2CW8A

Crystal structure of intein homing endonuclease ii
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
537
structure length
537
Chain Sequence
SILPEEWLPVLEEGEVHFVRIGELIDRMMEENAGKVKREGETEVLEVSGLEVPSFNRRTNKAELKRVKALIRHDYSGKVYTIRLKSGRRIKITSGHSLFSVRNGELVEVTGDELKPGDLVAVPRRLELPERNHVLNLVELLLGTPEEETLDIVMTIPVKGKKNFFKGMLRTLRWIFGEEKRPRTARRYLRHLEDLGYVRLKKIGYEVLDWDSLKNYRRLYEALVENVRYNGNKREYLVEFNSIRDAVGIMPLKELKEWKIGTLNGFRMRKLIEVDESLAKLLGYYVSEGYARKQRNPKNGWSYSVKLYNEDPEVLDDMERLASRFFGKVRRGRNYVEIPKKIGYLLFENMCGVLAENKRIPEFVFTSPKGVRLAFLEGYFIGDGDVHPNKRLRLSTKSELLANQLVLLLNSVGVSAVKLGHDSGVYRVYINEELPFVKLDKKKNAYYSHVIPKEVLSEVFGKVFQKNVSPQTFRKMVEDGRLDPEKAQRLSWLIEGDVVLDRVESVDVEDYDGYVYDLSVEDNENFLVGFGLVYAHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Endonuclease PI-PkoII
publication title Crystal structure of intein homing endonuclease II encoded in DNA polymerase gene from hyperthermophilic archaeon Thermococcus kodakaraensis strain KOD1
pubmed doi rcsb
source organism Thermococcus kodakarensis
total genus 153
structure length 537
sequence length 537
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2005-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14528 LAGLIDADG_3 LAGLIDADG-like domain
A PF14890 Intein_splicing Intein splicing domain
A PF18714 PI-TkoII_IV DNA polymerase II intein Domain IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1010 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2cw8A02
2.170.16.10 Mainly Beta Beta Complex Endonuclease - Pi-scei; Chain A, domain 1 Hedgehog/Intein (Hint) domain 2cw8A01
3.10.28.10 Alpha Beta Roll Endonuclease I-creI Homing endonucleases 2cw8A03
3.30.1490.210 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2cw8A04
2LQMA 1ZD7A 2L8LA 5A77A 1G9YA 1AF5A 4AQUA 2IN9A 2DCHX 3HYIA 3OOLA 2JMZA 1R7MA 5E5OA 2IN8A 2VBOA 5AKMA 4AQXA 4AAFA 4UN9A 5A0MB 2KEQA 1BP7A 2CW7A 4LOXA 4KL5A 3MXAA 1GPPA 4UN8G 4UNCA 5A78A 4Z1ZA 2VBNA 4UN7G 4O1SA 4AAGA 2JNQA 3E54A 2I3QA 3OORA 1T9IA 2FLDA 5AK9A 3R7PA 4GIGA 3IFJA 4EFJA 3C0XA 2QOJZ 3QQYA 1P8KZ 3MIPA 4LQ0A 4UN8A 4OZ6A 2VS7A 3EH8A 3MXBB 5A0MA 4UN7A 2O7MA 2AB5A 1MI8A 5AKNA 5AKFA 2VBJB 5I0AA 1DQ3A 4E2TA 1U0DA 2VS8A 3UVFA 4D6OA 2IN0A 1UM2A 4YITA 1B24A 4Z20A 2I3PA 5E63A 1T9JA 4AABA 2LWYA 4D6NA 3FD2A 1N3FA 3MX9A 4Z1XA 2XE0B 2VBLA 3MXBA 1JVAA 4YHXA 2VBLB 2IMZA 4KL6A 4YISA 5A72A 2VBJA 1N3EA 1AM2A 4AAEA 4UNBA 1MOWA 1LWTA 1G9ZA 3IGDA 3KO2A 4AADA 2EX5A 5A0WA 2LCJA 1U0CA 5E5SA 3C0WA 1LWSA 3NZMA 5A74A 2XE0A 5K08A 4E2UA 4UT0A 2VBOB 4UNAA 1DFAA 2CW8A 4O1RA 1ZDEA 1EF0A 5E67A 1VDEA 3MISA 1AT0A 2VBNB 4UN9G 3HYJA 1M5XA
chains in the Genus database with same CATH superfamily
3F22A 2QBYA 4BDYA 1ODDA 2XGCA 5KFHA 1Z77A 4JI7H 4FASD 1SFEA 2XROA 3JRXA 2PN6A 2DLNA 1LQ1A 4KN4X 3IAM2 4UB8C 3OSNA 1ZRCA 2FB9A 4XKBA 5FFZA 3S1QJ 5CB4F 3SE7A 1SANA 4BY7J 1FOKA 2K9MA 1HC8A 3LAJA 3N8DA 4ZZDA 1PYVA 2P6TA 1X1CA 2XF5A 3ZN0A 3BZKA 2LP0A 4CCNA 1B4AA 2P7VB 2ELJA 3H3UA 4JP0A 2HQNA 3C2HA 3E97A 4LLLA 4ED8A 3BR2A 5BPIA 3FX3A 1A35A 1B59A 4UNCA 3DBRB 4IWYA 3IWFA 4IRKA 5D1OB 1IOWA 4PCQA 2R8GA 3CC2I 2IA6A 3G1OA 1TWCA 3OYAA 1ZLKA 4UY8I 2VOOA 4Q5SF 5J1UA 1WH2A 1IV6A 4YR0A 2A6HF 5FKMA 4O3QA 3JCUC 2BOLA 3C0XA 1MDMB 1BOBA 1MD0A 4JBAA 4C2MA 4DV7H 4WXDA 1C30A 5J6XA 2A5WA 2E60A 1T08B 5D8LB 2MW8A 1Z2OX 4A3MJ 1WVRA 1R58A 4BAYA 4XQFA 4HF1A 2EFOA 3VMMA 2F4VH 4A3LJ 3WTXC 1B8IB 3IKVA 3U1KA 1X4PA 5I0AA 3KCCA 4Y17A 4E2TA 1NTCA 5KG7A 4BY7G 1TZLA 2Y0MA 2NS7A 2O61A 4RB1A 1N25A 1ZRDA 4KDPA 2IN0A 4GYGA 1G59A 5LD2C 2B9SA 3C18A 1FIAA 3OTOH 2R0QC 3AG2H 3VDXA 1WSUA 1Y1WJ 5BR8H 4OINF 5EWFA 3L2UA 1LDKB 2IAIA 2VJ5A 1MIJA 4A5MA 1EJ9A 2XAQA 1BC8C 2NXNB 4KN7X 2V5AA 4U87A 4LB5A 4J00A 4MV1A 4EG0A 4RLFA 3QZ7A 2HZDA 4F50A 2VODA 2JTVA 2DT5A 4YEJA 3ZQ7A 3MXBA 2BY3A 4LK0F 2R4GA 4YHXA 2X51A 5KFGA 5BPFA 1XGOA 2WWYA 4MEXF 1GSHA 3I12A 1XSDA 1FBQA 1N3EA 3G8CA 5JR3A 1IAWA 1X1PA 1MJ9A 2F2EA 4AC0A 4C2TA 3QQAA 2FK2A 1WHUA 3UFXB 2L3DA 3FM5A 4A3EG 2BXYA 4BQAA 1X2MA 2KHMA 2VKVA 1TQMA 3HHGA 2B7EA 3BAAA 4FETA 1HW2A 3GIQA 2NYXA 2DT6A 4Y13A 5HLIA 3K4MA 2HU9A 1VQ9I 4A3BG 4HNUA 2XVCA 2R7ZJ 4P96A 2Y0SN 3DFGA 5TRDA 2NVTJ 3T1BA 2ICWG 1XC5A 5FLXK 3G2BA 5DG8A 2IGNA 3MEXA 1N36H 4G7HF 2ZFUA 4DBRA 1RK5A 1X1BA 1M0WA 1UZCA 3KALA 4NDLA 4PJMA 3H0GJ 3PM1A 2JN6A 4QWQA 1EF0A 4KA4A 3BQ2A 1VBGA 3K4JA 4DR1H 4XONA 2G7UA 1KC7A 4L18B 4G94A 1P4AA 2W57A 1LE8A 2ZM6H 3HZJA 3KAJA 5HV6A 1EV7A 1R5ID 2XSDC 2E1CA 4XL9A 1XG1A 5IOYA 4ECUA 3OYKA 4P5OA 4LF5H 3E5QA 1CF7B 3LNQA 3DU5A 5KG1A 2CW0F 4B09A 5ICCA 1RESA 3HRUA 3ZMZA 1R7MA 4B3MH 2LC2A 1N48A 4E6KG 1X1DA 1KA8A 5IYZF 3MR3A 3VYTB 1POGA 2AHQA 2R7UA 3RIZA 2R7ZG 3AKZA 3RUPA 3MR2A 1G3WA 3OYEA 2CW7A 4MQ9F 2DA5A 4A3JJ 1RNLA 1A36A 4XM3A 1VQ7I 3P9CA 1PJRA 2V6EA 5A78A 4Q8EA 3V7RA 3MMYB 2ETHA 2I87A 4L9VA 1GSAA 3FK6A 3JW4A 1AKHB 3K4BA 4J19A 1T9IA 3H0GG 2X6YA 3GLLA 5KG3A 2BHYA 2QF7A 2Y9YA 4GIGA 1I27A 2VUMA 1XGNA 4ZYHA 1RKWA 3D1NI 4UNOA 1JKJB 1DP3A 2B63A 3K3PA 1UHWA 1P8KZ 3HXLA 3TQNA 1IN8A 2LBFA 3IP4B 4E7HA 3HTSB 4XRSA 5EGOA 3VWBA 4XORA 4BJ5C 3A01B 4CZZA 4HG2A 1IXCA 4QJFA 1BBYA 2R8KA 1IRZA 2H6BA 3KP5A 3CMYA 2W71A 2B0LA 5E3MA 3BG9A 5HOOA 4LITA 2R82A 3BY6A 4G6TB 3H4DA 2L9NA 2FQ4A 4ANJA 1YITI 4ECYA 2KRFA 2EBIA 3CC7I 2FLNA 1OCCH 1CE8A 2CQKA 3RPUA 2CQNA 4F3QA 2ZSHB 5IP9G 3BR6A 3I4NJ 4BHCA 1QQIA 4EJUA 2KJCA 3CMAI 2MLKA 1UCRA 3GTLA 2LSOA 3GFIA 2VLAA 1KJ8A 3KP6A 4L9JA 4JX5A 4PK4A 2P7CB 1R1TA 2R7DA 1YX3A 2RNGA 1EF4A 4IR9A 1V3FA 3QPHA 1G4DA 1W93A 2GPWA 3ETHA 3RSNA 4RAYA 4ECRA 2LY2A 3M4IA 1E4EA 2IW5A 3R0JA 4A3KG 2R6FA 1SCUB 4HYEA 3M9NB 3E6MA 2DMPA 2J5OA 3KEOA 3GTJA 5BPHA 2YCHA 1B1BA 3ONQA 4LG3A 4P55A 5K7ZA 1U78A 1FYLA 4EM1A 2CQYA 2QSHX 2ZDGA 1MBHA 4JI1H 3N41B 1LNWA 4F91B 3FM3A 5K08A 3G3ZA 4XLAA 2JK3A 3FZVA 1T38A 4IHVA 3V4SA 4RNMA 3RB6A 2VBOB 1FNNA 2H1LA 5EEGA 4OIRF 1OLTA 4B1RA 3KETA 5KNLA 2D45A 1XDUA 3VYSB 4IRIA 3RJ0A 3I4NG 3MZYA 2QYOA 3OIOA 1EA3A 2W6ZA 3K70C 1ERDA 4EJWA 2WDTA 2K9SA 3CF2A 3HRTA 3W2AA 2DFEA 2L4MA 4HSTA 4FU0A 3TINA 4DR2H 5F9NA 2PFBA 2JEFA 4A2BA 2E1OA 3WHCA 4GDFA 4RNNA 2KPMA 1XGSA 3K7AJ 1VQ8I 2V59A 5KT3A 1TP4A 2HWVA 2W6OA 3JSNA 1S10A 4OOIA 5EDNA 2UV1A 4MV7A 3OSPA 1FOYA 1R5HA 2GQQA 5DQGA 4BXFA 3LSJA 2R7WA 1E3OC 5JLWA 2FMYA 4G7ZF 3G6VA 4GLXA 3WGGA 1I94H 2E1NA 2HKXA 2OAZA 2KRCA 3BG3A 3OR1C 1YRNB 4E4TA 4EBDA 3TIGA 3OYDA 2Y0SE 2GPSA 1E17A 3WTSC 4ZH4F 2IEKA 3CESA 4ED3A 2QK4A 2VOBA 2XF7A 3GIIA 4I6ZA 4D5FA 2L54A 2IA0A 1JKQC 2QQBA 3O6BB 2R7OA 4M9XA 3PQKA 5FRMA 2JNQA 2NU8B 5BMVF 2XGQA 2FLDA 2RQQA 3R7PA 2DYSH 4LH6A 1JUSA 4O2AF 3WTZA 1YW8A 4DNCA 2LKSA 3K4CA 4Y15A 3ZQCA 2IP2A 3HPGA 4ZDOA 2HHHH 2ID3A 4EGJA 3K69A 1T98A 3QQYA 5KT2A 5ILUA 3K2AA 4FX4A 1W0UA 2C2EA 3KYCB 4EJVA 2AO9A 3A4CA 4GFBA 3DKXA 1RETA 2AU0A 2PEXA 2LR8A 3IL2A 3CF5F 4MTEA 4MIMA 5FRNA 2LOOA 2ZSIB 2PG4A 4MGRA 3HOYJ 1U0DA 5K2MA 3SJMA 2QKLB 2JA6J 4WWCA 1VQ6I 3HOUG 1KYZA 4R8UB 1JXSA 3IRQA 1U5TC 3BG7A 2Z33A 2VT2A 3Q0VA 3RBEA 4AUXA 5LFAA 3SZPA 4HOBA 2M7BA 2EA2A 4OWRB 1GV5A 3OS0A 2R86A 1OFCX 1LB2A 4DV2H 2AXLA 3GTQA 4NBQA 2P6SA 5CVJA 4UVAA 3HUGB 2E5ZA 2K9NA 4M6VA 4CH7A 3OOPA 4PJLA 4XNFA 5ED4A 1VNDA 4Z1XA 1BXRA 2MABA 3O8GA 5L1LA 3MN2A 2IMWP 3BQZA 1QPMA 1TWFA 5EEAA 1SFOA 4OIQF 1PVEA 3ML6A 2J6SA 4JI3H 4EEFG 2ACJA 2XB5A 2HGCA 1AM2A 4E7IA 3I4PA 4MLOA 5JQWA 4K0KH 3T5HA 2FKLA 3IH3A 3DEEA 4ZDLA 2HDWA 3R5HA 2ZDQA 2L9SA 3VOEA 3FMQA 5AIQA 5J4VA 1E0EA 3HOYG 1W7PB 3SDGA 5HS8A 4KYWA 4NXMH 5GP9A 2RDIA 1IXRC 2JA6G 4Q0YA 1ZAOA 3OS2A 1JKRC 2DMQA 4HV5A 2IPQX 4U7BA 4A0XA 1AOYA 4IWXA 2P5KA 3BR0A 3CCRI 5JLXA 2OU2A 5DG7A 1S7AA 1MNEA 3GIJA 4HQEA 4IRDA 2M4GA 4B44A 2QA4I 4NLGA 1D1BA 3W2WA 4YRVA 3OYNA 1AT0A 5IT9K 3HKZA 3F23A 3PUFA 5JFRA 4X62H 2XCPA 2FUG2 2R8HA 4QWDA 3A02A 3PW4A 1Y8QB 3BZCA 3C2GA 4W97A 2PJRB 4FBUA 1GUUA 4GO1A 4J01A 4HX7A 1ZD7A 3BQ1A 1SFKA 3KTMA 2KZGA 2BVMA 5KT6A 1OCOH 2DPUA 4AQUA 2IA1A 3RKWA 2XC7A 1RI7A 3JZIA 1K1QA 4ZYDA 3TOAA 4M6YA 4RGRA 2W82A 2NS8A 2NVYA 4XSZF 5E5OA 2M0CA 4CO8A 2Y48A 4HNVA 5KFCA 3FXLA 3F21A 1U2WA 4EYHB 1Y1VJ 4C3HJ 4M3FA 5FPOA 3KP7A 4J9LA 3QODA 5E3LA 4YG2F 1MW7A 2GXAA 2DWCA 1K6OA 3I59A 2BGCA 2LRDA 3FDYA 1SYXB 2UVWA 4CC5A 2M9HA 2EA4A 2J9GA 3E7LA 4Z6YA 2JQ7A 2KL4A 4TV7A 3RDIA 4Q47A 1ULYA 2BE5F 2K40A 1ON2A 4NC7A 2BR0A 1ZELA 1IN6A 1OCZH 2JEJA 2NNYA 4L5IA 2OC6A 5GONF 3ECOA 2R7ZA 2CH0A 4L0ZB 1WFXA 2XAJA 4ABZA 5EOYA 4LQ0A 2BHZA 2I80A 5C5JA 1HNXH 3BZ6A 1IN7A 1S7OA 1W96A 2XCAA 3A03A 2ME6A 4ED0A 5BQTA 3RI4A 2ISZA 2X85A 3VYUB 2VBZA 3H0GA 2OPTA 1WH7A 2OD5A 4UHTA 3FXMA 4A3GJ 1B6RA 2VS8A 1YW9A 2LFBA 2XAHA 3BG6A 3ZQHA 3NARA 3GILA 2K02A 2M8EA 4I99C 1TNTA 1YQAA 2W85A 1SC7A 1GGOA 1Y1VG 5B66C 2Q2UA 3I64A 3BOQA 3KEYA 3CC4I 4AIKA 2UXCH 1UC9A 2VQHA 1WRJA 3LQQA 5B1AH 3I56I 2YYAA 2R5ZB 3E5XA 2CUFA 3ZPLA 3ZOBA 1S72I 2V4JC 2VBLA 2RN7A 4XLPF 1X2NA 4TV9F 5M5XJ 5DQIA 4O2BF 3OYJA 4HR7A 4ECZA 2A5YB 2BW3A 4LLGF 5KFAA 1NK2P 3VSLA 3VB2A 5IYBJ 3ZN1A 3H20A 3VODA 3VEPA 2VXZA 3NAUA 2OQRA 3SZGA 2R84A 3CMMA 1Z2NX 4AVPA 4ZJZA 3CCJI 3HL2A 5FKNA 1J9IA 5D8DA 4A3GG 2QBYB 3BR3A 3M8JA 4IEJA 5EEHA 1JLLB 3MAJA 4FQGA 5B1BH 3GO5A 1OYIA 4A6DA 4DZPA 4HV6A 2KQRA 4IHYA 2KZVA 3AL0C 3GTOA 5KFMA 2NVXJ 3RV4A 1G3YA 4APMA 4FT8A 2ZJRF 2FOWA 2IGKA 3LFUA 1QRYA 1ZH5A 4U0WA 2DMTA 1L2ZA 3CDIA 1DP7P 1MSFC 2ALZA 2GZWA 3FXJA 4RB0A 3MWEA 1EH8A 3OL4A 5GPCA 2RC4A 5FKLA 3N4MA 2FE3A 5LLQA 4LLNA 4C5CA 2XRLA 3WNZA 2XGPA 1G6NA 2D5VA 2XKPA 4N9IA 4PWQA 2XDVA 1V54H 1LKXA 1R4MB 1XMKA 5IYBG 1VZ0A 1EZ1A 3M4OJ 1HDPA 2IN9A 1KGSA 1HA8A 1EHIA 4C3JJ 2WAFA 2O8KA 2FBIA 2X6XA 4J9KA 1Y0NA 3Q0UA 4LOCA 2UVVA 3E5UA 2G9WA 3UR3C 2JSPA 1P9QC 2VE9A 2PI0A 3CD6I 3ORRA 4C5AA 3R0AA 2DN0A 1HSTA 2EV6A 4NHJA 1JX4A 3L00A 2VPRA 1UHSA 4YELA 3PW0A 2JPBA 4EMSA 5D4RA 2BQ3A 3ZQFA 4ENKA 5BS6A 3PW2A 3DLAA 3FMRA 1F5TA 2JUCA 4I2OA 3PUBA 1X9NA 1HCRA 3GFMA 4RZQA 5KFUA 3HOWJ 3GZ5A 3M1CA 4KT5C 4M73A 5KK1A 2IBDA 4LF8H 3CUOA 3S3NA 3VPBA 3WG7H 4B3SH 2A69F 4OZ6A 2R7RA 1AA7A 2GIZA 1FKAH 2Z9OA 2W1OA 3MXBB 4NQWA 1I1SA 2RF4A 2L01A 4ENJA 2C22A 2X9DA 4BY1J 3FHZA 1KU9A 4Y3OA 3HTUA 2R92J 2GAUA 2M1BA 1VTNC 3C1DA 2XAGA 5D6EA 1LFBA 3CCVI 1D1AA 3M07A 2A61A 2DA4A 4B43A 1IBLH 2E36A 3T0YA 4YITA 1O75A 3H9QA 4HW0A 5E18F 5LEJA 3Q1KA 2GA2A 2OCCH 3ZQIA 4UV9A 5KFYA 1JKOC 4QTRA 3OYBA 1ITYA 3PL8A 2A3SA 3B02A 3PZPA 2P5VA 4KZSA 2OA4A 4ECXA 2HVSA 4C30A 2O5RA 4EM2A 1CS0A 1TC3C 3QRFF 2R87A 3G73A 3RKQA 2DT7B 4D7MA 2VBYA 2PBZA 3PN1A 3T5KA 3HIFA 2LCJA 4BY1G 2KFDA 3FIWA 4AD9A 1BW5A 4O3OA 2R92G 2OF7A 3LWBA 3RQIA 2XB0X 4I4TF 1E3PA 3D5SC 3BCAA 3I4MG 2VBWA 2NRAC 4HF2A 1D8KA 3CCSI 3PNTA 2QQ8A 4G7OF 4PJ0C 4UNAA 1ZGJA 3L2CA 4O1RA 1FWZA 1FOXA 2W7OA 2UUBH 3T5LA 1KEEA 1QZYA 4LIVA 3BJOA 5E67A 1MNMC 4TUYF 3RBDA 5KCMA 3MISA 5L3EA 3FMAA 3GFLA 2JA6A 2VASA 3HKZN 1I6UA 2R7FA 3R61A 3JTGA 2E2HJ 1RYRA 3DQVC 4QWCA 3CLQA 2WE6A 1XSXA 1Z1DA 5KFXA 3U1DA 3S1NJ 1JDEA 2HVQA 5L1IA 2W48A 2RGRA 2W7NA 2JA7J 2F5VA 2DA3A 2LBFB 4HDVA 5EGOB 2VJJA 1O3SA 3TKYA 1BJAA 1BP7A 3CCLI 3H9JA 4LOXA 2CMPA 5JVTA 2GIVA 4ESJA 1ZQ3P 4J9OA 2EIKH 3J7YJ 3F0CA 5CYVA 4PGHA 2XIGA 3BA8A 2ZJQF 4DBQA 2YL2A 4BHPA 2J6UA 3OORA 2IBKA 5GAEJ 5L1KA 2L7KA 4PDBA 4JI6H 4GXOA 3CDHA 1VKZA 2UUAH 4O5VA 2DIKA 4NUBA 5EG0A 4I01A 4UCRA 5KT5A 2LH9A 4E7KA 1MBEA 2RNJA 2E34A 2IS2A 2MG4A 2ESNA 4XK4A 3GTQJ 1FLIA 2UWMA 4F4XA 3NEUA 2OCEA 3B73A 1MI8A 1V5EA 1TWFJ 2EFQA 4PFPA 3P5JA 2JVHA 5TGTA 1SFOJ 3V8KA 3WU2C 4A3CJ 2EV5A 1IV8A 1DGSA 4M9UA 2W9AA 3Q8QB 2JA7G 1H0MA 2XC9A 2XHKA 3BJAA 3K10A 3J80K 4RB2C 3I55I 5LMUH 3SZTA 3H40A 2R3SA 3L2WA 4CUGA 4DLKA 1H8AC 1E4EB 5LA6F 2CYYA 4IQ4A 3OYMA 1LUJB 3CJNA 3DTKA 1FP1D 3OL3A 4MNUA 3JRFA 4UVBA 3M8FA 1BA5A 5A2QZ 4B3RH 4Z20A 3KYDB 1IDZA 5HDKA 2EZKA 1IG7A 3B6CA 1Z2PX 2W9CA 4HX4A 5CJ9A 5D4SA 4C5BA 3CCUI 4IHSA 5FKOA 2KIUA 3I58A 4A3DJ 1W1WE 1IOVA 4A3EJ 1I6HJ 2IMZA 3PW5A 2DXIA 4KL6A 1Y1VA 3CQZJ 3S32A 1DDNA 2WTEA 3TL4X 3MFHA 5FLXZ 3RB0A 4GKJH 3RYRA 3HOVJ 4KJZA 5KFTA 4UNBA 5GTIC 1F9NA 1D0XA 3TMOA 3BTLA 4A3BJ 3JSLA 1N56A 1R9TA 4NC6A 3G71I 4A3CG 4B8XA 5E5SA 4EGZA 1UC8A 3EDPA 4LFAH 4XBFA 2DZDA 3F8FA 1HKTA 3NZMA 2F5EA 3WO0A 3LQRA 5CQEA 3LSGA 5LHHA 1QPIA 2XGDA 2W6NA 2WV0A 2NAZA 5CVUA 2FPPB 3TQ1A 2L7FP 2NVYJ 3CCQI 5FD6A 2FMAA 2CW8A 3NGDA 4JYKA 2VPLA 2E71A 5DDGA 5J4YA 2VPSA 3JRHA 1C0WA 5FLXW 2TDXA 4L0YB 3K5IA 2CFXA 3TDZC 4J9MA 4A3DG 1RR7A 2CFOA 3RJPA 1WQ2A 5KVRA 3KLNA 3EETA 5A2QK 2PJPA 1OR7C 5E79C 2X6OA 4LIUA 4P9UA 3KHGA 2FLLA 1D0ZA 3HOVG 2VOPA 1FVIA 3VYRB 1IUFA 5IP7J 3LA2A 2HNHA 3F6VA 2N8GA 2JSCA 1KU7A 2V9PA 3PFYA 1T0FC 3HPHA 5EZYF 3I9V2 2LLKA 1STZA 3S8PA 3OIQA 2M8GX 4O3RA 1S5LC 2WAEA 2YRWA 3H1CA 3H4BA 2E7WA 2O0YA 1O3QA 6PAXA 2GOXB 5ICFA 2BZTA 3K4KA 2VJIA 3O3KA 5DLGA 1ZG3A 4ENNA 4CYDA 5J1RA 1EH7A 2I3QA 2HYJA 2YU9J 5KFNA 4ZTFA 3RAQA 3DPLC 2HPMA 2CQXA 1UELB 3HJEA 4DV1H 4D1QA 3H3VK 4FCYA 1IGNA 3HKZE 3LSHA 4HYKA 1XMOH 1U9NA 1YE9A 2D1HA 2QUFA 2XAFA 2NVXA 1VFCA 2STTA 3K1MA 5IP7G 3ASOH 4PDKA 2FPGB 1ZHFA 4X0GA 1WCMG 3V4ZA 3ABLH 1ENHA 1W36C 1O7FA 5H6QA 2NOJB 2L7ZA 5B3SH 4LSAA 4CCOA 5J2TF 1MZBA 1S7EA 3LSRA 2EZHA 3TBIA 4JQFA 5IP9J 3QU3A 4XLCA 4H4KC 3U21A 3WU0A 1A9XA 5KFWA 4JV2A 3LOCA 4OAYA 1A6QA 3GTKJ 5KFIA 4IO9F 3RZDJ 3BPXA 1T3NA 4HX8A 4B4CA 3MKYB 2MH9A 1QZZA 2X4HA 2I3PA 1MBGA 3IUOA 4JX6A 4AABA 3SFZA 1KJJA 2YS6A 5KFSA 3WGHA 4D6NA 1ETOA 3ABKH 3ZQQA 4O4IF 4G3IA 1Z05A 4Q44A 3GTOJ 2BYVE 1LDDA 1A6IA 4RDUA 3OUUA 2MSYA 1B6AA 4Y33A 4A0ZA 5DUKA 3IC7A 3BTJA 4A3KJ 1S9FA 1VF9A 2ZMEA 1Z21A 5KFDA 3F8BA 1D5YA 2GOMA 2DYRH 5AONA 3ZP5A 2AGQA 3ABUA 1FT9A 3EYIA 1N34H 4YIRX 1EH6A 1ZREA 2XAUA 1MMGA 4BE2A 1ZTRA 4ZTJA 3QWLA 1XMQH 1UG0A 1YJ9I 1OCTC 3EUHC 4Y7NJ 2O6GE 1QU3A 3BCBA 4MAMA 2H6CA 3JSPA 1ZG5A 4ESBA 1G3TA 2HVRA 2O3FA 2NNNA 3F9KA 5EYRA 1B72A 2R92A 1XX5A 1IO2A 4EFBA 5JHFA 4UCVA 3I59B 1IBKH 4JYAH 2MCTA 3N43B 2R7KA 2MBFA 4O3PA 3PO3G 4HDUA 1JJ8C 2VN2A 3U9TA 3IH4A 2WTFA 5I47A 3HSEA 4CICA 4HQMA 2LQMA 2EWNA 2ZJPF 1DU0A 2ELHA 3V7CA 3GXOA 2WA0A 1KJ9A 1FMWA 2VB6A 3GQCA 1R4NB 1X3WB 3FXQA 1PP8F 4BEHA 3BQ0A 4PGGA 1FP2A 4TQSA 4DV0H 4LF9H 2K5CA 3SFIA 4AU7A 2ZC2A 4P9FA 3BA9A 1Z9CA 1YOVB 1IRFA 3QYBA 2ZFWA 1TT5B 4AQXA 2H8RA 4KMFA 1YIJI 5IT3A 4ECVA 3KX2A 3KHRA 2VKEA 2ZNYA 4EYIB 3F8NA 1S68A 1R7JA 2EZLA 1A5JA 4S05A 4M9ZA 2KDOA 3A0HC 1GYFA 4BBRJ 1F4KA 4MV9A 3EPIA 3KHHA 1WJBA 2F5CA 1IUYA 1ZYRF 2EZIA 2COBA 5GTHC 2YU3A 3Q9VA 1BI2A 5L3BA 2BY1A 5EF6A 3CCEI 1F36A 2DPDA 3RGZA 2QOJZ 4NXNH 4BXXG 2JUGA 2V1XA 4CDGA 5TISC 4FM9A 2CO5A 2VS7A 1GDTA 4F92B 1WSCA 3L1PA 2FNAA 3MKLA 3GBGA 3ZMVA 2Y30A 3OYHA 3COAC 3HOUJ 4FS2A 2L0KA 4QPQA 1TWAJ 1HKSA 2BW3B 2JA2A 5AIPA 4ZZLA 3KIOA 5E1WA 3BJYA 3HOSA 4DL4A 4D9JA 3CVZA 5KAFC 4XKVA 5FB2A 4LB6B 1T2KA 3LSTA 2UUZA 2NOGA 2E2HA 1EUCB 4LH7A 4KITB 2DA6A 3L2VA 2UXXA 2Z3YA 4IPAA 1YO5C 1D3YA 4V2GA 3KPHA 1AU7A 4EGYA 4PJJA 1B9MA 1N77A 1XTAA 2V9KA 1FJLA 5KX5F 3UKGA 5D5VB 1N3FA 4BBRG 2JA7A 2MD5A 5K5OA 4A2AA 4YFXF 3CO7C 4FTHA 3G6XA 2LREA 2EIMH 4QLCU 3GEZA 1LJ9A 2VKDA 1KJIA 2XD4A 3M1EA 1R71A 3CJTB 3GZNB 2VBJA 3MKWB 4M7EA 1AWCA 4I98B 2AXTC 2DAOA 3KO2A 1XS9A 5HODA 3N6XA 4UFZA 3OUZA 2RAEA 3IAS2 5F9LA 1O4XA 1D0YA 4IHTA 5JUMA 2ZB9A 1BIAA 5HVQC 3ULQB 2VXDA 1APLC 1YFHA 5IT9Z 1ZR2A 2FNPA 2EB7A 2ZBKA 2RREA 3CO6C 2W9BA 4UUTA 4MHGA 5K5RA 2Q2TA 1NG6A 4A0YA 4BL0B 1YS7A 2XE0A 1PP7U 3AG1H 4KIFA 2E5LH 4BS9A 4WCGA 1A31A 1QHHD 3V6HA 5FLMG 4LFUA 2QZ8A 4WXHA 1BI1A 2P81A 5H2FC 2FQ3A 3QAHA 1K7AA 4Y4RA 5JVLA 3T1HH 3DTEA 1TL8A 1YI2I 4XLFA 3HBLA 4XIDA 3JRDA 2I8DA 5IT9W 4I0BA 2HTSA 2L8LA 2CS3A 3RFCA 2XPUA 3NRVA 5FD5A 1J5YA 5HNHA 4M9SA 3G1LA 1KYWA 1S97A 4F93B 2J6TA 5DCMA 1I39A 2FOKA 1U8BA 3W6JB 3GF2A 3FXKA 4XN3A 2JPCA 1OYYA 5AKMA 2DDAA 1CQJB 2W6QA 3GV8B 5J2UF 4LF7H 5J8FA 4NQWB 2HOTA 3CQZA 2K27A 2DFHA 4XMYA 3MFKA 1S0OA 2ZNZA 3M8EA 4CCMA 4YFNF 2COMA 2KJBA 1ONVA 2ASLA 2TCTA 1XNRH 4BHBA 4PUSA 3SEZA 1SAUA 4IRHA 2VKHA 3BG5A 5FO5A 5LOVF 4KNYA 1I6XA 3GWZA 2J5PA 3RYPA 4U7DA 2VIXA 1H88C 5AK9A 3WTWC 2CV0A 3GIMA 3Q8RB 4EFJA 4CZCA 5K7FA 3QU6A 1LFUP 4M74A 3IKTA 4MV3A 3MIPA 2AQ4A 5KFKA 4QIWA 1VQMI 4RAGA 2EJRA 3WU1B 2LY9A 5A0MA 4UVCA 3V4GA 2DOFA 2E19A 3FBIB 3LSMA 2FPIB 5DCFA 1REPC 3R60A 4DV4H 4QFQA 2C00A 3SEQA 5DLFA 5E1ZB 1UG2A 4BE1A 3JRCA 4ED2A 2MLGA 1HKQA 2FLPA 3DLLF 1K61A 3KP2A 4EV0A 1R9TJ 3OMYA 4M6XA 2UU9H 1UM2A 5D5XB 4RGSA 4XOTA 4JI0H 1SD6A 3I5UA 3HM5A 4IL6C 5FJ8J 1B24A 3M9OB 3C3WA 1XGMA 4IOAF 1QVTA 4RLQA 1WCMA 3JTHA 3OSGA 5E17F 3EYYA 3MX9A 2A6TA 2V79A 4A12A 2EFNA 2Q2EA 5F1JA 2FK3A 4ZI7F 3V7SA 1SAXA 4DV3H 5LRSA 2W7PA 4XYMB 3S2HJ 3ZMDA 4LFBH 3Q9SA 3FK7A 2PMHA 3TEDA 4IXAA 5CAEB 4IJAA 3GVAA 1XB4A 2W25A 5L3DA 3H5NA 2EH3A 4AADA 4JV1A 5LGNA 2G0EA 2HI3A 5L3GA 3MD2A 1U0JA 3P9KA 3W2VA 4CCKA 5C44G 3S1RJ 2YU9A 4R79A 2E2IA 3DCFA 2K86A 4I02A 3BT9A 2R85A 2RGVA 3S3MA 1UB9A 5FFXA 2X0SA 4LMYA 2F5DA 4ZOLF 5C1PA 2K85A 4RUCA 5EDWA 1O57A 3G4SI 4O3SA 2WADA 3S2DJ 5IY5H 2W70A 1IZ1A 2L2OA 4B3AA 2V1DA 5FJ8G 2O03A 1XCVA 3KP4A 5LL6b 5DD8A 1WKMA 1YS6A 4HPQA 2W8LA 3WE3A 2AGPA 1J09A 1DIKA 1ZRFA 1RJPA 4ZYEA 3REOA 3DF7A 2ZXHA 2R7SA 2VC1A 2HR3A 1LVKA 3PSFA 2ELKA 1OCRH 2VT3A 1IRGA 1HW5A 2IS1A 3TW6A 3HDDA 3SQNA 3GTKA 5TJJA 2EV0A 2H1KA 3ERED 1Y39A 3IH2A 4ED1A 3PO2J 1I3AA 1AF5A 1T6SA 2FK1A 4YP3A 5EG0B 5DGBA 1ZG1A 2NU9B 5CPRB 2JMZA 2K3PA 1OMIA 2YZMA 1PUEE 2R93G 2DMNA 2V4QA 4Q4ZF 3HSFA 2EIJH 1E2XA 2FU4A 4HSRA 4XOPA 1K4SA 2DI3A 1RUOA 2ME0A 3GTPA 4AIJA 1T56A 4FS1A 1Z0XA 3R4KA 2F4OB 1U6GA 5ICEA 2EFPA 3H36A 3OYIA 4IKFA 1KU2A 2YUSA 2CSOA 3GFJA 4E70A 1VQNI 4UN7G 1MMAA 5KFOA 3Q2OA 3WTTC 2OJED 4DV5H 2FBKA 3OS1A 1V5GA 3OV8A 1TNSA 4WX9A 1K83A 1NK3P 2R8IA 4BYYA 4R7RA 1VI0A 3CJRB 4L5EA 4LD5A 3PO3J 4DW6A 2C2RA 1HF0A 1CQTA 2W9CB 3DKWA 2EQRA 4QPOA 5FGMA 5J8CA 2PVPA 4G6DA 3A2KA 3RZOJ 1X3ZB 3PO2G 2ZJ2A 2KIQA 2O7MA 2DFIA 4QW9A 1B04A 1J2XA 2YX4A 1UNNC 1SD4A 3L4KA 1N33H 3TDUC 4IHXA 1R1VA 5F08A 3T5JA 2M3AA 5IP6A 4AIDA 4A6EA 3UVFA 3PNYA 1EYZA 2Y9ZA 1V4YA 1GT0C 2ECBA 3I71A 1T39A 3G6EI 3LMMA 3NQOA 5KAIC 3CUQA 1H9TA 2M7AA 1ZQ7A 4B47A 2PMZA 5ILVA 4XLHA 5E63A 4XLEA 2Q1ZB 2MFZA 3HC7A 5GADJ 1TWGJ 3MFIA 5K5QA 2HOAA 3DBHB 3MWMA 4MFDA 4N4OB 1T95A 3FD2A 1GO3E 1X19A 3BROA 5F0CA 4MV8A 5DEQA 5KFQA 5DTDA 2FMLA 5DS9A 1ETQA 4HBLA 5C4JJ 1TTYA 1GXQA 2ADUA 1USSA 2WY8Q 3K6GA 4FE7A 4UUVA 2GXBA 1LEBA 2VQEH 2K7LA 4IR1A 3AAFA 4RGXA 5HBRB 3T8RA 1MOWA 1PX2A 3V8LA 3BC8A 3IWZA 3FXUA 3GLXA 4X65H 2W24A 1IXSB 2EX5A 2GLTA 5KG5A 1F1ZA 3DEUA 2HDCA 3ASNH 3I4MJ 2WAQA 1U9OA 2E35A 4D7NA 1V51A 4J9PA 3RF2A 5KFLA 3Q5FA 4MA5A 4V2FA 5ICGA 3DTIA 1RIOH 5C8YF 4OAZA 3TQTA 2P0AA 3NWSA 1YTYA 2LD5A 2EILH 2L4AA 2I8CA 3CCYA 1K78A 3MR6A 3LMLA 2W4SA 4GRIA 1ULZA 4ED6A 5KFZA 2E5NA 2LNBA 5IPAA 4CCJA 1SFXA 1OWTA 4RUAA 1H9GA 1TWAA 1RJQA 4ITVA 2QSGX 1DGRM 4TV8F 4BUPA 5ILSA 2YZNA 2DDBA 2DCEA 1QGPA 3NWTA 4PSWA 3CLOA 4XSXF 2OLSA 2VONA 1ZN2A 4UN9G 4KUMA 3RKYA 3K5HA 4M72A 3AG3H 1MMDA 1LE8B 3K3VA 5HS7A 5K7HA 4JOMA 5A77A 1YG2A 2IRFG 2PLYA 3KHLA 3ZMTA 2R7XA 1MBFA 1X3UA 1P4WA 2Q0OA 4MV4A 4I50F 2C28A 4DR7H 1BNCA 3PNVA 4F52A 5C3EG 3ZXSA 5KFBA 1OCPA 4EJTA 1S6LA 2VQGA 4YR2A 4TQRA 3JAMK 2KEQA 4X1EA 4D0PA 2KKOA 3HG9A 3RCOA 2CUZA 3MZHA 4CYCA 1QA6A 1GPPA 2KMUA 3D5LA 2M5WA 4Z1ZA 1HQCA 1XDNA 1AN7A 1GXPA 1FJGH 2JA5G 2RDJA 3PIPF 1JDBB 1HNZH 4ECSA 3J80Z 4DYRA 2H09A 3FXOA 5C1OA 2HFHA 3VFZA 1HNWH 3WO1A 4GC6A 2NU7B 3OYLA 4OMZA 3TGNA 1Y8RB 2A6EF 5LHGA 3P9IA 4HA8A 3F8MA 3FBNB 1UAAA 3RTRA 1Z3XA 2JA8G 4RU9A 2V9VA 4ED7A 4QIWN 4EATA 2TRTA 1JJ6C 1YJWI 2CG4A 2KLOA 2DLLA 2ZMEB 1DQ3A 3HB9A 2H27A 4C2UA 2DODA 4O4LF 3DKYA 4BDZA 2MC4A 1I7LA 3J80W 4W1UA 4LX3A 1KZHA 5C4XJ 4F4YA 3HOXJ 2BBYA 1FTTA 1MSEC 2FSWA 5J47A 3S93A 2CGPA 2QENA 3DPUA 2DTZA 2LWYA 1T33A 1VQOI 1WPKA 4H0EA 3W6VA 2NVQJ 3F8CA 4C3IJ 1VQLI 5KG4A 5LP6F 2EINH 1W7PD 4BBSJ 4EQQA 1XN7A 2DPIA 4F4ZA 2ATLA 4HZFA 1UMQA 2O8XA 4FE4A 1JUPA 4P1WA 2XKOA 2BVLA 3EPZA 2VI6A 4LK1F 3J7ZI 5D1PA 5KFJA 1TLHB 1BR1A 4ZC3A 3FKIJ 1A0IA 4DQ2A 1B72B 1BC7C 1RC9A 3ABTA 2HTJA 1G9ZA 4AYBE 1MH4A 2OV7A 3FKJA 2CJJA 4LF6H 4M3GA 2VL8A 3K1PA 1WH5A 4UCUA 3GUDA 4ECWA 3JRGA 3E1SA 1U0CA 5CVVA 1FSEA 2ZDHA 2Q8KA 2QKMB 3ORQA 3ETJA 4GYIA 1LWSA 1V4RA 2P8TA 3TO7A 5ERIA 3S2WA 4JV0A 1MH3A 2ESHA 1SVOA 4U7CA 5JVDF 5C4XG 3I53A 3BWGA 4BEHB 1ZK8A 3HOXG 5HLTA 4E2UA 4ZYAA 1YX5A 3CTAA 1WJCA 1RPWA 1U5TA 2LG4A 5GAHJ 1JE8A 1Q1HA 1EUDB 4DR5H 2KDZA 1P7IA 1PUFA 1K1SA 3Q3SA 2A68F 3K4LA 1O7LA 5DUIA 3DPTA 5FROA 4J0MA 2LVSA 4BBSG 2X48A 5BNGA 4UB6C 2X6WA 4KHPH 2SCUB 2UVRA 4IF4A 2QQ9A 2DO7A 4YIIA 1G2HA 2JRTA 3V42A 2W6MA 3N40P 5IYDG 2MC3A 2BEOA 3L2PA 5IYCG 3J7AK 2UXDH 2R5YA 4RZRA 3H0DA 2VUGA 3FKIG 5A2QW 2OTLI 2OQGA 1J75A 1XDSA 4EBCA 3OWTA 3RB4A 1P2FA 3LSIA 4A93J 2EFWA 3OOLA 1EKEA 1W5TA 2CQ7A 2DMUA 3PQJA 3WTYC 1TA8A 3MWDA 2IN8A 5LBQA 2PBIA 3LL7A 1R49A 4GKKH 1Z6RA 2IGOA 5LGUA 2VQLA 4YIFA 3K70D 4KL5A 4NB5A 3TOBA 3E3VA 3JREA 5E8GA 1K4TA 3OYGA 2KP6A 4PFOA 5EWGA 2VA3A 1HR0H 5CA0F 1J7KA 3H9GA 4XX0B 2HQAA 3GZ6A 2R93A 3I54A 4EEQA 5F04A 2D1VA 5L9XA 4CA0A 1R00A 4E4HA 3GMEA 4WF2A 3KXYT 3HGGA 1J59A 3CJQB 4HNTA 1IW7F 2HYFA 1WCMJ 1V5FA 2LTPA 4Y52J 1SD5A 2H94A 4G8XA 3ZGKA 2F4MB 2F4LA 3C0FB 5H6RA 4QWAA 5KFVA 1R36A 3PR5B 4M71A 3EH8A 3FHNA 2W00A 4ON0A 1V9PA 2R7MA 5KFEA 1RK6A 2DBBA 4UN7A 4U0VA 1QVUA 1FYMA 2AB5A 2JEGA 5T14A 4A93G 4II2A 4EGQA 2DA1A 2WC2A 3ROUA 5AKFA 2VBJB 1KJQA 3FF5A 3KAKA 1ACIA 3BP8A 1GVDA 3CP2A 1WJFA 2K4JA 4A3MG 4YJ2F 3WTUC 4RAFA 1SEUA 4A3LG 2V7FA 2YZGA 3V6JA 2HQRA 5D8KB 5DQHA 3FWEA 2V1UA 1WJEA 5KFFA 1R23A 5K1YA 1P8LA 2W9BB 4R8HA 2E2IJ 4A3FJ 1GLVA 2PMZN 4N0BA 4XR6A 5DGAA 3DF8A 1Y1WG 4JX4A 2O7OA 1VQ5I 3S17J 3X2QH 4Q43A 2V9WA 4MV6A 2XE0B 4DYQA 4LG0A 1S8NA 1JVAA 2ASDA 2UZKA 2UUCH 1Q1VA 2ZO4A 3L4JA 2M30A 1GLNA 3B6AA 1T8IA 1YLFA 1YJNI 1BJZA 3HGYA 4D5CA 2G7HA 2CQQA 1TWHA 4OU0A 1SVMA 3IGDA 2P0WA 4X6AJ 4O3NA 3HSRA 5F0FA 1WJ5A 4QIWE 5A0WA 1JTXA 1WWXA 3DXJF 3ZCOA 2KIFA 4G6QA 1R22A 2XGEA 3G6YA 1QHGA 2I10A 2HS5A 3EQLF 2MD0A 2WAQN 1I5ZA 4UUSA 1ETXA 3U9SA 2LMDA 3IN5A 2E1MB 1Y56A 1IDYA 2KSWA 1ZKGA 2JRMA 1HLVA 4YBZB 5IOZA 5DCMB 1MJAA 5KHDA 3OY9A 4V19K 1GHCA 4F4WA 4UT0A 4YR3A 3ZQLA 1SVLA 2M2EA 2RVCA 3N42B 5HNFA 2FBHA 3CUQC 3E0JB 4XKCA 3JR9A 4A3FG 1ZDEA 2QEXI 3TO6A 3GTPJ 4ZQIA 4JI4H 4OMYA 1JT6A 2Y69H 3LA3A 3TP3A 5E3NA 5LGTA 1Z7LA 1ZR4A 1OYWA 1JKPC 2XPWA 1RR8C 2DK5A 5F1RA 3JRAA 1M5XA 1DPUA 3OR2C 2FX0A 4ZHQF 5CA1F 3GTMA 1S3JA 2OH2A 1K83J 1BIBA 2X1CA 4BQQA 5HDNA 3N44B 1YW7A 2NUAB 3OIPA 2DCHX 2HXIA 4JUZA 1G3SA 1TWGA 1E4GT 1WJDA 1FTZA 3GTGJ 2CUJA 3PVXA 1MKMA 1TQIA 1OISA 1Z7UA 3J81Z 2FXAA 2VA2A 3LA7A 4IHJF 3FDSA 3QPTA 5F64A 2JT1A 4RMNA 4XN0A 1X58A 2YSRA 5J40A 5A0MB 3N05A 3OOUA 4UN9A 4AAFA 3QPSA 2ASJA 1UFMA 2VC0A 1B9NA 4CCLA 4UN8G 3LFKA 2WYOA 2YR2A 2F4IA 2WB1A 2VBNA 4Q48A 4BE0A 2W6PA 1Z91A 1VS0A 3ZMSA 1Y14B 3HHHA 4KMUX 1E4FT 4A3JG 4BXXJ 4ECTA 4C9YA 5HLHA 4O4HF 4UCSA 4DZJA 5HDGA 1QNTA 1LFPA 3D0SA 3IFJA 2ECCA 3C2BA 4II3A 2HGSA 2VBXA 1FBUA 2VE8A 3LWFA 2Z5UA 4RA2A 3T1YH 1JI8A 3J81W 4BNCA 3R6SA 1WZ2A 9ANTA 1M7JA 3KEQA 4B48A 4L9NA 5KG0A 3BR5A 2Q2EB 4EVIA 1FC3A 3KZIC 3S15J 2JA5A 4EJOA 5DYMA 3RAXA 3OHBA 3SI8A 3MKZA 2YW2A 4A5NA 1X1AA 1SMTA 3BPVA 2Y75A 1BR2A 2FRHA 2JMWA 2NS0A 1BN5A 1WGXA 4RBOA 5D1OA 3ZR8X 3R5XA 1I50A 2JVGA 4S0HB 3A0BC 1Y0UA 3KZZA 1MBKA 2ZXIA 3L9FA 1TBXA 2M4KA 4WBNF 2R7NA 4YJ3F 4GGGA 4NNJA 4CC6A 1MDMA 3ZQGA 1T9JA 3J81K 2LKPA 4Q8FA 2RKHA 4WXCA 2PN1A 4JK1X 4AYBA 2O9LA 4DL3A 4BQOA 3TW7A 4N9HA 4ETSA 2QM3A 1NG7A 4E7JA 2VBLB 3E6BA 4JI2H 1I7NA 3PR4A 1SFUA 2YRXA 3O2PE 2KISA 4IOCF 4XICA 1S9HA 1B8IA 3GV5B 2CZGA 2V6CA 1NHAA 2CRGA 3RIRA 4E7ZA 4IZZA 5IWAH 2CWEA 4K2EA 1M6VA 3RB3A 3JRBA 3QZ8A 4GCVA 5LYJF 3N97A 4BJTA 4F7ZA 4PJNA 3IRRA 4RAZA 4IVNA 2FJ1A 4I76A 2V58A 2XUBA 1TT0A 1R5GA 4XKWA 3C0WA 2BXZA 3SYTA 1R6RA 5LHIA 3ELKA 1DUXC 5FLMJ 2M05A 5DM7F 2R7QA 1DGWY 4DOZA 1IBMH 1U3EM 5FKKA 3UNGC 1ON1A 4Y8VB 4DYCA 4OIOF 4AWXB 5LMNH 1XD7A 4BXUA 3GW2A 3HOZJ 1XNQH 4CXFA 2PMZE 2DJIA 2M34A 2GLOA 1HOMA 2RV8A 3T8TA 2ISYA 4L9TA 1VDEA 3VPRA 2DOEA 1DU6A 5JVGF 1FPQA 4B3TH 1W5SA 4ASNA 1NH3A 2GA1A 1GVJA 4RNOA 2HOEA 5L3FA 3FXRA 4YHHH 4ENMA 5KT4A 4KISA 1I3QA 1TW3A 1BR4A 3GV7B 1G9YA 1B6SA 5M5YJ 2FP4B 3HYIA 5BMZA 3ECHA 5JH7F 4DV6H 3RPUD 1ZHSA 3GIDA 4DUYH 1BI3A 2WAQE 4Q45A 1FBSA 4N4NB 1J5EH 3WG9A 3JRIA 2XASA 5KFRA 2R7LA 2MGQA 3FKIA 2XSJC 2GXGA 4XRFA 4PSXA 1JUMA 4RM3A 1PK8A 3QOPA 3ESWB 1AHDP 5LXTF 4BGDA 2AGOA 5DG9A 3HOTA 3HOZG 4XRMA 4F55A 3GLKA 3QPLA 2A07F 4XYLB 3K4NA 3I0TA 3P7NA 1ZARA 4DIQA 1CF7A 3CUQB 5M3MJ 5EJCA 3ABMH 2AQEA 2BY0A 2ZJTA 3OHAA 3MZ8A 4HLYA 2JEIA 2QGUA 3DEWA 3O8HA 4JI8H 3H5AA 2WV1A 1O3RA 1DPRA 1WI9A 2RQPA 4HAMA 5CLSA 3S3OA 2GWRA 4J9SA 4DUZH 2DK8A 3DP7A 5AKNA 1YYVA 2HQ5A 2IT0A 5EZHA 4KFCA 2H8WA 2HXOA 4CHUA 2DW4A 2WY7Q 3GIKA 5GAGJ 4ZDPA 2PMUA 5E8IA 3SXYA 3BDDA 1I1GA 1AKHA 1GV2A 2HEOA 1OQYA 3GIPA 2GM4A 3RV3A 1RYSA 1JXLA 4G9YA 4I0AA 3PSIA 2YPRA 1JGSA 1KONA 2LY1A 2MYSA 4IAJA 3KE2A 1FY7A 2ZKZA 3MVPA 1TW2A 2LYCA 4XLNF 1BI0A 1BM9A 3A01A 3RPQA 1RKTA 5EWEA 2DPJA 1TAEA 2DU9A 4RS8A 4Z2YA 3VSKA 1K78B 4J9NA 2L7MP 1FX7A 2KIMA 1HBXG 1PDNC 4YISA 2VPQA 2X1DA 4QWBA 4HLXA 2OZ6A 2AS5F 4MTDA 1D8JA 2UXNA 4MO7A 1L3LA 4HRIA 4AAEA 3SDBA 5C44J 3WODF 1JT0A 2HJWA 2XRNA 3F3XA 4UV8A 5B5EC 2NVUB 5LRRA 3PJRA 1FZPB 1Y1WA 1TWCJ 2LDUA 1UJ8A 4I09A 2OUMA 4J9RA 4LJZF 1ETWA 4X64H 3IV5A 4L5JA 3WTVC 5L1JA 2BV6A 2E2JJ 2L9VA 2OBPA 4DJAA 1R1UA 1WR2A 4BWSC 2YX7A 1W5CC 3HRSA 4C2MJ 4X66H 4JV5H 2LF8A 5M3FJ 4UCTA 1XMAA 2Z99A 4A69C 3H3ZA 1ZGWA 4FHTA 1ORKA 1N32H 2GBYA 1DV2A 1DV1A 3QYEA 5CKTA 4GC7A 1K6YA 2XCLA 3S16J 1C3OA 2EPFA 3U2RA 3OYCA 4IRGA 4RGUA 4KIGA 4CYCB 1IN4A 1IF1A 4BKXA 4DL7A 2I5UA 1P92A 2QSFX 1T36A 2OZUA 1OJLA 2R7TA 4YY3H 2BQRA 4XZ3B 3GX4X 1OPCA 2HKOA 2R93J 1WJAA 1ETYA 4G12A 5E1XA 4BJ6C 5F0HA 3UQ8A 4MQVA 4HQ6A 1BJTA 1JHHA 1MGTA 3BTCA 1SMYF 4OIPF 4YFKF 1T94A 3Q0WA 2F6CA 2VBOA 2YS9A 1IN5A 1Y6IA 4BACA 2CV1A 2JWTA 2ZCWA 3TO9A 1KU3A 2ZXJA 2IP4A 4QW8A 3V6KA 1VQKI 3KYLA 4IHWA 2BY2A 5DM6F 4A3IJ 4JI5H 2XV4S 1Z3YA 1B33N 2F48A 2IJLA 2R8JA 4U88A 2WB1N 3MJFA 2QWWA 2VQFH 2WBMA 3E54A 4IX7A 4EBEA 4BH9A 4EEYA 4YAKB 1ZETA 1FIPA 2Z1DA 4AVZA 3S1MJ 5M5WJ 3W3CA 3L2QA 3TIIA 2ZMEC 3M9AA 3L2RA 1FOWA 2MH2A 3C7JA 2CV2A 1S03G 3W6KB 1JGGA 3DV8A 2MA3A 4WK8F 3DBLB 4UN8A 1OR7A 4KT6A 1X4OA 3DWLE 5L3CA 2LF7A 3OSFA 1BGWA 2UXBH 1YRNA 1MMNA 1USTA 2Y2ZA 1N75A 4PZJA 3LSKA 4E7LA 5JI6A 1FEXA 4FBTA 2M0MA 4HF0A 4A2UA 4IQJA 2C35B 2M45A 3BABA 1TWHJ 2VR1A 3BLYA 4D6OA 1T0FA 1XMXA 5KG6A 1LVAA 3H5RA 4DR3H 1MJBA 3RGXA 1W0TA 3VPCA 4A3IG 3F6OA 3GYHX 3E6CC 1M0TA 1HW1A 2K3FA 2JJ7A 2M87A 4B3XA 3CMEI 2F5FA 3U9GA 3M9MB 5FLVA 2FD5A 2C2DA 2IVMA 4ESFA 1TQPA 3GTGA 5F6FA 4AYBN 1MMSA 1LDJA 2YS7A 5D5UB 1IJWC 1N78A 4IRCA 3A1YA 1U5TB 3JRWA 1Z6TA 1XPXA 3MQ0A 2KRHA 4DGWB 3G1MA 2R7VA 4LSXA 1LEAA 1J0RA 5J1YA 5KKNB 2IGMA 1PUFB 5FPRA 2W84A 3DU6A 1CQIB 1LWTA 3D5RC 1AUVA 1V55H 3BR1A 1YIOA 1ZHQA 4QWEA 4R8UA 3J7AO 5CVIA 3QOEA 1KBLA 1M1EB 4OX9H 1KQ9A 2FJZA 1VAJA 3R5FA 2EK5A 1OKRA 1UHMA 2X1EA 2R5YB 3GTMJ 2DOAA 4KICA 2V26A 5CVRA 3WE2A 2VUMJ 1WI3A 3R23A 2B63J 2HZTA 2Y0SA 3HUGA 5A74A 2CU7A 3QFFA 4WD3A 1JIHA 5KG2A 3H3VH 2AQFA 1LPQA 1JTYA 1P6RA 4AM3A 2K4BA 2UVUA 1Z67A 3EUAA 1K79A 4EFEA 4RM2A 2Z2SB 1DFAA 2BQUA 4DR6H 1HDDC 3F72A 4U0YA 3CP8A 4HEA2 5H20A 4DR4H 3BQYA 1ZGAA 1RZ4A 3JAMZ 3H92A 4O3MA 4UCOA 1VQ4I 2P4WA 4MA0A 2IS6A 4LFCH 4J9QA 1KQ0A 1A04A 3HRMA 1CGPA 4YAJB 2FEZA 3HYJA 1AUXA 4ME6A 1W7PA 2K9LA 3LP8A 1KQ8A 5C3EJ 2KT0A 2L02A 3ERMA 3FMSA 4KIBA 3M7GA 1F43A 2V1NA 1ETVA 4FISA 5EZGA 1S0NA 4S04A 1IC8A 2STWA 1ETKA 3S14J 5BPDA 4MFEA 3GTLJ 2DQLA 5D6FA 2C6YA 2VUMG 1VQPI 4E7SA 2LKXA 2JA5J 1ZLJA 3H35A 2B63G 3WHBA 2NU6B 5JHUA 5E3OA 3MXAA 2QQAA 3GCMA 3JAMW 3KLOA 4UXNA 4XRSG 2CKZB 4DL2A 3KFWX 1YHQI 5H80A 2HDDA 2V4RA 1JHFA 3L7WA 3RQ4A 4BU2A 4ECQA 3ZMUA 4O1SA 3EUHA 4AAGA 1I50J 2P5LC 2PJRA 1BL0A 1FSHA 3GTJJ 5KFPA 3PFIA 3EPGA 1DQUA 2JA8J 5GPAA 4M3DA 5CQGA 4CSWA 2JZYA 5DD4A 2RDPA 2XPVA 1XCBA 2FF4A 1G8XA 1QBJA 2OWOA 1IRXA 4LGWA 4QSHA 3OYFA 4I55F 3EUKL 5DV5A 2VQDA 4U6PA 3IHUA 3CZ6A 4MEYF 4LG0B 3J7AY 2QLZA 3K2ZA 3VPDA 4ZYGA 3Q8PB 3HOWG 5HS9A 3AYHB 3QYFA 2VJ4A 3I3LA 3BJ6A 3Q8SB 2X0LA 2HYGD 1U8RA 3FISA 1BW6A 4M3BA 5J3LA 3E5NA 3KZYA 1S29A 3ISPA 2HOSA 4DL6A 1MBJA 2W8KA 4YB8B 3PIOF 4LF4H 5E20A 2PQ8A 3LAPA 2IS4A 2QYZA 4UUSB 3E6DA 2XGXA 3BTIA 3AFHA 5D5WB 1RUNA 2HPIA 4BQNA 1P4XA 3KP3A 1BOAA 2WB1E 3V8JA 1GSOA 1SD7A 5BOXA 1S0MA 3RKXA 1HXDA 3CDLA 3HEFA 4AQYH 2FA5A 3ZRGA 2D2WA 2K9QA 2LK2A 3L09A 1W36D 1FYKA 5A72A 1O3TA 1VBHA 2OTJI 1MNDA 3K0LA 4CGZA 2E1MC 5HLGA 1HSJA 1QO0D 2ZXWH 1H89C 4M3EA 4I7HA 2Z16A 1L0OC 2DA2A 4EM0B 2VQCA 2E7XA 3QP5A 3M3YJ 3T5XA 3LSPA 5LEKA 4AIHA 4L1KA 2CUEA 3MR5A 3CCMI 1I3QJ 3QP6A 3SHFA 2A05A 4IZOA 2ID6A 2L5QA 1QZEA 3TP0A 3K9TA 2R5ZA 2DQRA 2DTRA 2QVOA 1FMVA 1SEIA 2IA2A 1W4MA 1XSVA 2L9RA 3MCZA 4FX0A 3WGIA 1D5VA 4NC8A 4DL5A 5F27A 3JSOA 2DA7A 4O6JA 1P7JA 2Y31A 2IXSA 5IYDJ 4RB3C 3PW7A 2PX9A 2DJNA 5IYCJ 3K1NA 1RJRA 4YQWA 3AG4H 4R1HA 1RRJA 1D1CA 1E3HA 2DFFA 2VBNB 2QCOA 3AL0B 3IG0A 3RTXA 5KT7A 2XF6A
chains in the Genus database with same CATH topology
4BDYA 1VZ0A 2L8LA 2CS3A 2X1CA 4BQQA 3N44B 4FASD 4JI7H 5FD5A 3OIPA 2IN9A 2DCHX 5HNHA 3IAM2 4F93B 1HA8A 1E4GT 4XKBA 1WJDA 2CUJA 2K9MA 2WAFA 4XN3A 5AKMA 2X6XA 1PYVA 1X1CA 2XF5A 4LF7H 4RMNA 4NQWB 4XN0A 4CCNA 5A0MB 4UN9A 3N05A 3OOUA 4AAFA 4XMYA 2JSPA 1P9QC 2ELJA 3UR3C 3C2HA 4CCMA 4CCLA 4UN8G 2WYOA 4UNCA 4YELA 2F4IA 5D1OB 2WB1A 2VBNA 1XNRH 4BE0A 1VS0A 4PUSA 3SEZA 3OYAA 1SAUA 2VKHA 1E4FT 3DLAA 5AK9A 2VIXA 4C9YA 1WH2A 3PUBA 1X9NA 2CV0A 4UCSA 3IFJA 4EFJA 1LFPA 2BOLA 4CZCA 3C0XA 3M1CA 4II3A 2HGSA 4RZQA 1BOBA 4LF8H 4DV7H 3T1YH 1JI8A 3S3NA 3J81W 2A5WA 4B3SH 3MIPA 2E60A 4B48A 4OZ6A 2R7RA 1AA7A 1FKAH 1Z2OX 2Q2EB 2W1OA 3MXBB 5A0MA 2F4VH 4XQFA 3MKZA 3FBIB 1X1AA 3LSMA 4Y3OA 4DV4H 5I0AA 1X4PA 4E2TA 1BR2A 3SEQA 5D1OA 1TZLA 3ZR8X 4RB1A 2IN0A 2JVGA 1D1AA 1G59A 5LD2C 3OMYA 4B43A 3OTOH 1IBLH 2ZXIA 3VDXA 1UM2A 4YITA 2M4KA 5BR8H 4XOTA 1O75A 3H9QA 3L2UA 1LDKB 1B24A 4JI0H 2VJ5A 4NNJA 4CC6A 1T9JA 4RLQA 4U87A 4J00A 4RLFA 2HZDA 3MX9A 4AYBA 3EYYA 2A6TA 3OYBA 4BQOA 3PL8A 4ETSA 4YEJA 3MXBA 4DV3H 1NG7A 2R4GA 4E7JA 2X51A 4YHXA 2VBLB 4JI2H 4LFBH 2HVSA 1S9HA 4C30A 2O5RA 1N3EA 4IZZA 4E7ZA 5IWAH 4C2TA 2DT7B 3H5NA 4BJTA 4PJNA 4AADA 2KHMA 4RAZA 3PN1A 2LCJA 3MD2A 1U0JA 3W2VA 1TT0A 4FETA 4CCKA 3BAAA 4XKWA 3C0WA 2DT6A 4R79A 3K4MA 2HU9A 3SYTA 1R6RA 3D5SC 4HNUA 3S3MA 2RGVA 4LMYA 3BCAA 2WADA 1DGWY 2R7QA 4DOZA 1IBMH 2L2OA 3PNTA 3G2BA 1N36H 2IGNA 3UNGC 2O03A 4UNAA 5LL6b 2ZFUA 4HPQA 4O1RA 4DBRA 5LMNH 1J09A 1X1BA 1M0WA 2UUBH 3KALA 1XNQH 2DJIA 4PJMA 4LIVA 1EF0A 5E67A 5KCMA 3DF7A 2ZXHA 3K4JA 2R7SA 1VDEA 4XONA 3MISA 3FMAA 4DR1H 1LVKA 2VASA 4B3TH 3PSFA 2W57A 1I6UA 2IS1A 3DQVC 2ZM6H 3KAJA 4YHHH 2WE6A 4KISA 4XL9A 1BR4A 4LF5H 3OYKA 4P5OA 1G9YA 1AF5A 3DU5A 2HVQA 3HYIA 4DV6H 5CPRB 2JMZA 2K3PA 2RGRA 2W7NA 3RPUD 2F5VA 1R7MA 1ZHSA 4B3MH 2LC2A 2LBFB 4E6KG 4DUYH 1X1DA 2VJJA 4HSRA 4N4NB 4XOPA 3VYTB 2R7UA 3RIZA 1J5EH 3AKZA 1BP7A 3OYEA 2CW7A 3H9JA 4LOXA 2CMPA 3OYIA 4IKFA 2XSJC 4XM3A 4PSXA 1PJRA 4RM3A 2V6EA 5A78A 3MMYB 4BGDA 3HOTA 4UN7G 2XIGA 3BA8A 4DBQA 1MMAA 4DV5H 3OS1A 4F55A 3K4BA 3OORA 1T9IA 1V5GA 2L7KA 2X6YA 4PDBA 3K4NA 4JI6H 4DIQA 4GIGA 4R7RA 2UUAH 4NUBA 3CJRB 4UCRA 1DP3A 2ZJTA 2AQEA 2LH9A 4E7KA 2IS2A 1P8KZ 3HXLA 4E7HA 3IP4B 2LBFA 4QPOA 4JI8H 3H5AA 3VWBA 2UWMA 4XORA 3A2KA 4BJ5C 3S3OA 4DUZH 2O7MA 4HG2A 1MI8A 1V5EA 1B04A 4PFPA 5TGTA 2JVHA 5AKNA 3L4KA 1N33H 1DGSA 2M3AA 5HOOA 4LITA 3K10A 4RB2C 2WY7Q 4G6TB 3UVFA 5LMUH 3PNYA 4ZDPA 3L2WA 4CUGA 2L9NA 4ANJA 4IQ4A 3OYMA 3DTKA 3LMMA 3OL3A 4B3RH 4Z20A 4F3QA 2ZSHB 3PSIA 2M7AA 4B47A 1KONA 2LY1A 2PMZA 4XLHA 4XLEA 2Q1ZB 2MFZA 2MYSA 3HC7A 5E63A 1Z2PX 4IAJA 3MWMA 3FD2A 2LYCA 4N4OB 1T95A 1X19A 2VLAA 1TAEA 3VSKA 2IMZA 4PK4A 2RNGA 2WY8Q 1YX3A 3K6GA 3S32A 2X1DA 3TL4X 2DXIA 4KL6A 4YISA 2VQEH 4GKJH 4MTDA 4KJZA 4HRIA 3RSNA 3SDBA 4UNBA 4AAEA 1MOWA 4RAYA 2LY2A 3M4IA 3BC8A 2UU9H 4X65H 3PJRA 1D0XA 3TMOA 2EX5A 3JSLA 2OUMA 2WAQA 5E5SA 4X64H 4LFAH 2YCHA 3RF2A 3ONQA 4LG3A 4DJAA 3NZMA 3DTIA 4BWSC 5CQEA 3LSGA 4OAZA 4JI1H 4JV5H 3NWSA 4X66H 3N41B 5K08A 4F91B 4UCTA 4XLAA 3LMLA 2W4SA 4GRIA 2VBOB 5FD6A 4DR5H 1OLTA 2CW8A 2E5NA 5KNLA 5FLXW 3VYSB 2VPLA 4CCJA 2VPSA 3RJ0A 1N32H 3QYEA 5CKTA 1K6YA 4ITVA 1DGRM 1EA3A 4BUPA 2DCEA 3OYCA 3K70C 1ERDA 2CFOA 3NWTA 2WDTA 3W2AA 3CF2A 4PSWA 4HSTA 4UN9G 1OR7C 4DR2H 4LIUA 1D0ZA 1MMDA 2R7TA 4YY3H 3K3VA 4A2BA 1FVIA 3VYRB 2KPMA 4JOMA 1WJAA 5A77A 4BJ6C 2R7XA 3JSNA 3UQ8A 2HNHA 2UV1A 1BJTA 4MV7A 3PFYA 4DR7H 1T0FC 3HPHA 4BXFA 3I9V2 3PNVA 2F6CA 4F52A 3ZXSA 2R7WA 2VBOA 4GLXA 3S8PA 1I94H 1Y6IA 4BACA 3OIQA 2CV1A 2WAEA 2VQGA 2KRCA 3OR1C 2KEQA 3OYDA 3KYLA 3HG9A 2GOXB 3RCOA 4JI5H 2CUZA 1Z3YA 1GPPA 3K4KA 1XDNA 2KMUA 3D5LA 2VJIA 4Z1ZA 3CESA 1AN7A 2VOBA 1FJGH 2XF7A 1HNZH 2VQFH 2WBMA 5FRMA 4IX7A 2R7OA 2JNQA 3E54A 2I3QA 2Z1DA 4AVZA 2FLDA 2RQQA 3W3CA 3L2QA 3R7PA 4LH6A 4ZTFA 1HNWH 3DPLC 2HPMA 3L2RA 1UELB 3K4CA 3OYLA 4DV1H 3HPGA 4D1QA 2CV2A 4ZDOA 2HHHH 1S03G 1XMOH 3LSHA 3QQYA 1UAAA 3FBNB 3RTRA 1YE9A 1Z3XA 4UN8A 4KT6A 1X4OA 3DWLE 3A4CA 4EATA 1BGWA 2UXBH 3DKXA 1MMNA 1N75A 4X0GA 3LSKA 4E7LA 4MTEA 5FRNA 2KLOA 2M0MA 2LOOA 2ZSIB 1W36C 4IQJA 4C2UA 1DQ3A 2NOJB 1U0DA 3BABA 4LSAA 3DKYA 3BLYA 4CCOA 4BDZA 1MZBA 2QKLB 3TBIA 2MC4A 4JQFA 4D6OA 4XLCA 4H4KC 3U21A 3J80W 3H5RA 4OAYA 4DR3H 3BG7A 3RGXA 5LFAA 3MKYB 1M0TA 2M7BA 4OWRB 3OS0A 4B3XA 2I3PA 3S93A 3IUOA 3DPUA 4AABA 2LWYA 4DV2H 4D6NA 4BE1A 3ZQQA 4CH7A 3HUGB 2E5ZA 4Z1XA 4XNFA 4PJLA 2MABA 1N78A 4JI3H 3A1YA 4P1WA 4Y33A 3EPZA 2BVLA 2KRHA 4DGWB 2R7VA 5D1PA 4LSXA 1BR1A 1Z21A 2IGMA 4ZC3A 4E7IA 1AM2A 4MLOA 5FPRA 3DU6A 1A0IA 4K0KH 2GOMA 1LWTA 3D5RC 1G9ZA 2OV7A 3DEEA 3FKJA 4LF6H 4ZDLA 2HDWA 1ZHQA 2VL8A 2L9SA 3QOEA 4OX9H 4UCUA 3E1SA 1U0CA 1E0EA 2QKMB 1N34H 2X1EA 1LWSA 2XAUA 2DOAA 4NXMH 1MMGA 2V26A 4BE2A 4Q0YA 2Y0SA 3OS2A 4ZTJA 5A74A 1XMQH 1UG0A 2AQFA 4BEHB 3EUHC 5HLTA 4U7BA 4E2UA 4ZYAA 1QU3A 1YX5A 3EUAA 1WJCA 4EFEA 2LG4A 2Z2SB 3BCBA 4RM2A 1DFAA 4DR6H 2HVRA 3CP8A 1MNEA 3F9KA 1IBKH 4HEA2 4J0MA 2M4GA 3K4LA 4B44A 3DPTA 5FROA 4EFBA 4DR4H 5JHFA 1D1BA 4UCVA 3W2WA 2X6WA 4YRVA 3OYNA 1AT0A 2MCTA 3HKZA 3N43B 4UCOA 4X62H 4JYAH 4KHPH 4LFCH 2IS6A 2FUG2 3N40P 3V42A 3HYJA 3C2GA 3L2PA 2PJRB 3J7AK 3H0DA 4J01A 2LQMA 2VUGA 2K9LA 1ZD7A 1SFKA 5A2QW 2BVMA 4AQUA 2WA0A 3OWTA 1FMWA 2VB6A 3LSIA 2XC7A 3OOLA 2V1NA 4BEHA 2W82A 4DV0H 4LF9H 5E5OA 1TA8A 2K5CA 4AU7A 2IN8A 3BA9A 4AQXA 3LL7A 3QYBA 4E7SA 5FPOA 3H35A 2IGOA 3QODA 1MW7A 2VQLA 3K70D 4KL5A 3MXAA 3KX2A 2LRDA 3OYGA 3FDYA 1SYXB 3JAMW 4CC5A 2KP6A 4PFOA 3F8NA 1S68A 4BU2A 3RQ4A 1HR0H 2KL4A 4O1SA 4AAGA 3H9GA 2PJRA 2KDOA 2HQAA 1GYFA 1DQUA 4MV9A 4EEQA 4NC7A 1WJBA 1ZELA 4CA0A 4E4HA 5CQGA 4CSWA 2OC6A 3RGZA 2CH0A 3KXYT 2QOJZ 4NXNH 1G8XA 1WFXA 3CJQB 2JUGA 4HNTA 2OWOA 5EOYA 1V5FA 4GKKH 2UXDH 1IRXA 3ZGKA 3OYFA 4LQ0A 3C0FB 4FM9A 3EUKL 1HNXH 3CZ6A 3J7AY 3FHNA 2W00A 2VS7A 4F92B 3EH8A 1V9PA 4UN7A 2UUCH 3GBGA 3OYHA 2AB5A 4II2A 3QYFA 4QPQA 2JA2A 2BW3B 2X85A 3VYUB 5AKFA 2VBJB 2VJ4A 3KAKA 3I3LA 3HOSA 4D9JA 3CVZA 3CP2A 1WJFA 2VS8A 4XKVA 3BG6A 2UUZA 4LH7A 2V7FA 4KITB 3L2VA 2Q2UA 3KEYA 4LF4H 2IS4A 1WJEA 2UXCH 1P8LA 3AFHA 2HPIA 2VQHA 4PJJA 4XR6A 4BQNA 1N77A 2V9KA 1N3FA 2V4JC 2XE0B 2VBLA 4A2AA 4AQYH 1LKXA 1JVAA 2LREA 3ZRGA 3OYJA 2VKDA 5A72A 1W36D 2BW3A 3L4JA 2VBJA 1GLNA 1MNDA 3MKWB 3VSLA 2E1MC 4M7EA 3H20A 4I7HA 2Z16A 3IGDA 3KO2A 2P0WA 3N6XA 4UFZA 2VQCA 2VXZA 3IAS2 1WJ5A 1D0YA 3SZGA 5A0WA 3CMMA 1Z2NX 5HVQC 3ZCOA 2VXDA 4ZJZA 3HL2A 1QHGA 2MD0A 2RREA 3M8JA 2L5QA 2Q2TA 1NG6A 2E1MB 1Y56A 2KSWA 4BL0B 2KQRA 1FMVA 2XE0A 2KZVA 3AL0C 1SEIA 5KHDA 3OY9A 2E5LH 4BS9A 4APMA 4UT0A 2IGKA 3LFUA 3N42B 1QHHD 4NC8A 5HNFA 4XKCA 3E0JB 1L2ZA 1ZDEA 2IXSA 4JI4H 4RB0A 4RB3C 3OL4A 2FE3A 1Z7LA 3T1HH 4Y4RA 3DTEA 1D1CA 2VBNB 3IG0A 3AL0B 4XLFA 3RTXA 2I8DA 2XDVA 5IT9W 1M5XA 3OR2C 2XF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LQM A;  1ZD7 A;  2L8L A;  5A77 A;  1G9Y A;  1AF5 A;  4AQU A;  2IN9 A;  2DCH X;  3HYI A;  3OOL A;  2JMZ A;  1R7M A;  5E5O A;  2IN8 A;  2VBO A;  5AKM A;  4AQX A;  4AAF A;  4UN9 A;  5A0M B;  2KEQ A;  1BP7 A;  2CW7 A;  4LOX A;  4KL5 A;  3MXA A;  1GPP A;  4UN8 G;  4UNC A;  5A78 A;  4Z1Z A;  2VBN A;  4UN7 G;  4O1S A;  4AAG A;  2JNQ A;  3E54 A;  2I3Q A;  3OOR A;  1T9I A;  2FLD A;  5AK9 A;  3R7P A;  4GIG A;  3IFJ A;  4EFJ A;  3C0X A;  2QOJ Z;  3QQY A;  1P8K Z;  3MIP A;  4LQ0 A;  4UN8 A;  4OZ6 A;  2VS7 A;  3EH8 A;  3MXB B;  5A0M A;  4UN7 A;  2O7M A;  2AB5 A;  1MI8 A;  5AKN A;  5AKF A;  2VBJ B;  5I0A A;  1DQ3 A;  4E2T A;  1U0D A;  2VS8 A;  3UVF A;  4D6O A;  2IN0 A;  1UM2 A;  4YIT A;  1B24 A;  4Z20 A;  2I3P A;  5E63 A;  1T9J A;  4AAB A;  2LWY A;  4D6N A;  3FD2 A;  1N3F A;  3MX9 A;  4Z1X A;  2XE0 B;  2VBL A;  3MXB A;  1JVA A;  4YHX A;  2VBL B;  2IMZ A;  4KL6 A;  4YIS A;  5A72 A;  2VBJ A;  1N3E A;  1AM2 A;  4AAE A;  4UNB A;  1MOW A;  1LWT A;  1G9Z A;  3IGD A;  3KO2 A;  4AAD A;  2EX5 A;  5A0W A;  2LCJ A;  1U0C A;  5E5S A;  3C0W A;  1LWS A;  3NZM A;  5A74 A;  2XE0 A;  5K08 A;  4E2U A;  4UT0 A;  2VBO B;  4UNA A;  1DFA A;  2CW8 A;  4O1R A;  1ZDE A;  1EF0 A;  5E67 A;  1VDE A;  3MIS A;  1AT0 A;  2VBN B;  4UN9 G;  3HYJ A;  1M5X A; 
#chains in the Genus database with same CATH topology
 3F22 A;  2QBY A;  4BDY A;  1ODD A;  2XGC A;  5KFH A;  1Z77 A;  4JI7 H;  4FAS D;  1SFE A;  2XRO A;  3JRX A;  2PN6 A;  2DLN A;  1LQ1 A;  4KN4 X;  3IAM 2;  4UB8 C;  3OSN A;  1ZRC A;  2FB9 A;  4XKB A;  5FFZ A;  3S1Q J;  5CB4 F;  3SE7 A;  1SAN A;  4BY7 J;  1FOK A;  2K9M A;  1HC8 A;  3LAJ A;  3N8D A;  4ZZD A;  1PYV A;  2P6T A;  1X1C A;  2XF5 A;  3ZN0 A;  3BZK A;  2LP0 A;  4CCN A;  1B4A A;  2P7V B;  2ELJ A;  3H3U A;  4JP0 A;  2HQN A;  3C2H A;  3E97 A;  4LLL A;  4ED8 A;  3BR2 A;  5BPI A;  3FX3 A;  1A35 A;  1B59 A;  4UNC A;  3DBR B;  4IWY A;  3IWF A;  4IRK A;  5D1O B;  1IOW A;  4PCQ A;  2R8G A;  3CC2 I;  2IA6 A;  3G1O A;  1TWC A;  3OYA A;  1ZLK A;  4UY8 I;  2VOO A;  4Q5S F;  5J1U A;  1WH2 A;  1IV6 A;  4YR0 A;  2A6H F;  5FKM A;  4O3Q A;  3JCU C;  2BOL A;  3C0X A;  1MDM B;  1BOB A;  1MD0 A;  4JBA A;  4C2M A;  4DV7 H;  4WXD A;  1C30 A;  5J6X A;  2A5W A;  2E60 A;  1T08 B;  5D8L B;  2MW8 A;  1Z2O X;  4A3M J;  1WVR A;  1R58 A;  4BAY A;  4XQF A;  4HF1 A;  2EFO A;  3VMM A;  2F4V H;  4A3L J;  3WTX C;  1B8I B;  3IKV A;  3U1K A;  1X4P A;  5I0A A;  3KCC A;  4Y17 A;  4E2T A;  1NTC A;  5KG7 A;  4BY7 G;  1TZL A;  2Y0M A;  2NS7 A;  2O61 A;  4RB1 A;  1N25 A;  1ZRD A;  4KDP A;  2IN0 A;  4GYG A;  1G59 A;  5LD2 C;  2B9S A;  3C18 A;  1FIA A;  3OTO H;  2R0Q C;  3AG2 H;  3VDX A;  1WSU A;  1Y1W J;  5BR8 H;  4OIN F;  5EWF A;  3L2U A;  1LDK B;  2IAI A;  2VJ5 A;  1MIJ A;  4A5M A;  1EJ9 A;  2XAQ A;  1BC8 C;  2NXN B;  4KN7 X;  2V5A A;  4U87 A;  4LB5 A;  4J00 A;  4MV1 A;  4EG0 A;  4RLF A;  3QZ7 A;  2HZD A;  4F50 A;  2VOD A;  2JTV A;  2DT5 A;  4YEJ A;  3ZQ7 A;  3MXB A;  2BY3 A;  4LK0 F;  2R4G A;  4YHX A;  2X51 A;  5KFG A;  5BPF A;  1XGO A;  2WWY A;  4MEX F;  1GSH A;  3I12 A;  1XSD A;  1FBQ A;  1N3E A;  3G8C A;  5JR3 A;  1IAW A;  1X1P A;  1MJ9 A;  2F2E A;  4AC0 A;  4C2T A;  3QQA A;  2FK2 A;  1WHU A;  3UFX B;  2L3D A;  3FM5 A;  4A3E G;  2BXY A;  4BQA A;  1X2M A;  2KHM A;  2VKV A;  1TQM A;  3HHG A;  2B7E A;  3BAA A;  4FET A;  1HW2 A;  3GIQ A;  2NYX A;  2DT6 A;  4Y13 A;  5HLI A;  3K4M A;  2HU9 A;  1VQ9 I;  4A3B G;  4HNU A;  2XVC A;  2R7Z J;  4P96 A;  2Y0S N;  3DFG A;  5TRD A;  2NVT J;  3T1B A;  2ICW G;  1XC5 A;  5FLX K;  3G2B A;  5DG8 A;  2IGN A;  3MEX A;  1N36 H;  4G7H F;  2ZFU A;  4DBR A;  1RK5 A;  1X1B A;  1M0W A;  1UZC A;  3KAL A;  4NDL A;  4PJM A;  3H0G J;  3PM1 A;  2JN6 A;  4QWQ A;  1EF0 A;  4KA4 A;  3BQ2 A;  1VBG A;  3K4J A;  4DR1 H;  4XON A;  2G7U A;  1KC7 A;  4L18 B;  4G94 A;  1P4A A;  2W57 A;  1LE8 A;  2ZM6 H;  3HZJ A;  3KAJ A;  5HV6 A;  1EV7 A;  1R5I D;  2XSD C;  2E1C A;  4XL9 A;  1XG1 A;  5IOY A;  4ECU A;  3OYK A;  4P5O A;  4LF5 H;  3E5Q A;  1CF7 B;  3LNQ A;  3DU5 A;  5KG1 A;  2CW0 F;  4B09 A;  5ICC A;  1RES A;  3HRU A;  3ZMZ A;  1R7M A;  4B3M H;  2LC2 A;  1N48 A;  4E6K G;  1X1D A;  1KA8 A;  5IYZ F;  3MR3 A;  3VYT B;  1POG A;  2AHQ A;  2R7U A;  3RIZ A;  2R7Z G;  3AKZ A;  3RUP A;  3MR2 A;  1G3W A;  3OYE A;  2CW7 A;  4MQ9 F;  2DA5 A;  4A3J J;  1RNL A;  1A36 A;  4XM3 A;  1VQ7 I;  3P9C A;  1PJR A;  2V6E A;  5A78 A;  4Q8E A;  3V7R A;  3MMY B;  2ETH A;  2I87 A;  4L9V A;  1GSA A;  3FK6 A;  3JW4 A;  1AKH B;  3K4B A;  4J19 A;  1T9I A;  3H0G G;  2X6Y A;  3GLL A;  5KG3 A;  2BHY A;  2QF7 A;  2Y9Y A;  4GIG A;  1I27 A;  2VUM A;  1XGN A;  4ZYH A;  1RKW A;  3D1N I;  4UNO A;  1JKJ B;  1DP3 A;  2B63 A;  3K3P A;  1UHW A;  1P8K Z;  3HXL A;  3TQN A;  1IN8 A;  2LBF A;  3IP4 B;  4E7H A;  3HTS B;  4XRS A;  5EGO A;  3VWB A;  4XOR A;  4BJ5 C;  3A01 B;  4CZZ A;  4HG2 A;  1IXC A;  4QJF A;  1BBY A;  2R8K A;  1IRZ A;  2H6B A;  3KP5 A;  3CMY A;  2W71 A;  2B0L A;  5E3M A;  3BG9 A;  5HOO A;  4LIT A;  2R82 A;  3BY6 A;  4G6T B;  3H4D A;  2L9N A;  2FQ4 A;  4ANJ A;  1YIT I;  4ECY A;  2KRF A;  2EBI A;  3CC7 I;  2FLN A;  1OCC H;  1CE8 A;  2CQK A;  3RPU A;  2CQN A;  4F3Q A;  2ZSH B;  5IP9 G;  3BR6 A;  3I4N J;  4BHC A;  1QQI A;  4EJU A;  2KJC A;  3CMA I;  2MLK A;  1UCR A;  3GTL A;  2LSO A;  3GFI A;  2VLA A;  1KJ8 A;  3KP6 A;  4L9J A;  4JX5 A;  4PK4 A;  2P7C B;  1R1T A;  2R7D A;  1YX3 A;  2RNG A;  1EF4 A;  4IR9 A;  1V3F A;  3QPH A;  1G4D A;  1W93 A;  2GPW A;  3ETH A;  3RSN A;  4RAY A;  4ECR A;  2LY2 A;  3M4I A;  1E4E A;  2IW5 A;  3R0J A;  4A3K G;  2R6F A;  1SCU B;  4HYE A;  3M9N B;  3E6M A;  2DMP A;  2J5O A;  3KEO A;  3GTJ A;  5BPH A;  2YCH A;  1B1B A;  3ONQ A;  4LG3 A;  4P55 A;  5K7Z A;  1U78 A;  1FYL A;  4EM1 A;  2CQY A;  2QSH X;  2ZDG A;  1MBH A;  4JI1 H;  3N41 B;  1LNW A;  4F91 B;  3FM3 A;  5K08 A;  3G3Z A;  4XLA A;  2JK3 A;  3FZV A;  1T38 A;  4IHV A;  3V4S A;  4RNM A;  3RB6 A;  2VBO B;  1FNN A;  2H1L A;  5EEG A;  4OIR F;  1OLT A;  4B1R A;  3KET A;  5KNL A;  2D45 A;  1XDU A;  3VYS B;  4IRI A;  3RJ0 A;  3I4N G;  3MZY A;  2QYO A;  3OIO A;  1EA3 A;  2W6Z A;  3K70 C;  1ERD A;  4EJW A;  2WDT A;  2K9S A;  3CF2 A;  3HRT A;  3W2A A;  2DFE A;  2L4M A;  4HST A;  4FU0 A;  3TIN A;  4DR2 H;  5F9N A;  2PFB A;  2JEF A;  4A2B A;  2E1O A;  3WHC A;  4GDF A;  4RNN A;  2KPM A;  1XGS A;  3K7A J;  1VQ8 I;  2V59 A;  5KT3 A;  1TP4 A;  2HWV A;  2W6O A;  3JSN A;  1S10 A;  4OOI A;  5EDN A;  2UV1 A;  4MV7 A;  3OSP A;  1FOY A;  1R5H A;  2GQQ A;  5DQG A;  4BXF A;  3LSJ A;  2R7W A;  1E3O C;  5JLW A;  2FMY A;  4G7Z F;  3G6V A;  4GLX A;  3WGG A;  1I94 H;  2E1N A;  2HKX A;  2OAZ A;  2KRC A;  3BG3 A;  3OR1 C;  1YRN B;  4E4T A;  4EBD A;  3TIG A;  3OYD A;  2Y0S E;  2GPS A;  1E17 A;  3WTS C;  4ZH4 F;  2IEK A;  3CES A;  4ED3 A;  2QK4 A;  2VOB A;  2XF7 A;  3GII A;  4I6Z A;  4D5F A;  2L54 A;  2IA0 A;  1JKQ C;  2QQB A;  3O6B B;  2R7O A;  4M9X A;  3PQK A;  5FRM A;  2JNQ A;  2NU8 B;  5BMV F;  2XGQ A;  2FLD A;  2RQQ A;  3R7P A;  2DYS H;  4LH6 A;  1JUS A;  4O2A F;  3WTZ A;  1YW8 A;  4DNC A;  2LKS A;  3K4C A;  4Y15 A;  3ZQC A;  2IP2 A;  3HPG A;  4ZDO A;  2HHH H;  2ID3 A;  4EGJ A;  3K69 A;  1T98 A;  3QQY A;  5KT2 A;  5ILU A;  3K2A A;  4FX4 A;  1W0U A;  2C2E A;  3KYC B;  4EJV A;  2AO9 A;  3A4C A;  4GFB A;  3DKX A;  1RET A;  2AU0 A;  2PEX A;  2LR8 A;  3IL2 A;  3CF5 F;  4MTE A;  4MIM A;  5FRN A;  2LOO A;  2ZSI B;  2PG4 A;  4MGR A;  3HOY J;  1U0D A;  5K2M A;  3SJM A;  2QKL B;  2JA6 J;  4WWC A;  1VQ6 I;  3HOU G;  1KYZ A;  4R8U B;  1JXS A;  3IRQ A;  1U5T C;  3BG7 A;  2Z33 A;  2VT2 A;  3Q0V A;  3RBE A;  4AUX A;  5LFA A;  3SZP A;  4HOB A;  2M7B A;  2EA2 A;  4OWR B;  1GV5 A;  3OS0 A;  2R86 A;  1OFC X;  1LB2 A;  4DV2 H;  2AXL A;  3GTQ A;  4NBQ A;  2P6S A;  5CVJ A;  4UVA A;  3HUG B;  2E5Z A;  2K9N A;  4M6V A;  4CH7 A;  3OOP A;  4PJL A;  4XNF A;  5ED4 A;  1VND A;  4Z1X A;  1BXR A;  2MAB A;  3O8G A;  5L1L A;  3MN2 A;  2IMW P;  3BQZ A;  1QPM A;  1TWF A;  5EEA A;  1SFO A;  4OIQ F;  1PVE A;  3ML6 A;  2J6S A;  4JI3 H;  4EEF G;  2ACJ A;  2XB5 A;  2HGC A;  1AM2 A;  4E7I A;  3I4P A;  4MLO A;  5JQW A;  4K0K H;  3T5H A;  2FKL A;  3IH3 A;  3DEE A;  4ZDL A;  2HDW A;  3R5H A;  2ZDQ A;  2L9S A;  3VOE A;  3FMQ A;  5AIQ A;  5J4V A;  1E0E A;  3HOY G;  1W7P B;  3SDG A;  5HS8 A;  4KYW A;  4NXM H;  5GP9 A;  2RDI A;  1IXR C;  2JA6 G;  4Q0Y A;  1ZAO A;  3OS2 A;  1JKR C;  2DMQ A;  4HV5 A;  2IPQ X;  4U7B A;  4A0X A;  1AOY A;  4IWX A;  2P5K A;  3BR0 A;  3CCR I;  5JLX A;  2OU2 A;  5DG7 A;  1S7A A;  1MNE A;  3GIJ A;  4HQE A;  4IRD A;  2M4G A;  4B44 A;  2QA4 I;  4NLG A;  1D1B A;  3W2W A;  4YRV A;  3OYN A;  1AT0 A;  5IT9 K;  3HKZ A;  3F23 A;  3PUF A;  5JFR A;  4X62 H;  2XCP A;  2FUG 2;  2R8H A;  4QWD A;  3A02 A;  3PW4 A;  1Y8Q B;  3BZC A;  3C2G A;  4W97 A;  2PJR B;  4FBU A;  1GUU A;  4GO1 A;  4J01 A;  4HX7 A;  1ZD7 A;  3BQ1 A;  1SFK A;  3KTM A;  2KZG A;  2BVM A;  5KT6 A;  1OCO H;  2DPU A;  4AQU A;  2IA1 A;  3RKW A;  2XC7 A;  1RI7 A;  3JZI A;  1K1Q A;  4ZYD A;  3TOA A;  4M6Y A;  4RGR A;  2W82 A;  2NS8 A;  2NVY A;  4XSZ F;  5E5O A;  2M0C A;  4CO8 A;  2Y48 A;  4HNV A;  5KFC A;  3FXL A;  3F21 A;  1U2W A;  4EYH B;  1Y1V J;  4C3H J;  4M3F A;  5FPO A;  3KP7 A;  4J9L A;  3QOD A;  5E3L A;  4YG2 F;  1MW7 A;  2GXA A;  2DWC A;  1K6O A;  3I59 A;  2BGC A;  2LRD A;  3FDY A;  1SYX B;  2UVW A;  4CC5 A;  2M9H A;  2EA4 A;  2J9G A;  3E7L A;  4Z6Y A;  2JQ7 A;  2KL4 A;  4TV7 A;  3RDI A;  4Q47 A;  1ULY A;  2BE5 F;  2K40 A;  1ON2 A;  4NC7 A;  2BR0 A;  1ZEL A;  1IN6 A;  1OCZ H;  2JEJ A;  2NNY A;  4L5I A;  2OC6 A;  5GON F;  3ECO A;  2R7Z A;  2CH0 A;  4L0Z B;  1WFX A;  2XAJ A;  4ABZ A;  5EOY A;  4LQ0 A;  2BHZ A;  2I80 A;  5C5J A;  1HNX H;  3BZ6 A;  1IN7 A;  1S7O A;  1W96 A;  2XCA A;  3A03 A;  2ME6 A;  4ED0 A;  5BQT A;  3RI4 A;  2ISZ A;  2X85 A;  3VYU B;  2VBZ A;  3H0G A;  2OPT A;  1WH7 A;  2OD5 A;  4UHT A;  3FXM A;  4A3G J;  1B6R A;  2VS8 A;  1YW9 A;  2LFB A;  2XAH A;  3BG6 A;  3ZQH A;  3NAR A;  3GIL A;  2K02 A;  2M8E A;  4I99 C;  1TNT A;  1YQA A;  2W85 A;  1SC7 A;  1GGO A;  1Y1V G;  5B66 C;  2Q2U A;  3I64 A;  3BOQ A;  3KEY A;  3CC4 I;  4AIK A;  2UXC H;  1UC9 A;  2VQH A;  1WRJ A;  3LQQ A;  5B1A H;  3I56 I;  2YYA A;  2R5Z B;  3E5X A;  2CUF A;  3ZPL A;  3ZOB A;  1S72 I;  2V4J C;  2VBL A;  2RN7 A;  4XLP F;  1X2N A;  4TV9 F;  5M5X J;  5DQI A;  4O2B F;  3OYJ A;  4HR7 A;  4ECZ A;  2A5Y B;  2BW3 A;  4LLG F;  5KFA A;  1NK2 P;  3VSL A;  3VB2 A;  5IYB J;  3ZN1 A;  3H20 A;  3VOD A;  3VEP A;  2VXZ A;  3NAU A;  2OQR A;  3SZG A;  2R84 A;  3CMM A;  1Z2N X;  4AVP A;  4ZJZ A;  3CCJ I;  3HL2 A;  5FKN A;  1J9I A;  5D8D A;  4A3G G;  2QBY B;  3BR3 A;  3M8J A;  4IEJ A;  5EEH A;  1JLL B;  3MAJ A;  4FQG A;  5B1B H;  3GO5 A;  1OYI A;  4A6D A;  4DZP A;  4HV6 A;  2KQR A;  4IHY A;  2KZV A;  3AL0 C;  3GTO A;  5KFM A;  2NVX J;  3RV4 A;  1G3Y A;  4APM A;  4FT8 A;  2ZJR F;  2FOW A;  2IGK A;  3LFU A;  1QRY A;  1ZH5 A;  4U0W A;  2DMT A;  1L2Z A;  3CDI A;  1DP7 P;  1MSF C;  2ALZ A;  2GZW A;  3FXJ A;  4RB0 A;  3MWE A;  1EH8 A;  3OL4 A;  5GPC A;  2RC4 A;  5FKL A;  3N4M A;  2FE3 A;  5LLQ A;  4LLN A;  4C5C A;  2XRL A;  3WNZ A;  2XGP A;  1G6N A;  2D5V A;  2XKP A;  4N9I A;  4PWQ A;  2XDV A;  1V54 H;  1LKX A;  1R4M B;  1XMK A;  5IYB G;  1VZ0 A;  1EZ1 A;  3M4O J;  1HDP A;  2IN9 A;  1KGS A;  1HA8 A;  1EHI A;  4C3J J;  2WAF A;  2O8K A;  2FBI A;  2X6X A;  4J9K A;  1Y0N A;  3Q0U A;  4LOC A;  2UVV A;  3E5U A;  2G9W A;  3UR3 C;  2JSP A;  1P9Q C;  2VE9 A;  2PI0 A;  3CD6 I;  3ORR A;  4C5A A;  3R0A A;  2DN0 A;  1HST A;  2EV6 A;  4NHJ A;  1JX4 A;  3L00 A;  2VPR A;  1UHS A;  4YEL A;  3PW0 A;  2JPB A;  4EMS A;  5D4R A;  2BQ3 A;  3ZQF A;  4ENK A;  5BS6 A;  3PW2 A;  3DLA A;  3FMR A;  1F5T A;  2JUC A;  4I2O A;  3PUB A;  1X9N A;  1HCR A;  3GFM A;  4RZQ A;  5KFU A;  3HOW J;  3GZ5 A;  3M1C A;  4KT5 C;  4M73 A;  5KK1 A;  2IBD A;  4LF8 H;  3CUO A;  3S3N A;  3VPB A;  3WG7 H;  4B3S H;  2A69 F;  4OZ6 A;  2R7R A;  1AA7 A;  2GIZ A;  1FKA H;  2Z9O A;  2W1O A;  3MXB B;  4NQW A;  1I1S A;  2RF4 A;  2L01 A;  4ENJ A;  2C22 A;  2X9D A;  4BY1 J;  3FHZ A;  1KU9 A;  4Y3O A;  3HTU A;  2R92 J;  2GAU A;  2M1B A;  1VTN C;  3C1D A;  2XAG A;  5D6E A;  1LFB A;  3CCV I;  1D1A A;  3M07 A;  2A61 A;  2DA4 A;  4B43 A;  1IBL H;  2E36 A;  3T0Y A;  4YIT A;  1O75 A;  3H9Q A;  4HW0 A;  5E18 F;  5LEJ A;  3Q1K A;  2GA2 A;  2OCC H;  3ZQI A;  4UV9 A;  5KFY A;  1JKO C;  4QTR A;  3OYB A;  1ITY A;  3PL8 A;  2A3S A;  3B02 A;  3PZP A;  2P5V A;  4KZS A;  2OA4 A;  4ECX A;  2HVS A;  4C30 A;  2O5R A;  4EM2 A;  1CS0 A;  1TC3 C;  3QRF F;  2R87 A;  3G73 A;  3RKQ A;  2DT7 B;  4D7M A;  2VBY A;  2PBZ A;  3PN1 A;  3T5K A;  3HIF A;  2LCJ A;  4BY1 G;  2KFD A;  3FIW A;  4AD9 A;  1BW5 A;  4O3O A;  2R92 G;  2OF7 A;  3LWB A;  3RQI A;  2XB0 X;  4I4T F;  1E3P A;  3D5S C;  3BCA A;  3I4M G;  2VBW A;  2NRA C;  4HF2 A;  1D8K A;  3CCS I;  3PNT A;  2QQ8 A;  4G7O F;  4PJ0 C;  4UNA A;  1ZGJ A;  3L2C A;  4O1R A;  1FWZ A;  1FOX A;  2W7O A;  2UUB H;  3T5L A;  1KEE A;  1QZY A;  4LIV A;  3BJO A;  5E67 A;  1MNM C;  4TUY F;  3RBD A;  5KCM A;  3MIS A;  5L3E A;  3FMA A;  3GFL A;  2JA6 A;  2VAS A;  3HKZ N;  1I6U A;  2R7F A;  3R61 A;  3JTG A;  2E2H J;  1RYR A;  3DQV C;  4QWC A;  3CLQ A;  2WE6 A;  1XSX A;  1Z1D A;  5KFX A;  3U1D A;  3S1N J;  1JDE A;  2HVQ A;  5L1I A;  2W48 A;  2RGR A;  2W7N A;  2JA7 J;  2F5V A;  2DA3 A;  2LBF B;  4HDV A;  5EGO B;  2VJJ A;  1O3S A;  3TKY A;  1BJA A;  1BP7 A;  3CCL I;  3H9J A;  4LOX A;  2CMP A;  5JVT A;  2GIV A;  4ESJ A;  1ZQ3 P;  4J9O A;  2EIK H;  3J7Y J;  3F0C A;  5CYV A;  4PGH A;  2XIG A;  3BA8 A;  2ZJQ F;  4DBQ A;  2YL2 A;  4BHP A;  2J6U A;  3OOR A;  2IBK A;  5GAE J;  5L1K A;  2L7K A;  4PDB A;  4JI6 H;  4GXO A;  3CDH A;  1VKZ A;  2UUA H;  4O5V A;  2DIK A;  4NUB A;  5EG0 A;  4I01 A;  4UCR A;  5KT5 A;  2LH9 A;  4E7K A;  1MBE A;  2RNJ A;  2E34 A;  2IS2 A;  2MG4 A;  2ESN A;  4XK4 A;  3GTQ J;  1FLI A;  2UWM A;  4F4X A;  3NEU A;  2OCE A;  3B73 A;  1MI8 A;  1V5E A;  1TWF J;  2EFQ A;  4PFP A;  3P5J A;  2JVH A;  5TGT A;  1SFO J;  3V8K A;  3WU2 C;  4A3C J;  2EV5 A;  1IV8 A;  1DGS A;  4M9U A;  2W9A A;  3Q8Q B;  2JA7 G;  1H0M A;  2XC9 A;  2XHK A;  3BJA A;  3K10 A;  3J80 K;  4RB2 C;  3I55 I;  5LMU H;  3SZT A;  3H40 A;  2R3S A;  3L2W A;  4CUG A;  4DLK A;  1H8A C;  1E4E B;  5LA6 F;  2CYY A;  4IQ4 A;  3OYM A;  1LUJ B;  3CJN A;  3DTK A;  1FP1 D;  3OL3 A;  4MNU A;  3JRF A;  4UVB A;  3M8F A;  1BA5 A;  5A2Q Z;  4B3R H;  4Z20 A;  3KYD B;  1IDZ A;  5HDK A;  2EZK A;  1IG7 A;  3B6C A;  1Z2P X;  2W9C A;  4HX4 A;  5CJ9 A;  5D4S A;  4C5B A;  3CCU I;  4IHS A;  5FKO A;  2KIU A;  3I58 A;  4A3D J;  1W1W E;  1IOV A;  4A3E J;  1I6H J;  2IMZ A;  3PW5 A;  2DXI A;  4KL6 A;  1Y1V A;  3CQZ J;  3S32 A;  1DDN A;  2WTE A;  3TL4 X;  3MFH A;  5FLX Z;  3RB0 A;  4GKJ H;  3RYR A;  3HOV J;  4KJZ A;  5KFT A;  4UNB A;  5GTI C;  1F9N A;  1D0X A;  3TMO A;  3BTL A;  4A3B J;  3JSL A;  1N56 A;  1R9T A;  4NC6 A;  3G71 I;  4A3C G;  4B8X A;  5E5S A;  4EGZ A;  1UC8 A;  3EDP A;  4LFA H;  4XBF A;  2DZD A;  3F8F A;  1HKT A;  3NZM A;  2F5E A;  3WO0 A;  3LQR A;  5CQE A;  3LSG A;  5LHH A;  1QPI A;  2XGD A;  2W6N A;  2WV0 A;  2NAZ A;  5CVU A;  2FPP B;  3TQ1 A;  2L7F P;  2NVY J;  3CCQ I;  5FD6 A;  2FMA A;  2CW8 A;  3NGD A;  4JYK A;  2VPL A;  2E71 A;  5DDG A;  5J4Y A;  2VPS A;  3JRH A;  1C0W A;  5FLX W;  2TDX A;  4L0Y B;  3K5I A;  2CFX A;  3TDZ C;  4J9M A;  4A3D G;  1RR7 A;  2CFO A;  3RJP A;  1WQ2 A;  5KVR A;  3KLN A;  3EET A;  5A2Q K;  2PJP A;  1OR7 C;  5E79 C;  2X6O A;  4LIU A;  4P9U A;  3KHG A;  2FLL A;  1D0Z A;  3HOV G;  2VOP A;  1FVI A;  3VYR B;  1IUF A;  5IP7 J;  3LA2 A;  2HNH A;  3F6V A;  2N8G A;  2JSC A;  1KU7 A;  2V9P A;  3PFY A;  1T0F C;  3HPH A;  5EZY F;  3I9V 2;  2LLK A;  1STZ A;  3S8P A;  3OIQ A;  2M8G X;  4O3R A;  1S5L C;  2WAE A;  2YRW A;  3H1C A;  3H4B A;  2E7W A;  2O0Y A;  1O3Q A;  6PAX A;  2GOX B;  5ICF A;  2BZT A;  3K4K A;  2VJI A;  3O3K A;  5DLG A;  1ZG3 A;  4ENN A;  4CYD A;  5J1R A;  1EH7 A;  2I3Q A;  2HYJ A;  2YU9 J;  5KFN A;  4ZTF A;  3RAQ A;  3DPL C;  2HPM A;  2CQX A;  1UEL B;  3HJE A;  4DV1 H;  4D1Q A;  3H3V K;  4FCY A;  1IGN A;  3HKZ E;  3LSH A;  4HYK A;  1XMO H;  1U9N A;  1YE9 A;  2D1H A;  2QUF A;  2XAF A;  2NVX A;  1VFC A;  2STT A;  3K1M A;  5IP7 G;  3ASO H;  4PDK A;  2FPG B;  1ZHF A;  4X0G A;  1WCM G;  3V4Z A;  3ABL H;  1ENH A;  1W36 C;  1O7F A;  5H6Q A;  2NOJ B;  2L7Z A;  5B3S H;  4LSA A;  4CCO A;  5J2T F;  1MZB A;  1S7E A;  3LSR A;  2EZH A;  3TBI A;  4JQF A;  5IP9 J;  3QU3 A;  4XLC A;  4H4K C;  3U21 A;  3WU0 A;  1A9X A;  5KFW A;  4JV2 A;  3LOC A;  4OAY A;  1A6Q A;  3GTK J;  5KFI A;  4IO9 F;  3RZD J;  3BPX A;  1T3N A;  4HX8 A;  4B4C A;  3MKY B;  2MH9 A;  1QZZ A;  2X4H A;  2I3P A;  1MBG A;  3IUO A;  4JX6 A;  4AAB A;  3SFZ A;  1KJJ A;  2YS6 A;  5KFS A;  3WGH A;  4D6N A;  1ETO A;  3ABK H;  3ZQQ A;  4O4I F;  4G3I A;  1Z05 A;  4Q44 A;  3GTO J;  2BYV E;  1LDD A;  1A6I A;  4RDU A;  3OUU A;  2MSY A;  1B6A A;  4Y33 A;  4A0Z A;  5DUK A;  3IC7 A;  3BTJ A;  4A3K J;  1S9F A;  1VF9 A;  2ZME A;  1Z21 A;  5KFD A;  3F8B A;  1D5Y A;  2GOM A;  2DYR H;  5AON A;  3ZP5 A;  2AGQ A;  3ABU A;  1FT9 A;  3EYI A;  1N34 H;  4YIR X;  1EH6 A;  1ZRE A;  2XAU A;  1MMG A;  4BE2 A;  1ZTR A;  4ZTJ A;  3QWL A;  1XMQ H;  1UG0 A;  1YJ9 I;  1OCT C;  3EUH C;  4Y7N J;  2O6G E;  1QU3 A;  3BCB A;  4MAM A;  2H6C A;  3JSP A;  1ZG5 A;  4ESB A;  1G3T A;  2HVR A;  2O3F A;  2NNN A;  3F9K A;  5EYR A;  1B72 A;  2R92 A;  1XX5 A;  1IO2 A;  4EFB A;  5JHF A;  4UCV A;  3I59 B;  1IBK H;  4JYA H;  2MCT A;  3N43 B;  2R7K A;  2MBF A;  4O3P A;  3PO3 G;  4HDU A;  1JJ8 C;  2VN2 A;  3U9T A;  3IH4 A;  2WTF A;  5I47 A;  3HSE A;  4CIC A;  4HQM A;  2LQM A;  2EWN A;  2ZJP F;  1DU0 A;  2ELH A;  3V7C A;  3GXO A;  2WA0 A;  1KJ9 A;  1FMW A;  2VB6 A;  3GQC A;  1R4N B;  1X3W B;  3FXQ A;  1PP8 F;  4BEH A;  3BQ0 A;  4PGG A;  1FP2 A;  4TQS A;  4DV0 H;  4LF9 H;  2K5C A;  3SFI A;  4AU7 A;  2ZC2 A;  4P9F A;  3BA9 A;  1Z9C A;  1YOV B;  1IRF A;  3QYB A;  2ZFW A;  1TT5 B;  4AQX A;  2H8R A;  4KMF A;  1YIJ I;  5IT3 A;  4ECV A;  3KX2 A;  3KHR A;  2VKE A;  2ZNY A;  4EYI B;  3F8N A;  1S68 A;  1R7J A;  2EZL A;  1A5J A;  4S05 A;  4M9Z A;  2KDO A;  3A0H C;  1GYF A;  4BBR J;  1F4K A;  4MV9 A;  3EPI A;  3KHH A;  1WJB A;  2F5C A;  1IUY A;  1ZYR F;  2EZI A;  2COB A;  5GTH C;  2YU3 A;  3Q9V A;  1BI2 A;  5L3B A;  2BY1 A;  5EF6 A;  3CCE I;  1F36 A;  2DPD A;  3RGZ A;  2QOJ Z;  4NXN H;  4BXX G;  2JUG A;  2V1X A;  4CDG A;  5TIS C;  4FM9 A;  2CO5 A;  2VS7 A;  1GDT A;  4F92 B;  1WSC A;  3L1P A;  2FNA A;  3MKL A;  3GBG A;  3ZMV A;  2Y30 A;  3OYH A;  3COA C;  3HOU J;  4FS2 A;  2L0K A;  4QPQ A;  1TWA J;  1HKS A;  2BW3 B;  2JA2 A;  5AIP A;  4ZZL A;  3KIO A;  5E1W A;  3BJY A;  3HOS A;  4DL4 A;  4D9J A;  3CVZ A;  5KAF C;  4XKV A;  5FB2 A;  4LB6 B;  1T2K A;  3LST A;  2UUZ A;  2NOG A;  2E2H A;  1EUC B;  4LH7 A;  4KIT B;  2DA6 A;  3L2V A;  2UXX A;  2Z3Y A;  4IPA A;  1YO5 C;  1D3Y A;  4V2G A;  3KPH A;  1AU7 A;  4EGY A;  4PJJ A;  1B9M A;  1N77 A;  1XTA A;  2V9K A;  1FJL A;  5KX5 F;  3UKG A;  5D5V B;  1N3F A;  4BBR G;  2JA7 A;  2MD5 A;  5K5O A;  4A2A A;  4YFX F;  3CO7 C;  4FTH A;  3G6X A;  2LRE A;  2EIM H;  4QLC U;  3GEZ A;  1LJ9 A;  2VKD A;  1KJI A;  2XD4 A;  3M1E A;  1R71 A;  3CJT B;  3GZN B;  2VBJ A;  3MKW B;  4M7E A;  1AWC A;  4I98 B;  2AXT C;  2DAO A;  3KO2 A;  1XS9 A;  5HOD A;  3N6X A;  4UFZ A;  3OUZ A;  2RAE A;  3IAS 2;  5F9L A;  1O4X A;  1D0Y A;  4IHT A;  5JUM A;  2ZB9 A;  1BIA A;  5HVQ C;  3ULQ B;  2VXD A;  1APL C;  1YFH A;  5IT9 Z;  1ZR2 A;  2FNP A;  2EB7 A;  2ZBK A;  2RRE A;  3CO6 C;  2W9B A;  4UUT A;  4MHG A;  5K5R A;  2Q2T A;  1NG6 A;  4A0Y A;  4BL0 B;  1YS7 A;  2XE0 A;  1PP7 U;  3AG1 H;  4KIF A;  2E5L H;  4BS9 A;  4WCG A;  1A31 A;  1QHH D;  3V6H A;  5FLM G;  4LFU A;  2QZ8 A;  4WXH A;  1BI1 A;  2P81 A;  5H2F C;  2FQ3 A;  3QAH A;  1K7A A;  4Y4R A;  5JVL A;  3T1H H;  3DTE A;  1TL8 A;  1YI2 I;  4XLF A;  3HBL A;  4XID A;  3JRD A;  2I8D A;  5IT9 W;  4I0B A;  2HTS A;  2L8L A;  2CS3 A;  3RFC A;  2XPU A;  3NRV A;  5FD5 A;  1J5Y A;  5HNH A;  4M9S A;  3G1L A;  1KYW A;  1S97 A;  4F93 B;  2J6T A;  5DCM A;  1I39 A;  2FOK A;  1U8B A;  3W6J B;  3GF2 A;  3FXK A;  4XN3 A;  2JPC A;  1OYY A;  5AKM A;  2DDA A;  1CQJ B;  2W6Q A;  3GV8 B;  5J2U F;  4LF7 H;  5J8F A;  4NQW B;  2HOT A;  3CQZ A;  2K27 A;  2DFH A;  4XMY A;  3MFK A;  1S0O A;  2ZNZ A;  3M8E A;  4CCM A;  4YFN F;  2COM A;  2KJB A;  1ONV A;  2ASL A;  2TCT A;  1XNR H;  4BHB A;  4PUS A;  3SEZ A;  1SAU A;  4IRH A;  2VKH A;  3BG5 A;  5FO5 A;  5LOV F;  4KNY A;  1I6X A;  3GWZ A;  2J5P A;  3RYP A;  4U7D A;  2VIX A;  1H88 C;  5AK9 A;  3WTW C;  2CV0 A;  3GIM A;  3Q8R B;  4EFJ A;  4CZC A;  5K7F A;  3QU6 A;  1LFU P;  4M74 A;  3IKT A;  4MV3 A;  3MIP A;  2AQ4 A;  5KFK A;  4QIW A;  1VQM I;  4RAG A;  2EJR A;  3WU1 B;  2LY9 A;  5A0M A;  4UVC A;  3V4G A;  2DOF A;  2E19 A;  3FBI B;  3LSM A;  2FPI B;  5DCF A;  1REP C;  3R60 A;  4DV4 H;  4QFQ A;  2C00 A;  3SEQ A;  5DLF A;  5E1Z B;  1UG2 A;  4BE1 A;  3JRC A;  4ED2 A;  2MLG A;  1HKQ A;  2FLP A;  3DLL F;  1K61 A;  3KP2 A;  4EV0 A;  1R9T J;  3OMY A;  4M6X A;  2UU9 H;  1UM2 A;  5D5X B;  4RGS A;  4XOT A;  4JI0 H;  1SD6 A;  3I5U A;  3HM5 A;  4IL6 C;  5FJ8 J;  1B24 A;  3M9O B;  3C3W A;  1XGM A;  4IOA F;  1QVT A;  4RLQ A;  1WCM A;  3JTH A;  3OSG A;  5E17 F;  3EYY A;  3MX9 A;  2A6T A;  2V79 A;  4A12 A;  2EFN A;  2Q2E A;  5F1J A;  2FK3 A;  4ZI7 F;  3V7S A;  1SAX A;  4DV3 H;  5LRS A;  2W7P A;  4XYM B;  3S2H J;  3ZMD A;  4LFB H;  3Q9S A;  3FK7 A;  2PMH A;  3TED A;  4IXA A;  5CAE B;  4IJA A;  3GVA A;  1XB4 A;  2W25 A;  5L3D A;  3H5N A;  2EH3 A;  4AAD A;  4JV1 A;  5LGN A;  2G0E A;  2HI3 A;  5L3G A;  3MD2 A;  1U0J A;  3P9K A;  3W2V A;  4CCK A;  5C44 G;  3S1R J;  2YU9 A;  4R79 A;  2E2I A;  3DCF A;  2K86 A;  4I02 A;  3BT9 A;  2R85 A;  2RGV A;  3S3M A;  1UB9 A;  5FFX A;  2X0S A;  4LMY A;  2F5D A;  4ZOL F;  5C1P A;  2K85 A;  4RUC A;  5EDW A;  1O57 A;  3G4S I;  4O3S A;  2WAD A;  3S2D J;  5IY5 H;  2W70 A;  1IZ1 A;  2L2O A;  4B3A A;  2V1D A;  5FJ8 G;  2O03 A;  1XCV A;  3KP4 A;  5LL6 b;  5DD8 A;  1WKM A;  1YS6 A;  4HPQ A;  2W8L A;  3WE3 A;  2AGP A;  1J09 A;  1DIK A;  1ZRF A;  1RJP A;  4ZYE A;  3REO A;  3DF7 A;  2ZXH A;  2R7S A;  2VC1 A;  2HR3 A;  1LVK A;  3PSF A;  2ELK A;  1OCR H;  2VT3 A;  1IRG A;  1HW5 A;  2IS1 A;  3TW6 A;  3HDD A;  3SQN A;  3GTK A;  5TJJ A;  2EV0 A;  2H1K A;  3ERE D;  1Y39 A;  3IH2 A;  4ED1 A;  3PO2 J;  1I3A A;  1AF5 A;  1T6S A;  2FK1 A;  4YP3 A;  5EG0 B;  5DGB A;  1ZG1 A;  2NU9 B;  5CPR B;  2JMZ A;  2K3P A;  1OMI A;  2YZM A;  1PUE E;  2R93 G;  2DMN A;  2V4Q A;  4Q4Z F;  3HSF A;  2EIJ H;  1E2X A;  2FU4 A;  4HSR A;  4XOP A;  1K4S A;  2DI3 A;  1RUO A;  2ME0 A;  3GTP A;  4AIJ A;  1T56 A;  4FS1 A;  1Z0X A;  3R4K A;  2F4O B;  1U6G A;  5ICE A;  2EFP A;  3H36 A;  3OYI A;  4IKF A;  1KU2 A;  2YUS A;  2CSO A;  3GFJ A;  4E70 A;  1VQN I;  4UN7 G;  1MMA A;  5KFO A;  3Q2O A;  3WTT C;  2OJE D;  4DV5 H;  2FBK A;  3OS1 A;  1V5G A;  3OV8 A;  1TNS A;  4WX9 A;  1K83 A;  1NK3 P;  2R8I A;  4BYY A;  4R7R A;  1VI0 A;  3CJR B;  4L5E A;  4LD5 A;  3PO3 J;  4DW6 A;  2C2R A;  1HF0 A;  1CQT A;  2W9C B;  3DKW A;  2EQR A;  4QPO A;  5FGM A;  5J8C A;  2PVP A;  4G6D A;  3A2K A;  3RZO J;  1X3Z B;  3PO2 G;  2ZJ2 A;  2KIQ A;  2O7M A;  2DFI A;  4QW9 A;  1B04 A;  1J2X A;  2YX4 A;  1UNN C;  1SD4 A;  3L4K A;  1N33 H;  3TDU C;  4IHX A;  1R1V A;  5F08 A;  3T5J A;  2M3A A;  5IP6 A;  4AID A;  4A6E A;  3UVF A;  3PNY A;  1EYZ A;  2Y9Z A;  1V4Y A;  1GT0 C;  2ECB A;  3I71 A;  1T39 A;  3G6E I;  3LMM A;  3NQO A;  5KAI C;  3CUQ A;  1H9T A;  2M7A A;  1ZQ7 A;  4B47 A;  2PMZ A;  5ILV A;  4XLH A;  5E63 A;  4XLE A;  2Q1Z B;  2MFZ A;  3HC7 A;  5GAD J;  1TWG J;  3MFI A;  5K5Q A;  2HOA A;  3DBH B;  3MWM A;  4MFD A;  4N4O B;  1T95 A;  3FD2 A;  1GO3 E;  1X19 A;  3BRO A;  5F0C A;  4MV8 A;  5DEQ A;  5KFQ A;  5DTD A;  2FML A;  5DS9 A;  1ETQ A;  4HBL A;  5C4J J;  1TTY A;  1GXQ A;  2ADU A;  1USS A;  2WY8 Q;  3K6G A;  4FE7 A;  4UUV A;  2GXB A;  1LEB A;  2VQE H;  2K7L A;  4IR1 A;  3AAF A;  4RGX A;  5HBR B;  3T8R A;  1MOW A;  1PX2 A;  3V8L A;  3BC8 A;  3IWZ A;  3FXU A;  3GLX A;  4X65 H;  2W24 A;  1IXS B;  2EX5 A;  2GLT A;  5KG5 A;  1F1Z A;  3DEU A;  2HDC A;  3ASN H;  3I4M J;  2WAQ A;  1U9O A;  2E35 A;  4D7N A;  1V51 A;  4J9P A;  3RF2 A;  5KFL A;  3Q5F A;  4MA5 A;  4V2F A;  5ICG A;  3DTI A;  1RIO H;  5C8Y F;  4OAZ A;  3TQT A;  2P0A A;  3NWS A;  1YTY A;  2LD5 A;  2EIL H;  2L4A A;  2I8C A;  3CCY A;  1K78 A;  3MR6 A;  3LML A;  2W4S A;  4GRI A;  1ULZ A;  4ED6 A;  5KFZ A;  2E5N A;  2LNB A;  5IPA A;  4CCJ A;  1SFX A;  1OWT A;  4RUA A;  1H9G A;  1TWA A;  1RJQ A;  4ITV A;  2QSG X;  1DGR M;  4TV8 F;  4BUP A;  5ILS A;  2YZN A;  2DDB A;  2DCE A;  1QGP A;  3NWT A;  4PSW A;  3CLO A;  4XSX F;  2OLS A;  2VON A;  1ZN2 A;  4UN9 G;  4KUM A;  3RKY A;  3K5H A;  4M72 A;  3AG3 H;  1MMD A;  1LE8 B;  3K3V A;  5HS7 A;  5K7H A;  4JOM A;  5A77 A;  1YG2 A;  2IRF G;  2PLY A;  3KHL A;  3ZMT A;  2R7X A;  1MBF A;  1X3U A;  1P4W A;  2Q0O A;  4MV4 A;  4I50 F;  2C28 A;  4DR7 H;  1BNC A;  3PNV A;  4F52 A;  5C3E G;  3ZXS A;  5KFB A;  1OCP A;  4EJT A;  1S6L A;  2VQG A;  4YR2 A;  4TQR A;  3JAM K;  2KEQ A;  4X1E A;  4D0P A;  2KKO A;  3HG9 A;  3RCO A;  2CUZ A;  3MZH A;  4CYC A;  1QA6 A;  1GPP A;  2KMU A;  3D5L A;  2M5W A;  4Z1Z A;  1HQC A;  1XDN A;  1AN7 A;  1GXP A;  1FJG H;  2JA5 G;  2RDJ A;  3PIP F;  1JDB B;  1HNZ H;  4ECS A;  3J80 Z;  4DYR A;  2H09 A;  3FXO A;  5C1O A;  2HFH A;  3VFZ A;  1HNW H;  3WO1 A;  4GC6 A;  2NU7 B;  3OYL A;  4OMZ A;  3TGN A;  1Y8R B;  2A6E F;  5LHG A;  3P9I A;  4HA8 A;  3F8M A;  3FBN B;  1UAA A;  3RTR A;  1Z3X A;  2JA8 G;  4RU9 A;  2V9V A;  4ED7 A;  4QIW N;  4EAT A;  2TRT A;  1JJ6 C;  1YJW I;  2CG4 A;  2KLO A;  2DLL A;  2ZME B;  1DQ3 A;  3HB9 A;  2H27 A;  4C2U A;  2DOD A;  4O4L F;  3DKY A;  4BDZ A;  2MC4 A;  1I7L A;  3J80 W;  4W1U A;  4LX3 A;  1KZH A;  5C4X J;  4F4Y A;  3HOX J;  2BBY A;  1FTT A;  1MSE C;  2FSW A;  5J47 A;  3S93 A;  2CGP A;  2QEN A;  3DPU A;  2DTZ A;  2LWY A;  1T33 A;  1VQO I;  1WPK A;  4H0E A;  3W6V A;  2NVQ J;  3F8C A;  4C3I J;  1VQL I;  5KG4 A;  5LP6 F;  2EIN H;  1W7P D;  4BBS J;  4EQQ A;  1XN7 A;  2DPI A;  4F4Z A;  2ATL A;  4HZF A;  1UMQ A;  2O8X A;  4FE4 A;  1JUP A;  4P1W A;  2XKO A;  2BVL A;  3EPZ A;  2VI6 A;  4LK1 F;  3J7Z I;  5D1P A;  5KFJ A;  1TLH B;  1BR1 A;  4ZC3 A;  3FKI J;  1A0I A;  4DQ2 A;  1B72 B;  1BC7 C;  1RC9 A;  3ABT A;  2HTJ A;  1G9Z A;  4AYB E;  1MH4 A;  2OV7 A;  3FKJ A;  2CJJ A;  4LF6 H;  4M3G A;  2VL8 A;  3K1P A;  1WH5 A;  4UCU A;  3GUD A;  4ECW A;  3JRG A;  3E1S A;  1U0C A;  5CVV A;  1FSE A;  2ZDH A;  2Q8K A;  2QKM B;  3ORQ A;  3ETJ A;  4GYI A;  1LWS A;  1V4R A;  2P8T A;  3TO7 A;  5ERI A;  3S2W A;  4JV0 A;  1MH3 A;  2ESH A;  1SVO A;  4U7C A;  5JVD F;  5C4X G;  3I53 A;  3BWG A;  4BEH B;  1ZK8 A;  3HOX G;  5HLT A;  4E2U A;  4ZYA A;  1YX5 A;  3CTA A;  1WJC A;  1RPW A;  1U5T A;  2LG4 A;  5GAH J;  1JE8 A;  1Q1H A;  1EUD B;  4DR5 H;  2KDZ A;  1P7I A;  1PUF A;  1K1S A;  3Q3S A;  2A68 F;  3K4L A;  1O7L A;  5DUI A;  3DPT A;  5FRO A;  4J0M A;  2LVS A;  4BBS G;  2X48 A;  5BNG A;  4UB6 C;  2X6W A;  4KHP H;  2SCU B;  2UVR A;  4IF4 A;  2QQ9 A;  2DO7 A;  4YII A;  1G2H A;  2JRT A;  3V42 A;  2W6M A;  3N40 P;  5IYD G;  2MC3 A;  2BEO A;  3L2P A;  5IYC G;  3J7A K;  2UXD H;  2R5Y A;  4RZR A;  3H0D A;  2VUG A;  3FKI G;  5A2Q W;  2OTL I;  2OQG A;  1J75 A;  1XDS A;  4EBC A;  3OWT A;  3RB4 A;  1P2F A;  3LSI A;  4A93 J;  2EFW A;  3OOL A;  1EKE A;  1W5T A;  2CQ7 A;  2DMU A;  3PQJ A;  3WTY C;  1TA8 A;  3MWD A;  2IN8 A;  5LBQ A;  2PBI A;  3LL7 A;  1R49 A;  4GKK H;  1Z6R A;  2IGO A;  5LGU A;  2VQL A;  4YIF A;  3K70 D;  4KL5 A;  4NB5 A;  3TOB A;  3E3V A;  3JRE A;  5E8G A;  1K4T A;  3OYG A;  2KP6 A;  4PFO A;  5EWG A;  2VA3 A;  1HR0 H;  5CA0 F;  1J7K A;  3H9G A;  4XX0 B;  2HQA A;  3GZ6 A;  2R93 A;  3I54 A;  4EEQ A;  5F04 A;  2D1V A;  5L9X A;  4CA0 A;  1R00 A;  4E4H A;  3GME A;  4WF2 A;  3KXY T;  3HGG A;  1J59 A;  3CJQ B;  4HNT A;  1IW7 F;  2HYF A;  1WCM J;  1V5F A;  2LTP A;  4Y52 J;  1SD5 A;  2H94 A;  4G8X A;  3ZGK A;  2F4M B;  2F4L A;  3C0F B;  5H6R A;  4QWA A;  5KFV A;  1R36 A;  3PR5 B;  4M71 A;  3EH8 A;  3FHN A;  2W00 A;  4ON0 A;  1V9P A;  2R7M A;  5KFE A;  1RK6 A;  2DBB A;  4UN7 A;  4U0V A;  1QVU A;  1FYM A;  2AB5 A;  2JEG A;  5T14 A;  4A93 G;  4II2 A;  4EGQ A;  2DA1 A;  2WC2 A;  3ROU A;  5AKF A;  2VBJ B;  1KJQ A;  3FF5 A;  3KAK A;  1ACI A;  3BP8 A;  1GVD A;  3CP2 A;  1WJF A;  2K4J A;  4A3M G;  4YJ2 F;  3WTU C;  4RAF A;  1SEU A;  4A3L G;  2V7F A;  2YZG A;  3V6J A;  2HQR A;  5D8K B;  5DQH A;  3FWE A;  2V1U A;  1WJE A;  5KFF A;  1R23 A;  5K1Y A;  1P8L A;  2W9B B;  4R8H A;  2E2I J;  4A3F J;  1GLV A;  2PMZ N;  4N0B A;  4XR6 A;  5DGA A;  3DF8 A;  1Y1W G;  4JX4 A;  2O7O A;  1VQ5 I;  3S17 J;  3X2Q H;  4Q43 A;  2V9W A;  4MV6 A;  2XE0 B;  4DYQ A;  4LG0 A;  1S8N A;  1JVA A;  2ASD A;  2UZK A;  2UUC H;  1Q1V A;  2ZO4 A;  3L4J A;  2M30 A;  1GLN A;  3B6A A;  1T8I A;  1YLF A;  1YJN I;  1BJZ A;  3HGY A;  4D5C A;  2G7H A;  2CQQ A;  1TWH A;  4OU0 A;  1SVM A;  3IGD A;  2P0W A;  4X6A J;  4O3N A;  3HSR A;  5F0F A;  1WJ5 A;  4QIW E;  5A0W A;  1JTX A;  1WWX A;  3DXJ F;  3ZCO A;  2KIF A;  4G6Q A;  1R22 A;  2XGE A;  3G6Y A;  1QHG A;  2I10 A;  2HS5 A;  3EQL F;  2MD0 A;  2WAQ N;  1I5Z A;  4UUS A;  1ETX A;  3U9S A;  2LMD A;  3IN5 A;  2E1M B;  1Y56 A;  1IDY A;  2KSW A;  1ZKG A;  2JRM A;  1HLV A;  4YBZ B;  5IOZ A;  5DCM B;  1MJA A;  5KHD A;  3OY9 A;  4V19 K;  1GHC A;  4F4W A;  4UT0 A;  4YR3 A;  3ZQL A;  1SVL A;  2M2E A;  2RVC A;  3N42 B;  5HNF A;  2FBH A;  3CUQ C;  3E0J B;  4XKC A;  3JR9 A;  4A3F G;  1ZDE A;  2QEX I;  3TO6 A;  3GTP J;  4ZQI A;  4JI4 H;  4OMY A;  1JT6 A;  2Y69 H;  3LA3 A;  3TP3 A;  5E3N A;  5LGT A;  1Z7L A;  1ZR4 A;  1OYW A;  1JKP C;  2XPW A;  1RR8 C;  2DK5 A;  5F1R A;  3JRA A;  1M5X A;  1DPU A;  3OR2 C;  2FX0 A;  4ZHQ F;  5CA1 F;  3GTM A;  1S3J A;  2OH2 A;  1K83 J;  1BIB A;  2X1C A;  4BQQ A;  5HDN A;  3N44 B;  1YW7 A;  2NUA B;  3OIP A;  2DCH X;  2HXI A;  4JUZ A;  1G3S A;  1TWG A;  1E4G T;  1WJD A;  1FTZ A;  3GTG J;  2CUJ A;  3PVX A;  1MKM A;  1TQI A;  1OIS A;  1Z7U A;  3J81 Z;  2FXA A;  2VA2 A;  3LA7 A;  4IHJ F;  3FDS A;  3QPT A;  5F64 A;  2JT1 A;  4RMN A;  4XN0 A;  1X58 A;  2YSR A;  5J40 A;  5A0M B;  3N05 A;  3OOU A;  4UN9 A;  4AAF A;  3QPS A;  2ASJ A;  1UFM A;  2VC0 A;  1B9N A;  4CCL A;  4UN8 G;  3LFK A;  2WYO A;  2YR2 A;  2F4I A;  2WB1 A;  2VBN A;  4Q48 A;  4BE0 A;  2W6P A;  1Z91 A;  1VS0 A;  3ZMS A;  1Y14 B;  3HHH A;  4KMU X;  1E4F T;  4A3J G;  4BXX J;  4ECT A;  4C9Y A;  5HLH A;  4O4H F;  4UCS A;  4DZJ A;  5HDG A;  1QNT A;  1LFP A;  3D0S A;  3IFJ A;  2ECC A;  3C2B A;  4II3 A;  2HGS A;  2VBX A;  1FBU A;  2VE8 A;  3LWF A;  2Z5U A;  4RA2 A;  3T1Y H;  1JI8 A;  3J81 W;  4BNC A;  3R6S A;  1WZ2 A;  9ANT A;  1M7J A;  3KEQ A;  4B48 A;  4L9N A;  5KG0 A;  3BR5 A;  2Q2E B;  4EVI A;  1FC3 A;  3KZI C;  3S15 J;  2JA5 A;  4EJO A;  5DYM A;  3RAX A;  3OHB A;  3SI8 A;  3MKZ A;  2YW2 A;  4A5N A;  1X1A A;  1SMT A;  3BPV A;  2Y75 A;  1BR2 A;  2FRH A;  2JMW A;  2NS0 A;  1BN5 A;  1WGX A;  4RBO A;  5D1O A;  3ZR8 X;  3R5X A;  1I50 A;  2JVG A;  4S0H B;  3A0B C;  1Y0U A;  3KZZ A;  1MBK A;  2ZXI A;  3L9F A;  1TBX A;  2M4K A;  4WBN F;  2R7N A;  4YJ3 F;  4GGG A;  4NNJ A;  4CC6 A;  1MDM A;  3ZQG A;  1T9J A;  3J81 K;  2LKP A;  4Q8F A;  2RKH A;  4WXC A;  2PN1 A;  4JK1 X;  4AYB A;  2O9L A;  4DL3 A;  4BQO A;  3TW7 A;  4N9H A;  4ETS A;  2QM3 A;  1NG7 A;  4E7J A;  2VBL B;  3E6B A;  4JI2 H;  1I7N A;  3PR4 A;  1SFU A;  2YRX A;  3O2P E;  2KIS A;  4IOC F;  4XIC A;  1S9H A;  1B8I A;  3GV5 B;  2CZG A;  2V6C A;  1NHA A;  2CRG A;  3RIR A;  4E7Z A;  4IZZ A;  5IWA H;  2CWE A;  4K2E A;  1M6V A;  3RB3 A;  3JRB A;  3QZ8 A;  4GCV A;  5LYJ F;  3N97 A;  4BJT A;  4F7Z A;  4PJN A;  3IRR A;  4RAZ A;  4IVN A;  2FJ1 A;  4I76 A;  2V58 A;  2XUB A;  1TT0 A;  1R5G A;  4XKW A;  3C0W A;  2BXZ A;  3SYT A;  1R6R A;  5LHI A;  3ELK A;  1DUX C;  5FLM J;  2M05 A;  5DM7 F;  2R7Q A;  1DGW Y;  4DOZ A;  1IBM H;  1U3E M;  5FKK A;  3UNG C;  1ON1 A;  4Y8V B;  4DYC A;  4OIO F;  4AWX B;  5LMN H;  1XD7 A;  4BXU A;  3GW2 A;  3HOZ J;  1XNQ H;  4CXF A;  2PMZ E;  2DJI A;  2M34 A;  2GLO A;  1HOM A;  2RV8 A;  3T8T A;  2ISY A;  4L9T A;  1VDE A;  3VPR A;  2DOE A;  1DU6 A;  5JVG F;  1FPQ A;  4B3T H;  1W5S A;  4ASN A;  1NH3 A;  2GA1 A;  1GVJ A;  4RNO A;  2HOE A;  5L3F A;  3FXR A;  4YHH H;  4ENM A;  5KT4 A;  4KIS A;  1I3Q A;  1TW3 A;  1BR4 A;  3GV7 B;  1G9Y A;  1B6S A;  5M5Y J;  2FP4 B;  3HYI A;  5BMZ A;  3ECH A;  5JH7 F;  4DV6 H;  3RPU D;  1ZHS A;  3GID A;  4DUY H;  1BI3 A;  2WAQ E;  4Q45 A;  1FBS A;  4N4N B;  1J5E H;  3WG9 A;  3JRI A;  2XAS A;  5KFR A;  2R7L A;  2MGQ A;  3FKI A;  2XSJ C;  2GXG A;  4XRF A;  4PSX A;  1JUM A;  4RM3 A;  1PK8 A;  3QOP A;  3ESW B;  1AHD P;  5LXT F;  4BGD A;  2AGO A;  5DG9 A;  3HOT A;  3HOZ G;  4XRM A;  4F55 A;  3GLK A;  3QPL A;  2A07 F;  4XYL B;  3K4N A;  3I0T A;  3P7N A;  1ZAR A;  4DIQ A;  1CF7 A;  3CUQ B;  5M3M J;  5EJC A;  3ABM H;  2AQE A;  2BY0 A;  2ZJT A;  3OHA A;  3MZ8 A;  4HLY A;  2JEI A;  2QGU A;  3DEW A;  3O8H A;  4JI8 H;  3H5A A;  2WV1 A;  1O3R A;  1DPR A;  1WI9 A;  2RQP A;  4HAM A;  5CLS A;  3S3O A;  2GWR A;  4J9S A;  4DUZ H;  2DK8 A;  3DP7 A;  5AKN A;  1YYV A;  2HQ5 A;  2IT0 A;  5EZH A;  4KFC A;  2H8W A;  2HXO A;  4CHU A;  2DW4 A;  2WY7 Q;  3GIK A;  5GAG J;  4ZDP A;  2PMU A;  5E8I A;  3SXY A;  3BDD A;  1I1G A;  1AKH A;  1GV2 A;  2HEO A;  1OQY A;  3GIP A;  2GM4 A;  3RV3 A;  1RYS A;  1JXL A;  4G9Y A;  4I0A A;  3PSI A;  2YPR A;  1JGS A;  1KON A;  2LY1 A;  2MYS A;  4IAJ A;  3KE2 A;  1FY7 A;  2ZKZ A;  3MVP A;  1TW2 A;  2LYC A;  4XLN F;  1BI0 A;  1BM9 A;  3A01 A;  3RPQ A;  1RKT A;  5EWE A;  2DPJ A;  1TAE A;  2DU9 A;  4RS8 A;  4Z2Y A;  3VSK A;  1K78 B;  4J9N A;  2L7M P;  1FX7 A;  2KIM A;  1HBX G;  1PDN C;  4YIS A;  2VPQ A;  2X1D A;  4QWB A;  4HLX A;  2OZ6 A;  2AS5 F;  4MTD A;  1D8J A;  2UXN A;  4MO7 A;  1L3L A;  4HRI A;  4AAE A;  3SDB A;  5C44 J;  3WOD F;  1JT0 A;  2HJW A;  2XRN A;  3F3X A;  4UV8 A;  5B5E C;  2NVU B;  5LRR A;  3PJR A;  1FZP B;  1Y1W A;  1TWC J;  2LDU A;  1UJ8 A;  4I09 A;  2OUM A;  4J9R A;  4LJZ F;  1ETW A;  4X64 H;  3IV5 A;  4L5J A;  3WTV C;  5L1J A;  2BV6 A;  2E2J J;  2L9V A;  2OBP A;  4DJA A;  1R1U A;  1WR2 A;  4BWS C;  2YX7 A;  1W5C C;  3HRS A;  4C2M J;  4X66 H;  4JV5 H;  2LF8 A;  5M3F J;  4UCT A;  1XMA A;  2Z99 A;  4A69 C;  3H3Z A;  1ZGW A;  4FHT A;  1ORK A;  1N32 H;  2GBY A;  1DV2 A;  1DV1 A;  3QYE A;  5CKT A;  4GC7 A;  1K6Y A;  2XCL A;  3S16 J;  1C3O A;  2EPF A;  3U2R A;  3OYC A;  4IRG A;  4RGU A;  4KIG A;  4CYC B;  1IN4 A;  1IF1 A;  4BKX A;  4DL7 A;  2I5U A;  1P92 A;  2QSF X;  1T36 A;  2OZU A;  1OJL A;  2R7T A;  4YY3 H;  2BQR A;  4XZ3 B;  3GX4 X;  1OPC A;  2HKO A;  2R93 J;  1WJA A;  1ETY A;  4G12 A;  5E1X A;  4BJ6 C;  5F0H A;  3UQ8 A;  4MQV A;  4HQ6 A;  1BJT A;  1JHH A;  1MGT A;  3BTC A;  1SMY F;  4OIP F;  4YFK F;  1T94 A;  3Q0W A;  2F6C A;  2VBO A;  2YS9 A;  1IN5 A;  1Y6I A;  4BAC A;  2CV1 A;  2JWT A;  2ZCW A;  3TO9 A;  1KU3 A;  2ZXJ A;  2IP4 A;  4QW8 A;  3V6K A;  1VQK I;  3KYL A;  4IHW A;  2BY2 A;  5DM6 F;  4A3I J;  4JI5 H;  2XV4 S;  1Z3Y A;  1B33 N;  2F48 A;  2IJL A;  2R8J A;  4U88 A;  2WB1 N;  3MJF A;  2QWW A;  2VQF H;  2WBM A;  3E54 A;  4IX7 A;  4EBE A;  4BH9 A;  4EEY A;  4YAK B;  1ZET A;  1FIP A;  2Z1D A;  4AVZ A;  3S1M J;  5M5W J;  3W3C A;  3L2Q A;  3TII A;  2ZME C;  3M9A A;  3L2R A;  1FOW A;  2MH2 A;  3C7J A;  2CV2 A;  1S03 G;  3W6K B;  1JGG A;  3DV8 A;  2MA3 A;  4WK8 F;  3DBL B;  4UN8 A;  1OR7 A;  4KT6 A;  1X4O A;  3DWL E;  5L3C A;  2LF7 A;  3OSF A;  1BGW A;  2UXB H;  1YRN A;  1MMN A;  1UST A;  2Y2Z A;  1N75 A;  4PZJ A;  3LSK A;  4E7L A;  5JI6 A;  1FEX A;  4FBT A;  2M0M A;  4HF0 A;  4A2U A;  4IQJ A;  2C35 B;  2M45 A;  3BAB A;  1TWH J;  2VR1 A;  3BLY A;  4D6O A;  1T0F A;  1XMX A;  5KG6 A;  1LVA A;  3H5R A;  4DR3 H;  1MJB A;  3RGX A;  1W0T A;  3VPC A;  4A3I G;  3F6O A;  3GYH X;  3E6C C;  1M0T A;  1HW1 A;  2K3F A;  2JJ7 A;  2M87 A;  4B3X A;  3CME I;  2F5F A;  3U9G A;  3M9M B;  5FLV A;  2FD5 A;  2C2D A;  2IVM A;  4ESF A;  1TQP A;  3GTG A;  5F6F A;  4AYB N;  1MMS A;  1LDJ A;  2YS7 A;  5D5U B;  1IJW C;  1N78 A;  4IRC A;  3A1Y A;  1U5T B;  3JRW A;  1Z6T A;  1XPX A;  3MQ0 A;  2KRH A;  4DGW B;  3G1M A;  2R7V A;  4LSX A;  1LEA A;  1J0R A;  5J1Y A;  5KKN B;  2IGM A;  1PUF B;  5FPR A;  2W84 A;  3DU6 A;  1CQI B;  1LWT A;  3D5R C;  1AUV A;  1V55 H;  3BR1 A;  1YIO A;  1ZHQ A;  4QWE A;  4R8U A;  3J7A O;  5CVI A;  3QOE A;  1KBL A;  1M1E B;  4OX9 H;  1KQ9 A;  2FJZ A;  1VAJ A;  3R5F A;  2EK5 A;  1OKR A;  1UHM A;  2X1E A;  2R5Y B;  3GTM J;  2DOA A;  4KIC A;  2V26 A;  5CVR A;  3WE2 A;  2VUM J;  1WI3 A;  3R23 A;  2B63 J;  2HZT A;  2Y0S A;  3HUG A;  5A74 A;  2CU7 A;  3QFF A;  4WD3 A;  1JIH A;  5KG2 A;  3H3V H;  2AQF A;  1LPQ A;  1JTY A;  1P6R A;  4AM3 A;  2K4B A;  2UVU A;  1Z67 A;  3EUA A;  1K79 A;  4EFE A;  4RM2 A;  2Z2S B;  1DFA A;  2BQU A;  4DR6 H;  1HDD C;  3F72 A;  4U0Y A;  3CP8 A;  4HEA 2;  5H20 A;  4DR4 H;  3BQY A;  1ZGA A;  1RZ4 A;  3JAM Z;  3H92 A;  4O3M A;  4UCO A;  1VQ4 I;  2P4W A;  4MA0 A;  2IS6 A;  4LFC H;  4J9Q A;  1KQ0 A;  1A04 A;  3HRM A;  1CGP A;  4YAJ B;  2FEZ A;  3HYJ A;  1AUX A;  4ME6 A;  1W7P A;  2K9L A;  3LP8 A;  1KQ8 A;  5C3E J;  2KT0 A;  2L02 A;  3ERM A;  3FMS A;  4KIB A;  3M7G A;  1F43 A;  2V1N A;  1ETV A;  4FIS A;  5EZG A;  1S0N A;  4S04 A;  1IC8 A;  2STW A;  1ETK A;  3S14 J;  5BPD A;  4MFE A;  3GTL J;  2DQL A;  5D6F A;  2C6Y A;  2VUM G;  1VQP I;  4E7S A;  2LKX A;  2JA5 J;  1ZLJ A;  3H35 A;  2B63 G;  3WHB A;  2NU6 B;  5JHU A;  5E3O A;  3MXA A;  2QQA A;  3GCM A;  3JAM W;  3KLO A;  4UXN A;  4XRS G;  2CKZ B;  4DL2 A;  3KFW X;  1YHQ I;  5H80 A;  2HDD A;  2V4R A;  1JHF A;  3L7W A;  3RQ4 A;  4BU2 A;  4ECQ A;  3ZMU A;  4O1S A;  3EUH A;  4AAG A;  1I50 J;  2P5L C;  2PJR A;  1BL0 A;  1FSH A;  3GTJ J;  5KFP A;  3PFI A;  3EPG A;  1DQU A;  2JA8 J;  5GPA A;  4M3D A;  5CQG A;  4CSW A;  2JZY A;  5DD4 A;  2RDP A;  2XPV A;  1XCB A;  2FF4 A;  1G8X A;  1QBJ A;  2OWO A;  1IRX A;  4LGW A;  4QSH A;  3OYF A;  4I55 F;  3EUK L;  5DV5 A;  2VQD A;  4U6P A;  3IHU A;  3CZ6 A;  4MEY F;  4LG0 B;  3J7A Y;  2QLZ A;  3K2Z A;  3VPD A;  4ZYG A;  3Q8P B;  3HOW G;  5HS9 A;  3AYH B;  3QYF A;  2VJ4 A;  3I3L A;  3BJ6 A;  3Q8S B;  2X0L A;  2HYG D;  1U8R A;  3FIS A;  1BW6 A;  4M3B A;  5J3L A;  3E5N A;  3KZY A;  1S29 A;  3ISP A;  2HOS A;  4DL6 A;  1MBJ A;  2W8K A;  4YB8 B;  3PIO F;  4LF4 H;  5E20 A;  2PQ8 A;  3LAP A;  2IS4 A;  2QYZ A;  4UUS B;  3E6D A;  2XGX A;  3BTI A;  3AFH A;  5D5W B;  1RUN A;  2HPI A;  4BQN A;  1P4X A;  3KP3 A;  1BOA A;  2WB1 E;  3V8J A;  1GSO A;  1SD7 A;  5BOX A;  1S0M A;  3RKX A;  1HXD A;  3CDL A;  3HEF A;  4AQY H;  2FA5 A;  3ZRG A;  2D2W A;  2K9Q A;  2LK2 A;  3L09 A;  1W36 D;  1FYK A;  5A72 A;  1O3T A;  1VBH A;  2OTJ I;  1MND A;  3K0L A;  4CGZ A;  2E1M C;  5HLG A;  1HSJ A;  1QO0 D;  2ZXW H;  1H89 C;  4M3E A;  4I7H A;  2Z16 A;  1L0O C;  2DA2 A;  4EM0 B;  2VQC A;  2E7X A;  3QP5 A;  3M3Y J;  3T5X A;  3LSP A;  5LEK A;  4AIH A;  4L1K A;  2CUE A;  3MR5 A;  3CCM I;  1I3Q J;  3QP6 A;  3SHF A;  2A05 A;  4IZO A;  2ID6 A;  2L5Q A;  1QZE A;  3TP0 A;  3K9T A;  2R5Z A;  2DQR A;  2DTR A;  2QVO A;  1FMV A;  1SEI A;  2IA2 A;  1W4M A;  1XSV A;  2L9R A;  3MCZ A;  4FX0 A;  3WGI A;  1D5V A;  4NC8 A;  4DL5 A;  5F27 A;  3JSO A;  2DA7 A;  4O6J A;  1P7J A;  2Y31 A;  2IXS A;  5IYD J;  4RB3 C;  3PW7 A;  2PX9 A;  2DJN A;  5IYC J;  3K1N A;  1RJR A;  4YQW A;  3AG4 H;  4R1H A;  1RRJ A;  1D1C A;  1E3H A;  2DFF A;  2VBN B;  2QCO A;  3AL0 B;  3IG0 A;  3RTX A;  5KT7 A;  2XF6 A; 
#chains in the Genus database with same CATH homology
 4BDY A;  1VZ0 A;  2L8L A;  2CS3 A;  2X1C A;  4BQQ A;  3N44 B;  4FAS D;  4JI7 H;  5FD5 A;  3OIP A;  2IN9 A;  2DCH X;  5HNH A;  3IAM 2;  4F93 B;  1HA8 A;  1E4G T;  4XKB A;  1WJD A;  2CUJ A;  2K9M A;  2WAF A;  4XN3 A;  5AKM A;  2X6X A;  1PYV A;  1X1C A;  2XF5 A;  4LF7 H;  4RMN A;  4NQW B;  4XN0 A;  4CCN A;  5A0M B;  4UN9 A;  3N05 A;  3OOU A;  4AAF A;  4XMY A;  2JSP A;  1P9Q C;  2ELJ A;  3UR3 C;  3C2H A;  4CCM A;  4CCL A;  4UN8 G;  2WYO A;  4UNC A;  4YEL A;  2F4I A;  5D1O B;  2WB1 A;  2VBN A;  1XNR H;  4BE0 A;  1VS0 A;  4PUS A;  3SEZ A;  3OYA A;  1SAU A;  2VKH A;  1E4F T;  3DLA A;  5AK9 A;  2VIX A;  4C9Y A;  1WH2 A;  3PUB A;  1X9N A;  2CV0 A;  4UCS A;  3IFJ A;  4EFJ A;  1LFP A;  2BOL A;  4CZC A;  3C0X A;  3M1C A;  4II3 A;  2HGS A;  4RZQ A;  1BOB A;  4LF8 H;  4DV7 H;  3T1Y H;  1JI8 A;  3S3N A;  3J81 W;  2A5W A;  4B3S H;  3MIP A;  2E60 A;  4B48 A;  4OZ6 A;  2R7R A;  1AA7 A;  1FKA H;  1Z2O X;  2Q2E B;  2W1O A;  3MXB B;  5A0M A;  2F4V H;  4XQF A;  3MKZ A;  3FBI B;  1X1A A;  3LSM A;  4Y3O A;  4DV4 H;  5I0A A;  1X4P A;  4E2T A;  1BR2 A;  3SEQ A;  5D1O A;  1TZL A;  3ZR8 X;  4RB1 A;  2IN0 A;  2JVG A;  1D1A A;  1G59 A;  5LD2 C;  3OMY A;  4B43 A;  3OTO H;  1IBL H;  2ZXI A;  3VDX A;  1UM2 A;  4YIT A;  2M4K A;  5BR8 H;  4XOT A;  1O75 A;  3H9Q A;  3L2U A;  1LDK B;  1B24 A;  4JI0 H;  2VJ5 A;  4NNJ A;  4CC6 A;  1T9J A;  4RLQ A;  4U87 A;  4J00 A;  4RLF A;  2HZD A;  3MX9 A;  4AYB A;  3EYY A;  2A6T A;  3OYB A;  4BQO A;  3PL8 A;  4ETS A;  4YEJ A;  3MXB A;  4DV3 H;  1NG7 A;  2R4G A;  4E7J A;  2X51 A;  4YHX A;  2VBL B;  4JI2 H;  4LFB H;  2HVS A;  1S9H A;  4C30 A;  2O5R A;  1N3E A;  4IZZ A;  4E7Z A;  5IWA H;  4C2T A;  2DT7 B;  3H5N A;  4BJT A;  4PJN A;  4AAD A;  2KHM A;  4RAZ A;  3PN1 A;  2LCJ A;  3MD2 A;  1U0J A;  3W2V A;  1TT0 A;  4FET A;  4CCK A;  3BAA A;  4XKW A;  3C0W A;  2DT6 A;  4R79 A;  3K4M A;  2HU9 A;  3SYT A;  1R6R A;  3D5S C;  4HNU A;  3S3M A;  2RGV A;  4LMY A;  3BCA A;  2WAD A;  1DGW Y;  2R7Q A;  4DOZ A;  1IBM H;  2L2O A;  3PNT A;  3G2B A;  1N36 H;  2IGN A;  3UNG C;  2O03 A;  4UNA A;  5LL6 b;  2ZFU A;  4HPQ A;  4O1R A;  4DBR A;  5LMN H;  1J09 A;  1X1B A;  1M0W A;  2UUB H;  3KAL A;  1XNQ H;  2DJI A;  4PJM A;  4LIV A;  1EF0 A;  5E67 A;  5KCM A;  3DF7 A;  2ZXH A;  3K4J A;  2R7S A;  1VDE A;  4XON A;  3MIS A;  3FMA A;  4DR1 H;  1LVK A;  2VAS A;  4B3T H;  3PSF A;  2W57 A;  1I6U A;  2IS1 A;  3DQV C;  2ZM6 H;  3KAJ A;  4YHH H;  2WE6 A;  4KIS A;  4XL9 A;  1BR4 A;  4LF5 H;  3OYK A;  4P5O A;  1G9Y A;  1AF5 A;  3DU5 A;  2HVQ A;  3HYI A;  4DV6 H;  5CPR B;  2JMZ A;  2K3P A;  2RGR A;  2W7N A;  3RPU D;  2F5V A;  1R7M A;  1ZHS A;  4B3M H;  2LC2 A;  2LBF B;  4E6K G;  4DUY H;  1X1D A;  2VJJ A;  4HSR A;  4N4N B;  4XOP A;  3VYT B;  2R7U A;  3RIZ A;  1J5E H;  3AKZ A;  1BP7 A;  3OYE A;  2CW7 A;  3H9J A;  4LOX A;  2CMP A;  3OYI A;  4IKF A;  2XSJ C;  4XM3 A;  4PSX A;  1PJR A;  4RM3 A;  2V6E A;  5A78 A;  3MMY B;  4BGD A;  3HOT A;  4UN7 G;  2XIG A;  3BA8 A;  4DBQ A;  1MMA A;  4DV5 H;  3OS1 A;  4F55 A;  3K4B A;  3OOR A;  1T9I A;  1V5G A;  2L7K A;  2X6Y A;  4PDB A;  3K4N A;  4JI6 H;  4DIQ A;  4GIG A;  4R7R A;  2UUA H;  4NUB A;  3CJR B;  4UCR A;  1DP3 A;  2ZJT A;  2AQE A;  2LH9 A;  4E7K A;  2IS2 A;  1P8K Z;  3HXL A;  4E7H A;  3IP4 B;  2LBF A;  4QPO A;  4JI8 H;  3H5A A;  3VWB A;  2UWM A;  4XOR A;  3A2K A;  4BJ5 C;  3S3O A;  4DUZ H;  2O7M A;  4HG2 A;  1MI8 A;  1V5E A;  1B04 A;  4PFP A;  5TGT A;  2JVH A;  5AKN A;  3L4K A;  1N33 H;  1DGS A;  2M3A A;  5HOO A;  4LIT A;  3K10 A;  4RB2 C;  2WY7 Q;  4G6T B;  3UVF A;  5LMU H;  3PNY A;  4ZDP A;  3L2W A;  4CUG A;  2L9N A;  4ANJ A;  4IQ4 A;  3OYM A;  3DTK A;  3LMM A;  3OL3 A;  4B3R H;  4Z20 A;  4F3Q A;  2ZSH B;  3PSI A;  2M7A A;  4B47 A;  1KON A;  2LY1 A;  2PMZ A;  4XLH A;  4XLE A;  2Q1Z B;  2MFZ A;  2MYS A;  3HC7 A;  5E63 A;  1Z2P X;  4IAJ A;  3MWM A;  3FD2 A;  2LYC A;  4N4O B;  1T95 A;  1X19 A;  2VLA A;  1TAE A;  3VSK A;  2IMZ A;  4PK4 A;  2RNG A;  2WY8 Q;  1YX3 A;  3K6G A;  3S32 A;  2X1D A;  3TL4 X;  2DXI A;  4KL6 A;  4YIS A;  2VQE H;  4GKJ H;  4MTD A;  4KJZ A;  4HRI A;  3RSN A;  3SDB A;  4UNB A;  4AAE A;  1MOW A;  4RAY A;  2LY2 A;  3M4I A;  3BC8 A;  2UU9 H;  4X65 H;  3PJR A;  1D0X A;  3TMO A;  2EX5 A;  3JSL A;  2OUM A;  2WAQ A;  5E5S A;  4X64 H;  4LFA H;  2YCH A;  3RF2 A;  3ONQ A;  4LG3 A;  4DJA A;  3NZM A;  3DTI A;  4BWS C;  5CQE A;  3LSG A;  4OAZ A;  4JI1 H;  4JV5 H;  3NWS A;  4X66 H;  3N41 B;  5K08 A;  4F91 B;  4UCT A;  4XLA A;  3LML A;  2W4S A;  4GRI A;  2VBO B;  5FD6 A;  4DR5 H;  1OLT A;  2CW8 A;  2E5N A;  5KNL A;  5FLX W;  3VYS B;  2VPL A;  4CCJ A;  2VPS A;  3RJ0 A;  1N32 H;  3QYE A;  5CKT A;  1K6Y A;  4ITV A;  1DGR M;  1EA3 A;  4BUP A;  2DCE A;  3OYC A;  3K70 C;  1ERD A;  2CFO A;  3NWT A;  2WDT A;  3W2A A;  3CF2 A;  4PSW A;  4HST A;  4UN9 G;  1OR7 C;  4DR2 H;  4LIU A;  1D0Z A;  1MMD A;  2R7T A;  4YY3 H;  3K3V A;  4A2B A;  1FVI A;  3VYR B;  2KPM A;  4JOM A;  1WJA A;  5A77 A;  4BJ6 C;  2R7X A;  3JSN A;  3UQ8 A;  2HNH A;  2UV1 A;  1BJT A;  4MV7 A;  3PFY A;  4DR7 H;  1T0F C;  3HPH A;  4BXF A;  3I9V 2;  3PNV A;  2F6C A;  4F52 A;  3ZXS A;  2R7W A;  2VBO A;  4GLX A;  3S8P A;  1I94 H;  1Y6I A;  4BAC A;  3OIQ A;  2CV1 A;  2WAE A;  2VQG A;  2KRC A;  3OR1 C;  2KEQ A;  3OYD A;  3KYL A;  3HG9 A;  2GOX B;  3RCO A;  4JI5 H;  2CUZ A;  1Z3Y A;  1GPP A;  3K4K A;  1XDN A;  2KMU A;  3D5L A;  2VJI A;  4Z1Z A;  3CES A;  1AN7 A;  2VOB A;  1FJG H;  2XF7 A;  1HNZ H;  2VQF H;  2WBM A;  5FRM A;  4IX7 A;  2R7O A;  2JNQ A;  3E54 A;  2I3Q A;  2Z1D A;  4AVZ A;  2FLD A;  2RQQ A;  3W3C A;  3L2Q A;  3R7P A;  4LH6 A;  4ZTF A;  1HNW H;  3DPL C;  2HPM A;  3L2R A;  1UEL B;  3K4C A;  3OYL A;  4DV1 H;  3HPG A;  4D1Q A;  2CV2 A;  4ZDO A;  2HHH H;  1S03 G;  1XMO H;  3LSH A;  3QQY A;  1UAA A;  3FBN B;  3RTR A;  1YE9 A;  1Z3X A;  4UN8 A;  4KT6 A;  1X4O A;  3DWL E;  3A4C A;  4EAT A;  1BGW A;  2UXB H;  3DKX A;  1MMN A;  1N75 A;  4X0G A;  3LSK A;  4E7L A;  4MTE A;  5FRN A;  2KLO A;  2M0M A;  2LOO A;  2ZSI B;  1W36 C;  4IQJ A;  4C2U A;  1DQ3 A;  2NOJ B;  1U0D A;  3BAB A;  4LSA A;  3DKY A;  3BLY A;  4CCO A;  4BDZ A;  1MZB A;  2QKL B;  3TBI A;  2MC4 A;  4JQF A;  4D6O A;  4XLC A;  4H4K C;  3U21 A;  3J80 W;  3H5R A;  4OAY A;  4DR3 H;  3BG7 A;  3RGX A;  5LFA A;  3MKY B;  1M0T A;  2M7B A;  4OWR B;  3OS0 A;  4B3X A;  2I3P A;  3S93 A;  3IUO A;  3DPU A;  4AAB A;  2LWY A;  4DV2 H;  4D6N A;  4BE1 A;  3ZQQ A;  4CH7 A;  3HUG B;  2E5Z A;  4Z1X A;  4XNF A;  4PJL A;  2MAB A;  1N78 A;  4JI3 H;  3A1Y A;  4P1W A;  4Y33 A;  3EPZ A;  2BVL A;  2KRH A;  4DGW B;  2R7V A;  5D1P A;  4LSX A;  1BR1 A;  1Z21 A;  2IGM A;  4ZC3 A;  4E7I A;  1AM2 A;  4MLO A;  5FPR A;  3DU6 A;  1A0I A;  4K0K H;  2GOM A;  1LWT A;  3D5R C;  1G9Z A;  2OV7 A;  3DEE A;  3FKJ A;  4LF6 H;  4ZDL A;  2HDW A;  1ZHQ A;  2VL8 A;  2L9S A;  3QOE A;  4OX9 H;  4UCU A;  3E1S A;  1U0C A;  1E0E A;  2QKM B;  1N34 H;  2X1E A;  1LWS A;  2XAU A;  2DOA A;  4NXM H;  1MMG A;  2V26 A;  4BE2 A;  4Q0Y A;  2Y0S A;  3OS2 A;  4ZTJ A;  5A74 A;  1XMQ H;  1UG0 A;  2AQF A;  4BEH B;  3EUH C;  5HLT A;  4U7B A;  4E2U A;  4ZYA A;  1QU3 A;  1YX5 A;  3EUA A;  1WJC A;  4EFE A;  2LG4 A;  2Z2S B;  3BCB A;  4RM2 A;  1DFA A;  4DR6 H;  2HVR A;  3CP8 A;  1MNE A;  3F9K A;  1IBK H;  4HEA 2;  4J0M A;  2M4G A;  3K4L A;  4B44 A;  3DPT A;  5FRO A;  4EFB A;  4DR4 H;  5JHF A;  1D1B A;  4UCV A;  3W2W A;  2X6W A;  4YRV A;  3OYN A;  1AT0 A;  2MCT A;  3HKZ A;  3N43 B;  4UCO A;  4X62 H;  4JYA H;  4KHP H;  4LFC H;  2IS6 A;  2FUG 2;  3N40 P;  3V42 A;  3HYJ A;  3C2G A;  3L2P A;  2PJR B;  3J7A K;  3H0D A;  4J01 A;  2LQM A;  2VUG A;  2K9L A;  1ZD7 A;  1SFK A;  5A2Q W;  2BVM A;  4AQU A;  2WA0 A;  3OWT A;  1FMW A;  2VB6 A;  3LSI A;  2XC7 A;  3OOL A;  2V1N A;  4BEH A;  2W82 A;  4DV0 H;  4LF9 H;  5E5O A;  1TA8 A;  2K5C A;  4AU7 A;  2IN8 A;  3BA9 A;  4AQX A;  3LL7 A;  3QYB A;  4E7S A;  5FPO A;  3H35 A;  2IGO A;  3QOD A;  1MW7 A;  2VQL A;  3K70 D;  4KL5 A;  3MXA A;  3KX2 A;  2LRD A;  3OYG A;  3FDY A;  1SYX B;  3JAM W;  4CC5 A;  2KP6 A;  4PFO A;  3F8N A;  1S68 A;  4BU2 A;  3RQ4 A;  1HR0 H;  2KL4 A;  4O1S A;  4AAG A;  3H9G A;  2PJR A;  2KDO A;  2HQA A;  1GYF A;  1DQU A;  4MV9 A;  4EEQ A;  4NC7 A;  1WJB A;  1ZEL A;  4CA0 A;  4E4H A;  5CQG A;  4CSW A;  2OC6 A;  3RGZ A;  2CH0 A;  3KXY T;  2QOJ Z;  4NXN H;  1G8X A;  1WFX A;  3CJQ B;  2JUG A;  4HNT A;  2OWO A;  5EOY A;  1V5F A;  4GKK H;  2UXD H;  1IRX A;  3ZGK A;  3OYF A;  4LQ0 A;  3C0F B;  4FM9 A;  3EUK L;  1HNX H;  3CZ6 A;  3J7A Y;  3FHN A;  2W00 A;  2VS7 A;  4F92 B;  3EH8 A;  1V9P A;  4UN7 A;  2UUC H;  3GBG A;  3OYH A;  2AB5 A;  4II2 A;  3QYF A;  4QPQ A;  2JA2 A;  2BW3 B;  2X85 A;  3VYU B;  5AKF A;  2VBJ B;  2VJ4 A;  3KAK A;  3I3L A;  3HOS A;  4D9J A;  3CVZ A;  3CP2 A;  1WJF A;  2VS8 A;  4XKV A;  3BG6 A;  2UUZ A;  4LH7 A;  2V7F A;  4KIT B;  3L2V A;  2Q2U A;  3KEY A;  4LF4 H;  2IS4 A;  1WJE A;  2UXC H;  1P8L A;  3AFH A;  2HPI A;  2VQH A;  4PJJ A;  4XR6 A;  4BQN A;  1N77 A;  2V9K A;  1N3F A;  2V4J C;  2XE0 B;  2VBL A;  4A2A A;  4AQY H;  1LKX A;  1JVA A;  2LRE A;  3ZRG A;  3OYJ A;  2VKD A;  5A72 A;  1W36 D;  2BW3 A;  3L4J A;  2VBJ A;  1GLN A;  1MND A;  3MKW B;  3VSL A;  2E1M C;  4M7E A;  3H20 A;  4I7H A;  2Z16 A;  3IGD A;  3KO2 A;  2P0W A;  3N6X A;  4UFZ A;  2VQC A;  2VXZ A;  3IAS 2;  1WJ5 A;  1D0Y A;  3SZG A;  5A0W A;  3CMM A;  1Z2N X;  5HVQ C;  3ZCO A;  2VXD A;  4ZJZ A;  3HL2 A;  1QHG A;  2MD0 A;  2RRE A;  3M8J A;  2L5Q A;  2Q2T A;  1NG6 A;  2E1M B;  1Y56 A;  2KSW A;  4BL0 B;  2KQR A;  1FMV A;  2XE0 A;  2KZV A;  3AL0 C;  1SEI A;  5KHD A;  3OY9 A;  2E5L H;  4BS9 A;  4APM A;  4UT0 A;  2IGK A;  3LFU A;  3N42 B;  1QHH D;  4NC8 A;  5HNF A;  4XKC A;  3E0J B;  1L2Z A;  1ZDE A;  2IXS A;  4JI4 H;  4RB0 A;  4RB3 C;  3OL4 A;  2FE3 A;  1Z7L A;  3T1H H;  4Y4R A;  3DTE A;  1D1C A;  2VBN B;  3IG0 A;  3AL0 B;  4XLF A;  3RTX A;  2I8D A;  2XDV A;  5IT9 W;  1M5X A;  3OR2 C;  2XF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...