S1R J;  4KDP A;  5D5W B;  1LDJ A;  3QOD A;  2GPW A;  2XCL A;  4UCU A;  3F6O A;  2L4M A;  2DA5 A;  4ZJZ A;  2MD5 A;  2X1E A;  2P4W A;  3DTK A;  2KIS A;  1K4S A;  1G9Z A;  5GAH J;  2M3A A;  4MEX F;  1BOA A;  3SFI A;  3OS2 A;  4E6K G;  3UR3 C;  3GIP A;  2V4J C;  3HL2 A;  3IG0 A;  3FKJ A;  1R4N B;  3CCQ I;  2R7Q A;  3GTM J;  3CJR B;  4LG3 A;  5J2U F;  4YR3 A;  3CVZ A;  1R7M A;  2AXL A;  2F48 A;  3MN2 A;  2RQQ A;  2I5U A;  1WJE A;  4JOM A;  4E7H A;  2H94 A;  5KT7 A;  3ZN1 A;  2DJN A;  1UJ8 A;  1U5T A;  1IBL H;  2MW8 A;  2Z3Y A;  2LWY A;  3GTJ A;  4RAY A;  2A3S A;  2WB1 E;  5L1K A;  3PZP A;  3OUU A;  1HQC A;  4I99 C;  1D5Y A;  5EJC A;  3MFI A;  5CB4 F;  3AG1 H;  3JRD A;  1TL8 A;  4DL5 A;  2R93 J;  5F0F A;  3RPQ A;  4ETS A;  1FYK A;  3HOY J;  4U0W A;  2XE0 B;  2QQB A;  1D1A A;  1D8K A;  2K40 A;  3RV3 A;  5JI6 A;  2Y0M A;  5IP7 G;  3OSP A;  4EG0 A;  5F04 A;  4M3G A;  4RAG A;  3RB4 A;  3HRT A;  3K5I A;  3FKI J;  1DDN A;  1I5Z A;  3KP7 A;  4RGS A;  2NVQ J;  2MAB A;  4EM0 B;  2KRF A;  3GV5 B;  4LFA H;  5CQG A;  2EV5 A;  2EIL H;  5FJ8 J;  3FDY A;  1PDN C;  5IP9 J;  1RKT A;  2OH2 A;  1PYV A;  3GFJ A;  2V59 A;  4PDK A;  2LKX A;  2XHK A;  4ZTF A;  4ZYG A;  4HDU A;  3BTL A;  4YY3 H;  1SFU A;  4U7B A;  4RBO A;  4KIG A;  2DXI A;  4XK4 A;  2E1N A;  3GFL A;  4YQW A;  3MR6 A;  1AM2 A;  4RAZ A;  2NU7 B;  3ORQ A;  4I4T F;  4XLE A;  2HEO A;  3PW5 A;  4J00 A;  1JVA A;  2QGU A;  1W5S A;  3KHR A;  2EWN A;  3M3Y J;  1L2Z A;  3DTE A;  3PUB A;  4OWR B;  3W6J B;  2O8X A;  3MXB A;  1XC5 A;  1YG2 A;  4AAF A;  4DV1 H;  4DBR A;  1CS0 A;  4XRS A;  1JX4 A;  4JBA A;  3DBH B;  2IXS A;  4UVC A;  2EZL A;  2XB0 X;  2XDV A;  3KCC A;  5KFY A;  4DR2 H;  4LOX A;  2L4A A;  5E1W A;  3OL3 A;  2RDJ A;  2R7Z J;  1TT5 B;  4BKX A;  3QU6 A;  3VOE A;  1L3L A;  2NVX A;  1GLN A;  2XD4 A;  4QJF A;  4NQW A;  3BR2 A;  3ZGK A;  2AQF A;  3G6E I;  1RIO H;  3FD2 A;  4OMY A;  3B73 A;  2JA6 J;  2W70 A;  4C2M J;  1ENH A;  3ASN H;  3DF8 A;  3DFG A;  4IVN A;  3E6D A;  3R61 A;  4B09 A;  3JRF A;  1PP8 F;  1AKH A;  3D0S A;  1ZRC A;  1AUX A;  2XRL A;  1MH4 A;  3DP7 A;  2O61 A;  1TW3 A;  2CYY A;  4IF4 A;  3OYI A;  3HZJ A;  2Y0S E;  1FIP A;  4BE0 A;  2LP0 A;  4M72 A;  4XLN F;  1E4G T;  3FIW A;  4WXC A;  2UVR A;  2KP6 A;  1BJA A;  3BPX A;  4LG0 B;  4FTH A;  1K1Q A;  3PUF A;  2M05 A;  3JAM W;  2P0W A;  1BC8 C;  3LMM A;  1J59 A;  2XCP A;  2M34 A;  2PVP A;  1ITY A;  4IL6 C;  2B9S A;  4DV2 H;  2PG4 A;  3RCO A;  1P6R A;  3MZY A;  2HU9 A;  3NQO A;  4WCG A;  4FS2 A;  4I01 A;  3QYB A;  3MCZ A;  4RB1 A;  2QEX I;  3CLO A;  2V26 A;  4P55 A;  4BHB A;  4C2U A;  1XS9 A;  2DK8 A;  4UV8 A;  2ID6 A;  1J9I A;  4AYB N;  1FBU A;  1W5C C;  2MYS A;  3GZN B;  3PNY A;  4ITV A;  3R6S A;  3TP0 A;  4CCL A;  3CCJ I;  1ZDE A;  1PX2 A;  1WWX A;  3S3M A;  3RUP A;  3VPB A;  5CA1 F;  4BJ5 C;  4UVB A;  2PN1 A;  3BRO A;  1D0Z A;  1ZG1 A;  4UVA A;  3HKZ A;  3KHG A;  3EPI A;  5DM6 F;  3LQR A;  4Q0Y A;  2JNQ A;  4X66 H;  3D5L A;  2QUF A;  4BQN A;  4IOC F;  2UV1 A;  2CFO A;  3ML6 A;  3TMO A;  1K61 A;  1MIJ A;  1S0M A;  4CCO A;  2P5L C;  3MQ0 A;  2OU2 A;  4NXM H;  3IUO A;  2XRO A;  2I3Q A;  3L9F A;  4I0B A;  4QTR A;  2MFZ A;  2UWM A;  4E7Z A;  1GGO A;  3MFH A;  4YFN F;  2Y2Z A;  4E7L A;  2QBY B;  4KL5 A;  4TV9 F;  1QVT A;  3CUQ A;  4I2O A;  2VS8 A;  3A1Y A;  3KXY T;  1UB9 A;  2XAG A;  5LHG A;  1YHQ I;  1NK2 P;  1MBF A;  2V4Q A;  1R58 A;  3BZC A;  3GTK J;  4MTE A;  2IS6 A;  5D6E A;  1TTY A;  3M9O B;  5F27 A;  3VSK A;  5DM7 F;  1WJF A;  3U1D A;  1AT0 A;  1TWC A;  4DV3 H;  4MV9 A;  2PJR B;  3GFM A;  2WB1 A;  1V55 H;  4XKW A;  3MIP A;  1W0T A;  4FIS A;  2V1U A;  1OIS A;  4XID A;  2UU9 H;  4JV1 A;  3KP3 A;  1VFC A;  2DU9 A;  1W7P A;  3LSH A;  5IYC G;  1AA7 A;  2K7L A;  2YZN A;  4E2T A;  1UC9 A;  4IRC A;  4XN3 A;  2QQ9 A;  3H9G A;  1X3Z B;  5BS6 A;  2EBI A;  2VON A;  4UCO A;  5C44 J;  4X0G A;  5JVD F;  3QZ7 A;  1O3Q A;  2H6B A;  2IRF G;  4RU9 A;  3K70 C;  2AXT C;  1XG1 A;  2ZDQ A;  5EOY A;  1N3E A;  1B04 A;  1LUJ B;  5IP6 A;  3QOE A;  2R92 J;  1EA3 A;  1FX7 A;  2I87 A;  4RZQ A;  3WGI A;  5D5X B;  1Z2P X;  4M9X A;  1RYR A;  1NG6 A;  2X1C A;  1P9Q C;  3K69 A;  2VBL A;  2W6Q A;  3SE7 A;  2W57 A;  2DOF A;  4LIV A;  3FXQ A;  2ZC2 A;  1QHG A;  1T8I A;  1QA6 A;  3ZOB A;  2NS8 A;  2MC3 A;  5M3F J;  4ZOL F;  1GXP A;  1BI0 A;  1MBH A;  5FKK A;  2IAI A;  3OMY A;  4YG2 F;  3CMM A;  5AON A;  2FML A;  4A3B G;  3KE2 A;  4HG2 A;  4A3I J;  1FYM A;  4LH7 A;  2E36 A;  1V51 A;  4MV4 A;  2NXN B;  5CLS A;  1T33 A;  3TO9 A;  2O5R A;  4WXH A;  3BCB A;  3SZT A;  1Z6T A;  3UKG A;  3S1M J;  1YX3 A;  1TWF J;  3ABK H;  1ZK8 A;  4RB2 C;  2C35 B;  2W9B B;  5L1I A;  3IC7 A;  5E79 C;  3OYG A;  2IEK A;  1ZRD A;  3MWD A;  4XKC A;  3S17 J;  4CCJ A;  2C2E A;  4G7H F;  2O0Y A;  2YW2 A;  2OQG A;  1CF7 A;  5KG1 A;  1KQ0 A;  3TIN A;  3GME A;  1Z2O X;  2R85 A;  3HOV J;  1ON1 A;  4A3E J;  3HUG A;  4N4O B;  4CCN A;  2VBJ A;  2UUA H;  3AL0 C;  3W6K B;  2DMT A;  1S68 A;  1NHA A;  4PZJ A;  3ORR A;  4N9I A;  2FOK A;  4Z6Y A;  3LA2 A;  1IXC A;  1KEE A;  3BAA A;  1LDK B;  3L00 A;  2XGE A;  4JI8 H;  1J0R A;  4QPQ A;  3HSR A;  5DGB A;  1IV6 A;  2BV6 A;  5EGO B;  3JRH A;  2K4J A;  5BMV F;  2K9Q A;  3GLL A;  4BY7 J;  1TP4 A;  3J7A Y;  2DOE A;  5IT9 W;  1I39 A;  2JQ7 A;  3B6A A;  3SXY A;  2VPS A;  3OOL A;  1Z77 A;  1NTC A;  5B66 C;  4CC6 A;  4O2A F;  5LGT A;  1JKO C;  3HXL A;  4D6O A;  3GUD A;  4OAY A;  4U0Y A;  3C0W A;  2QSF X;  3LAP A;  4ZTJ A;  5EWF A;  3G4S I;  3F8M A;  1IRX A;  1OPC A;  2K85 A;  3WU1 B;  4EAT A;  1HKT A;  4V19 K;  2R7N A;  5A2Q W;  2M45 A;  3CF2 A;  1P4A A;  2KQR A;  4WF2 A;  4A5N A;  4GIG A;  4A93 G;  3LL7 A;  4DUY H;  5FB2 A;  1LFB A;  3OIO A;  2F5E A;  1FSE A;  1UST A;  1Y1W J;  3V6J A;  1IN4 A;  2CUE A;  5AKM A;  3V7C A;  4IX7 A;  4II2 A;  4A0Z A;  1SMT A;  2ID3 A;  4XLC A;  4LF5 H;  1Z3X A;  3ETH A;  1VBH A;  2FPI B;  4B3T H;  3ZN0 A;  4KMU X;  1XB4 A;  4M3D A;  1EF0 A;  1I50 J;  3TBI A;  3TED A;  4F4Z A;  2R7U A;  3E5U A;  3I56 I;  3A02 A;  2R7X A;  3GLK A;  3T5L A;  4B3A A;  2HVS A;  2A61 A;  3GTP J;  2IJL A;  1MDM B;  2NVY J;  1Y39 A;  4XLH A;  2BY2 A;  3KZY A;  2CQX A;  2K5C A;  1VAJ A;  4HR7 A;  3PVX A;  5D1O A;  2ZSI B;  4NNJ A;  2X51 A;  1OYI A;  2HYJ A;  2DA6 A;  3E3V A;  1O57 A;  1OCT C;  1N3F A;  2ZJT A;  3L2Q A;  2KDZ A;  4YFX F;  2CH0 A;  2STT A;  4ZDO A;  1F43 A;  5IT9 Z;  2KHM A;  2L7K A;  1SVO A;  3HPG A;  4RGX A;  4ZYA A;  3RYP A;  3SZG A;  4HYK A;  5C1O A;  1IN6 A;  4BBS J;  2P5V A;  3DXJ F;  3FWE A;  2QYZ A;  5KFM A;  2VQE H;  3ABT A;  1KGS A;  2L9V A;  4GCV A;  4NC8 A;  2PBI A;  3KHL A;  4I76 A;  3MEX A;  5A72 A;  4C5B A;  2A5W A;  4O1R A;  2K9M A;  4D6N A;  3CO6 C;  5HVQ C;  5CVU A;  2I10 A;  2VBN B;  4ECW A;  2L54 A;  4KT5 C;  3WG9 A;  4M74 A;  2ZDH A;  5JVL A;  1B4A A;  2YPR A;  3L2P A;  2LR8 A;  2JA7 G;  5DV5 A;  3HOW J;  2Z99 A;  4XLA A;  2K3P A;  5KAF C;  2NNY A;  1RR8 C;  5E67 A;  3J80 K;  4Q8F A;  3QP6 A;  3ZMS A;  2XKP A;  2WAQ A;  5LGU A;  4QSH A;  2UVW A;  4IO9 F;  1B6S A;  2W25 A;  4TV7 A;  3MXA A;  2LF8 A;  2XV4 S;  2D2W A;  4LFU A;  4ZDL A;  2GXB A;  5A0M A;  4HF1 A;  3ZMD A;  2VT3 A;  4LK1 F;  1FIA A;  3JRA A;  1VQP I;  3I58 A;  4P9F A;  3QAH A;  1I7L A;  3HOV G;  2K27 A;  3M1E A;  4F55 A;  5DG8 A;  5FFZ A;  3MVP A;  3BG6 A;  2ASD A;  3VB2 A;  2P7C B;  1SD4 A;  2BY1 A;  4M3E A;  3RIR A;  3EPG A;  5C4X J;  1TNT A;  4A3L J;  2L7F P;  1YRN A;  5KFA A;  1X58 A;  3V6H A;  2W00 A;  2V9W A;  3TDU C;  5M3M J;  3GX4 X;  1MD0 A;  3DPT A;  3E5X A;  1ZH5 A;  4DR5 H;  2UUC H;  3DEU A;  3HSF A;  4QIW N;  4F4W A;  4YAJ B;  3IL2 A;  4W97 A;  2VS7 A;  2W82 A;  1V5G A;  1YI2 I;  2L9R A;  4A3I G;  5L3E A;  4EV0 A;  5D1O B;  4IRG A;  3HOX G;  4O3Q A;  1S9H A;  3DEE A;  5AKF A;  4ED8 A;  4BBR J;  2V6C A;  4AID A;  4QWE A;  2W84 A;  3H3Z A;  4A3C G;  5A74 A;  3EUH A;  1J5Y A;  1W1W E;  1V54 H;  2CUF A;  5JQW A;  4YII A;  3BOQ A;  2JEF A;  2KIM A;  1KJQ A;  3K70 D;  1IF1 A;  2JWT A;  2VLA A;  3EQL F;  4AVZ A;  4YAK B;  1X1C A;  1G3S A;  1E17 A;  4D9J A;  4XX0 B;  3TIG A;  4XOP A;  5IOY A;  5FLM G;  4G6D A;  1IXS B;  5J3L A;  1BA5 A;  3ZRG A;  4Y13 A;  5F0C A;  3F22 A;  1XMX A;  2AQ4 A;  2M5W A;  1JUS A;  1X2M A;  1HSJ A;  3I4N G;  1G3Y A;  2HZD A;  3MD2 A;  4AQU A;  1IJW C;  1P4W A;  2FLL A;  1XGN A;  1FOW A;  4HQE A;  2WBM A;  3GTO A;  1R71 A;  3GIM A;  3D5R C;  3SEQ A;  2EZK A;  2G0E A;  4JI6 H;  3ECO A;  1LNW A;  2DOA A;  2HGC A;  4BDZ A;  2M8E A;  5ILS A;  2O8K A;  1IRG A;  2W7N A;  4A6D A;  3ZQH A;  1IV8 A;  2M0M A;  4HQM A;  1XNQ H;  2PMZ A;  1OCP A;  3PW4 A;  1SFO A;  1ZEL A;  2LRD A;  2DTR A;  4A3F G;  3OIQ A;  1EH6 A;  2VE8 A;  2RN7 A;  2Z33 A;  2R5Z B;  1BI1 A;  5FLX W;  1HW1 A;  3ERE D;  1U0C A;  3MKL A;  4XKV A;  1Y1W A;  2JVH A;  3K3V A;  3I0T A;  3IWZ A;  3S32 A;  2O6G E;  3TL4 X;  5J47 A;  1TNS A;  2COB A;  3H36 A;  2OQR A;  2E60 A;  2HZT A;  4H0E A;  2W6P A;  4DL3 A;  3J80 W;  5I47 A;  4HAM A;  2WAQ E;  2HVQ A;  3G8C A;  1H9G A;  1R9T A;  2DLN A;  3KET A;  3W6V A;  1CE8 A;  5IYZ F;  1ZQ3 P;  1GSA A;  2KIF A;  4MNU A;  5ICG A;  2OA4 A;  5EZG A;  5I0A A;  5DQH A;  2M2E A;  4O6J A;  3A01 A;  5E63 A;  3DBR B;  5KG5 A;  2Z16 A; 
#chains in the Genus database with same CATH homology
 1SAU A;  4JI7 H;  4CUG A;  4I7H A;  5HNF A;  2F6C A;  4Z20 A;  3A4C A;  4B3S H;  1R6R A;  2WAF A;  3OL4 A;  1D1B A;  3RTX A;  4G6T B;  2IN9 A;  1LWT A;  2HPI A;  2HHH H;  3H5R A;  2BW3 B;  2K9L A;  4BEH A;  3K4B A;  4PSX A;  3VYT B;  5FD6 A;  1E4F T;  2KRC A;  5D1P A;  4DR7 H;  4F93 B;  1TT0 A;  3OWT A;  1VZ0 A;  2HVR A;  2X6Y A;  3PSF A;  2VPL A;  3QOD A;  3HG9 A;  4N4N B;  3EUK L;  3SEZ A;  4RB0 A;  3VYU B;  4UCU A;  3J80 W;  3F9K A;  2L9N A;  4NQW B;  4UT0 A;  3BA9 A;  1M0W A;  3N6X A;  1XNR H;  3VYR B;  2R7W A;  4KT6 A;  3SDB A;  4ZJZ A;  2X1E A;  4PJL A;  1X1A A;  3DTK A;  3SYT A;  3OYF A;  1G9Z A;  2M3A A;  3OS2 A;  1BJT A;  4X62 H;  4E6K G;  3M4I A;  3UR3 C;  2VBN A;  2V4J C;  3HL2 A;  3OYE A;  3IG0 A;  3FKJ A;  2R7Q A;  3CJR B;  4LG3 A;  4UN9 G;  1G59 A;  1R7M A;  3CVZ A;  2RQQ A;  3DQV C;  1WJE A;  4JOM A;  4E7H A;  4UN9 A;  3DTI A;  4XKB A;  3LSG A;  1IBL H;  2LWY A;  3RTR A;  2DT7 B;  2UXB H;  4AQX A;  4RAY A;  4LF6 H;  2ZSH B;  4BE2 A;  2VQH A;  3NWT A;  4P1W A;  3W2V A;  2ZM6 H;  3HOT A;  2OWO A;  3MMY B;  1N36 H;  4JYA H;  2UUB H;  3BCA A;  1ZD7 A;  3IP4 B;  4PSW A;  3HUG B;  3PL8 A;  4ETS A;  2IGO A;  2X6W A;  2XE0 B;  1D1A A;  2UXC H;  3ZR8 X;  2L9S A;  2Z2S B;  3OYL A;  1P8L A;  1FKA H;  2WY7 Q;  5HNH A;  1MOW A;  4UCT A;  4AAE A;  4BXF A;  5A77 A;  4KHP H;  2M4G A;  1BR1 A;  2MAB A;  2JVG A;  4PK4 A;  4LIU A;  3PFY A;  2HPM A;  4BWS C;  1VDE A;  3N43 B;  4YHX A;  2NOJ B;  4LFA H;  1FMW A;  5CQG A;  3ZQQ A;  4CCM A;  1MMN A;  2VBO B;  1SFK A;  4IZZ A;  1X9N A;  5CPR B;  4DV7 H;  3FDY A;  1T9I A;  2I8D A;  3RF2 A;  4UNA A;  1DQU A;  3KYL A;  3FHN A;  1PYV A;  2JMZ A;  2VAS A;  4PJJ A;  4DGW B;  3LFU A;  1WFX A;  5BR8 H;  4ZTF A;  2CW8 A;  4YY3 H;  3KO2 A;  3DPL C;  4U7B A;  1BR2 A;  3UQ8 A;  3EPZ A;  2DXI A;  3NZM A;  2L5Q A;  1AM2 A;  4RAZ A;  5FPR A;  4II3 A;  2XF6 A;  4LH6 A;  4XLE A;  4HNU A;  2V9K A;  4XOR A;  1ERD A;  4CH7 A;  4J00 A;  4CZC A;  2FUG 2;  1JVA A;  2RGR A;  2BOL A;  4UNB A;  3HOS A;  4IKF A;  2XF7 A;  4UCV A;  4E4H A;  4DJA A;  1L2Z A;  4F91 B;  3OY9 A;  3DTE A;  3PUB A;  4OWR B;  4LMY A;  1XMQ H;  2CV0 A;  5AK9 A;  2VJ4 A;  3D5S C;  3MXB A;  1M0T A;  1SYX B;  2OV7 A;  3DF7 A;  4DV6 H;  4AAF A;  4DV1 H;  4DBR A;  4DV4 H;  2AQE A;  2IXS A;  1GYF A;  4HSR A;  2XDV A;  4DR2 H;  4LOX A;  3I3L A;  4UNC A;  1X4P A;  1LWS A;  3OL3 A;  1HNX H;  1X4O A;  1GLN A;  3N05 A;  2AB5 A;  3PNT A;  3CP2 A;  3ZGK A;  2AQF A;  2QKL B;  4PFO A;  2JA2 A;  3FD2 A;  2Q1Z B;  4XMY A;  3N42 B;  2IMZ A;  2KZV A;  4OZ6 A;  4LSA A;  5AKM A;  3ONQ A;  2I3P A;  1ZHS A;  4HRI A;  5E5S A;  2BW3 A;  4BEH B;  4FM9 A;  4F92 B;  2HNH A;  3OYI A;  4RM2 A;  3U21 A;  4BE0 A;  4LSX A;  1MMA A;  3RSN A;  1E4G T;  2E5N A;  2KP6 A;  4BJ6 C;  1S03 G;  2IS1 A;  2P0W A;  3G2B A;  3JAM W;  2M7A A;  3LMM A;  2M4K A;  5FD5 A;  1B24 A;  2O7M A;  3OR2 C;  3MKY B;  3S3O A;  1T0F C;  4DV2 H;  2R7R A;  3RCO A;  4O1S A;  2HU9 A;  3BG7 A;  4XON A;  5TGT A;  4UFZ A;  3PNV A;  4Y3O A;  3N41 B;  4C9Y A;  3QYB A;  4RM3 A;  4RB1 A;  3T1Y H;  2V26 A;  4LF4 H;  4B48 A;  4BU2 A;  4C2U A;  3MXB B;  4DV0 H;  2VQF H;  3CZ6 A;  3H5A A;  3AFH A;  1MI8 A;  4IAJ A;  4JI0 H;  2UXD H;  2QOJ Z;  4MTD A;  4CSW A;  2WE6 A;  4BL0 B;  4ITV A;  2MYS A;  3PNY A;  1ZDE A;  4CCL A;  3BAB A;  3S3M A;  3J7A K;  3V42 A;  2Z1D A;  4BJ5 C;  3K4N A;  3HC7 A;  4NUB A;  1D0Z A;  4XQF A;  2R7V A;  2RGV A;  3HKZ A;  2X1D A;  1GPP A;  4Q0Y A;  2JNQ A;  4X66 H;  3D5L A;  4BQN A;  1G9Y A;  2UV1 A;  2CFO A;  3TMO A;  3L2W A;  4CCO A;  4KL6 A;  1I94 H;  4NXM H;  3IUO A;  2I3Q A;  4BS9 A;  2MFZ A;  2UWM A;  4E7Z A;  3L2R A;  2LG4 A;  4E7L A;  4EFJ A;  4KL5 A;  4EEQ A;  3FBN B;  2VS8 A;  3A1Y A;  4RLQ A;  3KXY T;  1J5E H;  3MKZ A;  2JSP A;  1A0I A;  2R7T A;  4Z1Z A;  1MW7 A;  5LFA A;  2LCJ A;  4UCR A;  3J81 W;  4MTE A;  2IS6 A;  4B44 A;  3DPU A;  4JI2 H;  4E7J A;  3VSK A;  1N77 A;  1WJF A;  1AT0 A;  4DV3 H;  4MV9 A;  3K4K A;  1OR7 C;  1N34 H;  2PJR B;  1LVK A;  4J01 A;  5AKN A;  2WB1 A;  4XKW A;  1FMV A;  3MIP A;  2VUG A;  3KEY A;  4RB3 C;  3QYE A;  2KMU A;  2Q2T A;  4ANJ A;  1JI8 A;  4Y4R A;  2VBL B;  3FBI B;  4LQ0 A;  3CES A;  4PJM A;  4A2A A;  2UU9 H;  4DR4 H;  3LSH A;  1AA7 A;  4E2T A;  4XN3 A;  1HA8 A;  2HGS A;  4E7K A;  3H9G A;  5LL6 b;  2E5L H;  1TA8 A;  4XN0 A;  4UCO A;  4A2B A;  4X0G A;  5LMU H;  1NG7 A;  3HPH A;  4HNT A;  4C2T A;  1MZB A;  4DR6 H;  5HLT A;  3K70 C;  3M8J A;  5EOY A;  2ZFU A;  1N3E A;  1B04 A;  1DGS A;  4PDB A;  4FET A;  3QOE A;  4D1Q A;  3OTO H;  1EA3 A;  1U0D A;  4RZQ A;  1BR4 A;  3IFJ A;  1Z2P X;  1DFA A;  4NC7 A;  1NG6 A;  2E1M B;  1P9Q C;  2X1C A;  2X6X A;  3K4J A;  2KLO A;  4LIV A;  4BDY A;  2VBL A;  2W57 A;  1QHG A;  3R7P A;  3L2U A;  4YHH H;  2KL4 A;  1Z7L A;  4E7I A;  2XC7 A;  3K4L A;  4BQO A;  1OLT A;  3OMY A;  2IN8 A;  3CMM A;  1UG0 A;  3EH8 A;  2E1M C;  5FRO A;  3AKZ A;  1HNW H;  4HG2 A;  4LH7 A;  5CKT A;  2Q2E B;  4XLF A;  3H5N A;  2O5R A;  2VJI A;  1J09 A;  3BCB A;  4FAS D;  2VBJ B;  2WAE A;  1YX3 A;  2RRE A;  3OS1 A;  2KPM A;  3KAJ A;  2LBF A;  2VQG A;  3RGX A;  4RB2 C;  3OYG A;  2OC6 A;  2DT6 A;  4XKC A;  2VKD A;  1HR0 H;  4CCJ A;  1V5E A;  3OOR A;  4IQJ A;  1WJD A;  4NXN H;  4UN7 A;  4DV5 H;  1D0X A;  4YEL A;  3EUH C;  3DKY A;  3NWS A;  5FRM A;  1Z2O X;  3L4K A;  3DWL E;  2VIX A;  3QYF A;  4N4O B;  3S93 A;  4CCN A;  2VBJ A;  2UUA H;  3AL0 C;  1D0Y A;  2IS4 A;  1LFP A;  1UEL B;  3HYJ A;  1O75 A;  4UN8 A;  4BQQ A;  1S68 A;  1V9P A;  4MV7 A;  1FVI A;  4XNF A;  3W2W A;  1LDK B;  4BE1 A;  3BAA A;  4JI8 H;  2VL8 A;  1DP3 A;  2E5Z A;  4QPQ A;  4GKK H;  3I9V 2;  4M7E A;  3KAL A;  4X65 H;  2VJ5 A;  2F5V A;  1N32 H;  3EYY A;  1MMD A;  3VYS B;  3VWB A;  2XIG A;  4X64 H;  2WAD A;  1Z2N X;  2LH9 A;  3J7A Y;  4GRI A;  4ZC3 A;  2VB6 A;  2CS3 A;  3OYC A;  2L8L A;  5IT9 W;  2VPS A;  3OOL A;  2LOO A;  4MLO A;  3M1C A;  1SEI A;  1WJC A;  4CC6 A;  3RIZ A;  3HXL A;  4D6O A;  1W36 C;  4OAY A;  3C0W A;  4ZTJ A;  3K4M A;  5CQE A;  5IWA H;  1N78 A;  1IRX A;  1WH2 A;  2WA0 A;  2UUZ A;  4EAT A;  1FJG H;  2HQA A;  3OYH A;  2IGN A;  3K10 A;  5A2Q W;  4H4K C;  4GIG A;  2IGK A;  2KQR A;  2VXD A;  3CF2 A;  3ZCO A;  2ELJ A;  5K08 A;  3LL7 A;  3E54 A;  1TAE A;  4DUY H;  1IBK H;  3H20 A;  4IX7 A;  1MMG A;  2O03 A;  4II2 A;  3H9Q A;  4B47 A;  4HST A;  4XLC A;  1Z3X A;  4PUS A;  4DR3 H;  4LF5 H;  5A0M B;  4B3T H;  2LC2 A;  4OAZ A;  3KAK A;  3H0D A;  1EF0 A;  3TBI A;  3UNG C;  2R7U A;  5JHF A;  2R7X A;  4AAG A;  1LKX A;  2HVS A;  3E1S A;  4HEA 2;  5LD2 C;  1QU3 A;  3OYA A;  5E5O A;  1T95 A;  3F8N A;  4UCS A;  4DIQ A;  4XLH A;  3AL0 B;  3PN1 A;  3K6G A;  1BP7 A;  4IQ4 A;  2K5C A;  3CP8 A;  3KX2 A;  2CUJ A;  2FLD A;  5D1O A;  2ZSI B;  4NNJ A;  2X51 A;  4AQY H;  4E7S A;  2KEQ A;  4JV5 H;  1DQ3 A;  1U0J A;  4B3X A;  1UM2 A;  1N3F A;  5A78 A;  2ZJT A;  3DLA A;  3FMA A;  2M7B A;  3L2Q A;  2XE0 A;  3UVF A;  2CH0 A;  4C30 A;  4ZDO A;  4UN8 G;  2KRH A;  1G8X A;  2KHM A;  2L7K A;  3SZG A;  3HPG A;  4ZYA A;  3PJR A;  2IN0 A;  4XL9 A;  4KJZ A;  2LQM A;  1W36 D;  3OYD A;  4LF7 H;  2WYO A;  4Z1X A;  4LF9 H;  4KIT B;  5FRN A;  1WJ5 A;  2BVL A;  3PSI A;  3EUA A;  4AAD A;  3LML A;  4APM A;  3RJ0 A;  2VQE H;  4LIT A;  1X1D A;  3ZXS A;  4NC8 A;  3IAM 2;  4CC5 A;  5A72 A;  2A5W A;  2GOM A;  4AU7 A;  2ZXI A;  2K9M A;  5KHD A;  1TZL A;  3W2A A;  4O1R A;  4D6N A;  5HVQ C;  4YIT A;  2VBN B;  3OYB A;  3L4J A;  2VXZ A;  4B3R H;  2VQC A;  2CUZ A;  1Y56 A;  4EFB A;  2CW7 A;  3MWM A;  3L2P A;  4E2U A;  3LSK A;  5HOO A;  3BLY A;  5KNL A;  3S8P A;  3OYK A;  3OYJ A;  4XLA A;  2K3P A;  2VJJ A;  1E0E A;  3RGZ A;  1PJR A;  5FPO A;  1HNZ H;  2W4S A;  4J0M A;  5E67 A;  3OS0 A;  1ZHQ A;  3GBG A;  2WAQ A;  5LMN H;  2Q2U A;  1YE9 A;  4GKJ H;  3BA8 A;  2A6T A;  3S3N A;  2HDW A;  3LSI A;  2V1N A;  4R7R A;  3MXA A;  3N40 P;  2XAU A;  4YIS A;  1X1B A;  1Y6I A;  4ZDL A;  2MC4 A;  5A0M A;  1QHH D;  1AF5 A;  2XF5 A;  4AAB A;  1YX5 A;  2RNG A;  1Z3Y A;  2FE3 A;  2LRE A;  4F55 A;  2IS2 A;  3BG6 A;  2CV2 A;  2DCH X;  2EX5 A;  1N33 H;  4BAC A;  2DCE A;  2KDO A;  4GLX A;  4BUP A;  2W00 A;  2IGM A;  4PFP A;  1WJA A;  3RQ4 A;  2CV1 A;  3L2V A;  3DPT A;  2YCH A;  4P5O A;  4K0K H;  4DR5 H;  2UUC H;  3IGD A;  3OYN A;  2LY1 A;  4UN7 G;  4Y33 A;  3LSM A;  3DU5 A;  2VQL A;  1BGW A;  4DR1 H;  2MCT A;  2Y0S A;  2VS7 A;  2W82 A;  1V5G A;  4U87 A;  3C0F B;  4JI4 H;  2F4V H;  3W3C A;  4DOZ A;  1N75 A;  5D1O B;  1D1C A;  3BC8 A;  4LFB H;  3DU6 A;  4XOT A;  1S9H A;  3DEE A;  4B43 A;  1VS0 A;  5AKF A;  4JI5 H;  3H9J A;  2JUG A;  4RLF A;  2PJR A;  3JSL A;  2F4I A;  4HPQ A;  4PJN A;  1UAA A;  3QQY A;  2DJI A;  4CCK A;  1WJB A;  3E0J B;  4CA0 A;  5A74 A;  3K4C A;  2LY2 A;  3N44 B;  3H35 A;  4AYB A;  3C2H A;  4RMN A;  3K70 D;  4LF8 H;  2VLA A;  4AVZ A;  3MX9 A;  1BOB A;  1X1C A;  2MD0 A;  2W1O A;  2WY8 Q;  4D9J A;  2VOB A;  4R79 A;  4XM3 A;  4XOP A;  3VSL A;  2LYC A;  3ZRG A;  1DGR M;  4B3M H;  1V5F A;  1I6U A;  2R4G A;  1M5X A;  2KSW A;  3MIS A;  1X19 A;  4XR6 A;  3T1H H;  3HYI A;  1K6Y A;  2HZD A;  2XSJ C;  3MD2 A;  2LBF B;  2VBO A;  4AQU A;  2R7O A;  2WBM A;  2V7F A;  2V6E A;  3D5R C;  1IBM H;  1T9J A;  4ZDP A;  4JQF A;  3SEQ A;  3IAS 2;  2VKH A;  2GOX B;  2DOA A;  3JSN A;  4JI6 H;  4BDZ A;  4JI3 H;  5KCM A;  4EFE A;  3MKW B;  3VDX A;  4YRV A;  1MND A;  2W7N A;  3OOU A;  4KIS A;  2M0M A;  2QKM B;  2R7S A;  2X85 A;  3RPU D;  2PMZ A;  1AN7 A;  1XNQ H;  1ZEL A;  2LRD A;  3OIQ A;  1MNE A;  2CMP A;  4QPO A;  3C2G A;  4DBQ A;  4JI1 H;  3OR1 C;  5FLX W;  1U0C A;  4XKV A;  3OIP A;  4DUZ H;  2JVH A;  3K3V A;  1DGW Y;  2BVM A;  2OUM A;  1KON A;  3OYM A;  3S32 A;  4LFC H;  3TL4 X;  2ZXH A;  5A0W A;  2WDT A;  2E60 A;  4YEJ A;  3DKX A;  3A2K A;  1Z21 A;  4F52 A;  2HVQ A;  2L2O A;  1P8K Z;  5I0A A;  3C0X A;  1XDN A;  1XMO H;  5E63 A;  4OX9 H;  4F3Q A;  4BJT A;  3CJQ B;  4BGD A;  2Z16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...