2CW8A

Crystal structure of intein homing endonuclease ii
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
537
structure length
537
Chain Sequence
b'SILPEEWLPVLEEGEVHFVRIGELIDRMMEENAGKVKREGETEVLEVSGLEVPSFNRRTNKAELKRVKALIRHDYSGKVYTIRLKSGRRIKITSGHSLFSVRNGELVEVTGDELKPGDLVAVPRRLELPERNHVLNLVELLLGTPEEETLDIVMTIPVKGKKNFFKGMLRTLRWIFGEEKRPRTARRYLRHLEDLGYVRLKKIGYEVLDWDSLKNYRRLYEALVENVRYNGNKREYLVEFNSIRDAVGIMPLKELKEWKIGTLNGFRMRKLIEVDESLAKLLGYYVSEGYARKQRNPKNGWSYSVKLYNEDPEVLDDMERLASRFFGKVRRGRNYVEIPKKIGYLLFENMCGVLAENKRIPEFVFTSPKGVRLAFLEGYFIGDGDVHPNKRLRLSTKSELLANQLVLLLNSVGVSAVKLGHDSGVYRVYINEELPFVKLDKKKNAYYSHVIPKEVLSEVFGKVFQKNVSPQTFRKMVEDGRLDPEKAQRLSWLIEGDVVLDRVESVDVEDYDGYVYDLSVEDNENFLVGFGLVYAHN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endonuclease PI-PkoII
publication title Crystal structure of intein homing endonuclease II encoded in DNA polymerase gene from hyperthermophilic archaeon Thermococcus kodakaraensis strain KOD1
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 153
structure length 537
sequence length 537
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2005-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14528 LAGLIDADG_3 LAGLIDADG-like domain
A PF14890 Intein_splicing Intein splicing domain
A PF18714 PI-TkoII_IV DNA polymerase II intein Domain IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1010 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2cw8A02
2.170.16.10 Mainly Beta Beta Complex Endonuclease - Pi-scei; Chain A, domain 1 Hedgehog/Intein (Hint) domain 2cw8A01
3.10.28.10 Alpha Beta Roll Endonuclease I-creI Homing endonucleases 2cw8A03
3.30.1490.210 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2cw8A04
4EFJA 4O1RA 1AT0A 4E2UA 4LQ0A 4UN7G 5A78A 5A72A 3EH8A 5AKFA 1B24A 2LQMA 2QOJZ 4AQXA 4YHXA 2IN8A 4KL6A 1N3FA 2I3QA 4UN7A 4AAFA 2LWYA 4Z1XA 1DQ3A 2DCHX 4UN9G 2O7MA 2LCJA 3C0WA 2VBLB 2VBLA 2XE0A 1EF0A 1AF5A 2L8LA 2IMZA 4UN9A 3IGDA 1UM2A 1U0DA 4UNCA 1LWTA 2AB5A 3OOLA 4AQUA 3KO2A 4AAEA 4AABA 4UNBA 2VBOB 2VBOA 5K08A 4OZ6A 3NZMA 4AADA 1T9IA 3C0XA 1LWSA 2KEQA 4O1SA 3MIPA 2VBJA 4Z20A 1MOWA 1BP7A 1ZDEA 1U0CA 1G9ZA 3HYIA 2XE0B 5E5OA 5E67A 3UVFA 2VBNB 2VBNA 5A0WA 4D6OA 1P8KZ 2JMZA 4Z1ZA 2IN9A 1GPPA 5A0MB 5AKNA 4UNAA 5A0MA 4LOXA 3HYJA 2CW8A 4YITA 2VBJB 5A77A 2I3PA 1ZD7A 1N3EA 1MI8A 1G9YA 3MXBA 5E63A 3MXAA 4AAGA 3R7PA 2VS8A 3OORA 5AK9A 3MISA 1DFAA 2CW7A 3QQYA 2IN0A 3E54A 1AM2A 5A74A 1JVAA 4KL5A 5I0AA 4UT0A 1T9JA 4UN8G 2JNQA 3IFJA 2VS7A 1VDEA 4D6NA 2EX5A 4E2TA 4GIGA 4UN8A 5AKMA 3MX9A 4YISA 1R7MA 1M5XA 3MXBB 3FD2A 5E5SA 2FLDA
chains in the Genus database with same CATH superfamily
2AQFA 2EFNA 2ELHA 2CFXA 4RDUA 3Q1KA 4ED1A 3W2AA 3V7CA 3M9NB 1T0FA 3I59B 3S16J 2RKHA 3JTGA 2YU3A 3H1CA 5E17F 6PAXA 4JX4A 1FEXA 5IYCJ 1UC8A 2CW0F 3T5XA 3KLNA 5FLXK 1JXLA 1XTAA 2V1XA 4ECRA 4I0AA 1HW2A 2V58A 1IUYA 1IUFA 4FE7A 1VQOI 2XRLA 2H8RA 4JX6A 4MIMA 1M0TA 4DIQA 3BROA 4BQOA 3KEQA 5JVLA 4EJOA 2OF7A 1T98A 2XGXA 1B9NA 3ETJA 2H6BA 5K2MA 2DA7A 3H0GG 2VBYA 1P2FA 3J80K 3L1PA 3L2WA 2NNYA 4BWSC 5K7ZA 1BNCA 4Y33A 1NG6A 4DYRA 4BY7J 4RNNA 1XMXA 2VBOB 2BQ3A 2D45A 4UCTA 1X3UA 3H3VH 4N9HA 4FCYA 3TO7A 4S0HB 1NK3P 1XC5A 4I50F 5LP6F 5CVJA 2YS9A 2W8KA 3FKJA 4YIRX 2RNJA 2IRFG 4EEQA 3KLOA 3LMLA 4Q8FA 4UNOA 4DR3H 2VUMJ 1B72A 2X1CA 1U0CA 2M0MA 5B5EC 3GIDA 1RK5A 2V9VA 4LFUA 4LGWA 3H9QA 4J19A 1SMYF 3SEZA 1ZRCA 5KFGA 2ZXIA 5E67A 1W7PA 2JVHA 4ZOLF 1L2ZA 3GFMA 1BBYA 2D5VA 5IT9K 3HOYG 2LFBA 4X0GA 1JJ8C 5BPFA 4BXXJ 1T2KA 1AWCA 2JK3A 4YAJB 4I6ZA 5GADJ 2Y30A 2ESNA 3RKXA 4IOAF 1CQTA 1BI0A 2DW4A 4B8XA 2UWMA 2WTFA 1EV7A 1KYZA 2GA1A 2V1DA 5HBRB 3Q9VA 2R7NA 1FP1D 2Q2TA 5D5VB 1U9NA 1VQ7I 4R8UA 3HRMA 4LX3A 1AN7A 4TUYF 2BQUA 2OTJI 1B72B 2MD0A 5KFNA 2V4QA 4ZYAA 1VQ6I 3GV8B 3OYFA 5EWEA 2QKLB 3ASOH 3ERMA 4AAGA 3DBLB 1TWAJ 5AK9A 4PGHA 3SI8A 2UVRA 1WCMA 1W7PB 4EBCA 2RN7A 1JJ6C 5KFPA 1ETQA 2DMQA 3OV8A 4OU0A 4BJ6C 4GXOA 4A12A 3ORRA 2QSFX 1QGPA 1KC7A 3BG3A 1LQ1A 3V6JA 3TBIA 2M87A 3BPVA 5KFVA 4XM3A 2YX7A 4LLGF 4O3QA 1D8KA 2NS8A 3TO6A 4C2MJ 2FLLA 2NUAB 3ZP5A 3OYKA 1SAUA 1VDEA 1OCTC 5F1RA 1VQ9I 3MFIA 3MKYB 1BA5A 1T36A 5HS7A 1GT0C 4QW9A 1PP7U 3TW7A 4NXMH 2MLGA 3TOAA 4QSHA 2A68F 3S8PA 3PFIA 3OUUA 1BI1A 3UR3C 1ULZA 3BQZA 2NVTJ 5E1ZB 1P4XA 1KONA 2W71A 4ZQIA 4ECVA 4Y52J 3I4MG 1SFUA 3HOSA 3WO0A 2KPMA 2RAEA 1WGXA 2EZKA 1AT0A 2C2EA 3RDIA 4IX7A 3BZCA 1HDPA 2CRGA 2JPCA 4EM1A 3GTKA 3GO5A 3FMAA 5EWFA 3OYEA 3CJTB 5KFEA 3COAC 4HLYA 1SYXB 4WD3A 5DG7A 2ZXHA 2OA4A 2QOJZ 2YYAA 4G94A 3CCLI 3HJEA 3JAMK 1JDBB 4PDBA 3BABA 2FJ1A 4DR2H 4AAFA 4A3CG 1TWHJ 1X19A 3QODA 3ZMTA 2C2RA 2R7OA 4XYMB 4YJ3F 3KHHA 3RB4A 4KA4A 2VBLA 1K6YA 3VYSB 3PJRA 2IA6A 1JT6A 5EOYA 1TNTA 1UFMA 2FOWA 2EA4A 3FMSA 5IOYA 4GFBA 1H88C 5KFOA 2BE5F 5L1LA 4II3A 3G1LA 5BPDA 1N48A 2W48A 3QP6A 3V8KA 4ZJZA 3TEDA 3OOLA 5BQTA 4E7LA 4HX7A 3SZTA 3I9V2 1MNMC 4MV8A 3CP8A 4OZ6A 2HYFA 2HU9A 1S7AA 5E3LA 1B6RA 2R86A 5KG2A 4YP3A 3SFZA 2YZMA 5AIPA 2QBYA 4NHJA 1QRYA 3H35A 5KCMA 5E8IA 1MOWA 1HR0H 2DO7A 4ZDLA 4HNVA 3KHLA 4ZYDA 5IP9J 3L2CA 2PBIA 3EYIA 4A3DJ 2NAZA 5ICCA 1B04A 4D9JA 2JA8G 3CCMI 1QZYA 2IXSA 2VQDA 3VYTB 4YQWA 5DM7F 5FKLA 1U8RA 1RETA 3OSGA 3LP8A 4YHHH 4G7ZF 1QHGA 5EZYF 4D6OA 4NNJA 1FVIA 1R4MB 3B6AA 4IRKA 2XGPA 4PDKA 3IRRA 3FKIG 4UVBA 4ENJA 1S7EA 3GTMJ 3RBEA 1FYMA 3ZQLA 3KZZA 3RBDA 3K4KA 1HKQA 1KJIA 5KFUA 4YITA 2QBYB 3K5IA 4TQRA 2CYYA 4L5JA 4CHUA 1B6SA 4FBUA 2Z16A 1KU7A 2EB7A 3TOBA 1FSEA 2HNHA 4DNCA 3J81Z 3DLAA 5FPOA 5CVUA 3L2UA 1F43A 1TW2A 1RKWA 2XAFA 4WF2A 1GHCA 2VR1A 5DQHA 3BWGA 2F4MB 3TQTA 2VA3A 4RNMA 1HSTA 2E5NA 2E2HJ 4AM3A 3F8NA 2PMUA 4JI1H 4LG3A 3UNGC 3CDIA 2JQ7A 2GXGA 4XLCA 5JFRA 3DV8A 5J4YA 1MMAA 1AU7A 2EZHA 3FXQA 1EUDB 1FMVA 4IO9F 1JKQC 2VUGA 3H40A 3CZ6A 3ETHA 1I6HJ 1IO2A 2GXAA 3VPCA 1S03G 4GIGA 1GXPA 2FUG2 1RJQA 3PSIA 4BE1A 1FMWA 3DCFA 5FFXA 4BE2A 3G6EI 5EZGA 1ETXA 4R7RA 3WTYC 3PIOF 1DIKA 2IEKA 2DMPA 3SQNA 1ONVA 1WJEA 2DI3A 2K40A 2OH2A 2RQQA 3T0YA 2R7ZJ 3U1KA 4DR7H 1N33H 3BG5A 1I94H 4DR6H 3C1DA 4EFEA 4QPQA 4IHVA 3KP5A 1W4MA 1HXDA 1P4AA 2CKZB 3OR2C 4E7JA 2OC6A 4E6KG 2KMUA 5LL6b 1D5VA 2K5CA 2WYOA 1GGOA 3QPSA 5DYMA 4J9NA 1ETVA 1MH4A 2E60A 3FMRA 5LMUH 5LHIA 2AGQA 3VFZA 5M5YJ 2K9NA 3FXJA 4G7OF 5DM6F 5KFFA 3WTSC 2GLTA 3HOXG 2LC2A 2BQRA 1UG0A 1EF0A 2UXBH 3ABLH 1N77A 3M9OB 4P55A 3J7AO 5L3BA 4N9IA 1ZHFA 4O3MA 3ZQCA 3OMYA 4ZHQF 3J7AK 5H80A 5CAEB 2CV1A 4BQAA 1FJLA 4UNCA 4B3MH 1UNNC 3BR2A 1Z77A 3AKZA 5FLMG 3DPTA 1YITI 2JEFA 1LKXA 4LFCH 1IRZA 5KFQA 1EF4A 4ENMA 1GLNA 2CZGA 5KFZA 4I98B 1S0NA 2WV0A 3WGHA 4C3IJ 3G6YA 1Z6RA 3LAPA 5HS9A 2XPWA 3HL2A 1KJ8A 3OS1A 4IKFA 2R8KA 4QIWE 2KRFA 1J0RA 2YUSA 3HYIA 1I7LA 2E19A 5D8KB 4A0YA 1G59A 2RDIA 2F4IA 1RYSA 3UVFA 3TDZC 5GTHC 4MEXF 5A0WA 3LWBA 3R5HA 2HPMA 2LNBA 1J2XA 4NC6A 2HZTA 3HKZA 2DZDA 1OLTA 5HODA 3PR4A 3S93A 1ITYA 3I71A 2YU9J 2PG4A 1DQUA 2DA5A 5HDKA 2ACJA 3GIKA 1TWFJ 4Z2YA 5L3EA 3CDHA 3FZVA 1B8IA 3HYJA 4LOXA 5DQGA 1IRFA 3HG9A 3P7NA 3K69A 1YOVB 3P9KA 4K0KH 4IRDA 1A6QA 3HPHA 3GWZA 3M8JA 2BXYA 4XZ3B 1EH6A 1XDUA 2CU7A 4AU7A 1HW1A 3N4MA 3ZOBA 5KFSA 3OOPA 3QFFA 2VT3A 4A3MG 3SYTA 1QBJA 4G12A 1LNWA 4V19K 3EETA 3WO1A 1ORKA 5M3MJ 1VQKI 1KQ0A 5KAFC 1PUFB 2QGUA 1ZN2A 4Q47A 3SDGA 1OMIA 1S3JA 2OU2A 1QNTA 5KFJA 2JPBA 2K3FA 1A5JA 2DJNA 2HOTA 3J7ZI 4ED6A 4U7DA 4HLXA 1FC3A 2KP6A 4UN8G 4FU0A 1EUCB 2DMTA 2FA5A 2Z3YA 4B4CA 5DS9A 5M5XJ 3Q5FA 1T94A 1B8IB 3J7YJ 1O3RA 2FB9A 2PN1A 3R23A 2W9BA 4F92B 4OWRB 1LUJB 1ZR2A 1T33A 3MQ0A 3PIPF 4KMFA 3E0JB 3JZIA 5KG3A 2ZDHA 4QWCA 2A05A 1NH3A 4LF4H 2X9DA 3H20A 4M9UA 3DLLF 1I50J 4EFJA 2MYSA 4GO1A 2HGSA 2A69F 5IPAA 1SFOJ 3WTTC 3OYJA 4E70A 1RJPA 4UHTA 1FNNA 1BJZA 2C28A 1ZAOA 4IHTA 1R22A 4KICA 3DF8A 3I56I 3EH8A 2AU0A 3N6XA 4EYHB 1RKTA 3RQ4A 2XKOA 1A31A 2LY2A 5CLSA 1QPMA 3OHAA 1IBKH 1W96A 2I3QA 4F3QA 1P4WA 4XRMA 1YJWI 2D1HA 2QKMB 2O9LA 4UN7A 2VT2A 2F4OB 2XF6A 1TC3C 1RUNA 2C00A 1M6VA 2LREA 4OINF 1EH7A 4E7IA 2W9BB 4JV2A 1TP4A 1H9GA 2Y0SN 3HSRA 4DYCA 5EGOA 4ENNA 4JI7H 4QLCU 2O8XA 3CMYA 3H0GJ 2IS4A 3RV3A 5K7FA 2L8LA 1I1GA 3RF2A 3CMAI 1ZR4A 2BY2A 1D1CA 2DA2A 3DPLC 3M7GA 1Z9CA 2V4RA 4F4ZA 2RNGA 1GV5A 3LMMA 3KEOA 3A03A 3WGIA 4PUSA 2HVQA 3ROUA 3JRAA 2AB5A 2R82A 2VOPA 2V9WA 3S15J 4J9PA 4A2BA 5IT9W 1ZGJA 3EUHA 4LFBH 3HOVG 1H8AC 3PQKA 1X4PA 5K08A 2IA0A 4O3PA 2K4JA 5BNGA 2AS5F 2EILH 2M4KA 2O0YA 4UV8A 2OPTA 3KEYA 4BBSJ 2PVPA 1FKAH 5IT3A 1FBQA 2Y31A 3QPHA 2KZGA 2L4MA 4O3OA 1S29A 3CJRB 2M4GA 5EGOB 1UHSA 3O2PE 1DPRA 4PWQA 4UVAA 4A6DA 1T0FC 4Q5SF 1REPC 4CDGA 2VBNA 1K4TA 4JI2H 1XMAA 4Q48A 2NVXJ 4MLOA 5BS6A 2R93G 2UZKA 1MJBA 4JV1A 3BCAA 3F8FA 5L1KA 2GLOA 4PFOA 4LK0F 5ERIA 3ZXSA 2VA2A 2ZNYA 3U9SA 2JMZA 4ECSA 1U8BA 2HXOA 4M71A 4QIWN 3GTOA 4ED7A 1R1VA 2KL4A 2FNAA 3CCSI 1JGGA 2F48A 4RU9A 1LEBA 3SJMA 3TQNA 4BH9A 2EPFA 3E5NA 4RGRA 4TV9F 3T5JA 3L00A 4NQWA 2O5RA 3DEUA 4UUSA 2HQAA 3SHFA 1CQIB 2M7BA 3SZGA 2EFWA 1EJ9A 1MJ9A 1OKRA 4JI5H 4A93G 3OWTA 3CC7I 1W93A 5HDGA 2ZO4A 5IYBJ 5J1YA 1OISA 1IOWA 1TNSA 1KJQA 1TQIA 4BY1G 2IN0A 1L0OC 1FYKA 1F9NA 1D3YA 2QQBA 5L9XA 3U9TA 4ECYA 2MLKA 1HKTA 3E6BA 3K10A 3LL7A 2ZJRF 1ZLKA 4RB2C 2YRWA 3IFJA 4XSXF 2I80A 3Q2OA 1POGA 5CVRA 1IV6A 3FKIA 1DV1A 3HOUG 3K0LA 3H0DA 5C4XJ 3KP2A 2MH9A 4BAYA 3IN5A 1Y1WA 1C3OA 3HOWG 3ZQIA 4J9MA 1STZA 2DFHA 5D6EA 3FX3A 4EMSA 1NK2P 2WAEA 4J9KA 5KAIC 4LFAH 2DODA 4A3LG 2J9GA 3OYBA 2BEOA 4NC8A 5DUKA 3SFIA 3KHGA 4Y4RA 3GQCA 1OCZH 3JSOA 3S1RJ 3KZYA 1S72I 5BPIA 2WE6A 1TWGA 4PZJA 1ZGWA 3H3VK 1FP2A 1SVMA 2CUZA 5FKMA 1BJTA 4HSTA 1ETOA 4A3CJ 4L9TA 2ZM6H 2WA0A 4L9JA 3HTUA 1XG1A 4KL6A 2YRXA 5CKTA 4IRIA 1MNEA 2L3DA 2AXTC 2K9QA 1DQ3A 5KFYA 1WH5A 3M07A 2V9KA 3HZJA 2A61A 4NBQA 1FZPB 3WU2C 2LF8A 3PL8A 2NU8B 4LF5H 5H6RA 4QW8A 5KFCA 2Y2ZA 4YJ2F 2W70A 1QZZA 2V4JC 4M73A 3O3KA 3L2VA 2E7WA 2HPIA 5E3MA 1ZELA 3H9GA 4F55A 5JVGF 2DCEA 4IZZA 2JA6G 3FBNB 3CC2I 4DV2H 4HF2A 4JYAH 2Y0SA 1MD0A 3RV4A 3I55I 5JVDF 3H3UA 2ASJA 2ZNZA 1X1CA 2N8GA 3D5LA 1B1BA 1BIBA 5JHUA 4RM2A 1LFPA 4AADA 3CO7C 1ODDA 3EUAA 4IVNA 4DQ2A 3I5UA 4O1SA 3ABKH 3EPZA 3MZ8A 1J75A 3ISPA 4HV6A 5LHHA 4XIDA 2R5ZA 1ZDEA 5KK1A 4RAFA 2HJWA 1W1WE 5LEKA 1TWCJ 1G9ZA 4X66H 5EG0A 1TZLA 1FY7A 2FQ4A 2GOXB 5FKKA 5IP7J 3OUZA 1X9NA 3BLYA 4RB0A 2W6PA 3G71I 3TIGA 5T14A 4IHSA 3Q8RB 1YS6A 5F08A 2DA1A 4PJMA 2PMZE 2QSHX 3Q0UA 4A3GJ 3RJ0A 3HOZG 1GXQA 2OQGA 2YS6A 2BGCA 1HDDC 1JUSA 1D0XA 2B0LA 1OQYA 5KG4A 1K83A 3ZRGA 1S97A 1AUXA 5A0MA 4U0VA 3BY6A 3VOEA 4BJ5C 3GVAA 2R5YA 3TINA 4PJ0C 2P5LC 2CQ7A 5E3NA 1LE8A 1X1PA 4MV4A 4U88A 2VLAA 5D5WB 4QIWA 1JUPA 4HF0A 2VS8A 4U0YA 1ETWA 4GDFA 1UCRA 1A9XA 2R8IA 4ECZA 1I39A 1Z0XA 3LOCA 2XC9A 3G73A 4HDUA 2R85A 4MA0A 3H92A 3GTJJ 3H36A 4LSAA 1CF7A 3RZDJ 1LB2A 3HM5A 4UT0A 2XVCA 3WG9A 4CC6A 4M3BA 1GSAA 5K7HA 1EA3A 2L7FP 2NU6B 2IGKA 3FXUA 4IHXA 4DZJA 2X6YA 1JX4A 2XPUA 1D1AA 4C5CA 2R5YB 3V8JA 2EX5A 4XYLB 4JX5A 1LE8B 3KYDB 2GA2A 2AQEA 3CUQA 4CO8A 4QFQA 4BHBA 2ECBA 2F5CA 5DGAA 2H6CA 2ZB9A 4M3FA 5GPCA 5FFZA 4ECXA 1E3PA 2FMLA 3KHRA 2QENA 2LDUA 2L9VA 2IP2A 1VI0A 4CYDA 2V5AA 4YRVA 5C3EJ 2X1EA 3CUOA 1CF7B 5A72A 5D6FA 5LYJF 5F9NA 4ED8A 1R71A 2NNNA 1WJDA 4QPOA 5KNLA 2STWA 1FTTA 4C2TA 4M9XA 3WHCA 1V51A 2R84A 3K4CA 4YIFA 3F21A 5DCFA 1X4OA 2ZFWA 3GTLA 2HDCA 1V3FA 2C2DA 1IXSB 4EGQA 4JI8H 3TP0A 2E2JJ 3GTGJ 3I4NJ 1I6XA 4FISA 3C0WA 4QJFA 3RUPA 3T5KA 2FEZA 2XE0A 3CUQB 4BDYA 4IRHA 3ASNH 4EGZA 2DQLA 3BR6A 5IYZF 3HRUA 4RMNA 5BOXA 2VOOA 2VPRA 4CH7A 3L2QA 3T5HA 3NWSA 4L9VA 1BM9A 3GTPJ 5DV5A 2V7FA 2MABA 4G6TB 1XS9A 4P96A 3F6VA 3J81K 4AAEA 1IDYA 4B47A 2VBOA 4BS9A 1GVDA 3QU3A 3CDLA 2GQQA 2ID6A 3EYYA 5LHGA 4WCGA 4RA2A 4UCOA 1R58A 1Y0NA 5AONA 5B1AH 3KP4A 3CO6C 2WB1N 2HQ5A 1BXRA 3JSNA 1W7PD 2FK2A 3MZHA 4ECTA 5DUIA 1XNRH 5KX5F 2M1BA 3NEUA 4ECWA 2GWRA 5IYDG 3CCVI 1ON2A 4HQEA 1EHIA 2VQLA 2K85A 2XE0B 3S32A 1V9PA 4ED0A 2NVYJ 2NS0A 2UXXA 2CMPA 2NU7B 1R6RA 1A04A 1Y0UA 5J2UF 5KFMA 5HLIA 2M8GX 5HS8A 4A3JJ 2F4VH 2QUFA 2H1KA 5KFWA 3HPGA 3GIIA 1IDZA 5JI6A 2VKVA 3HKZE 1T6SA 4CCLA 2FE3A 3ERED 5GAEJ 5A2QW 5LRRA 4PSWA 3OY9A 2PQ8A 1BR1A 3CCYA 3OYGA 2X6OA 4HR7A 2RGRA 2I3PA 1FOKA 5A77A 3W2VA 1LDDA 3AYHB 1DU6A 5LRSA 3CJQB 2PMZN 2KIUA 4D5CA 3CCJI 2WBMA 1IN7A 1S5LC 2Q2EA 3DEWA 3MISA 4XRFA 4C2MA 4F4XA 3IRQA 3VWBA 2EV0A 1ULYA 5F9LA 1W36C 2KFDA 4E7HA 2V1UA 2XB5A 3QQAA 1HF0A 4L0YB 1FIPA 3R4KA 3CD6I 5EYRA 2IS6A 2ZC2A 3N42B 1N34H 5K5RA 3RIRA 1JHFA 2FX0A 1NHAA 2JN6A 2O61A 2JEGA 1E4GT 3NQOA 2E2IA 1WH2A 2EV5A 1RPWA 2EK5A 1IXRC 4BBRJ 1ZH5A 2R93A 4M3DA 2PN6A 2VS7A 2WAQE 3VB2A 4IHJF 3BG7A 2YZGA 4D6NA 2VC1A 4ZTFA 4RLQA 2OAZA 4A3EG 5LFAA 1IW7F 4LF6H 1WJFA 5EEHA 3FMQA 1TLHB 2Q2EB 3P5JA 4BJTA 5JVTA 2JTVA 3OL3A 4LB5A 3VODA 2W7OA 5HOOA 3CC4I 2XSDC 1D5YA 1QO0D 3K2AA 5J4VA 3WHBA 1TWHA 4CCMA 4E4TA 3VSLA 2NU9B 4UN7G 1XDNA 1YRNA 3I4PA 2BYVE 4A3BG 2K9LA 4IRCA 1TT5B 1HQCA 1VQLI 4AQXA 3VMMA 1G4DA 3U1DA 2L01A 3OYAA 3S3NA 2IN8A 4AYBN 1Z7LA 3BR1A 3D5SC 1G8XA 3PO2G 1ZQ7A 2LKSA 3P9CA 4A3KJ 1UAAA 2O7MA 2COMA 1QPIA 1UC9A 5L3FA 1HNXH 2PFBA 2FLPA 2JA5A 4B43A 2LR8A 2R7VA 5D4SA 4Q44A 4QTRA 2FK1A 1TBXA 2XDVA 4M74A 3ZGKA 3A2KA 1ETKA 5ILSA 5EEAA 3RFCA 1XMOH 2E71A 2VXDA 3A01A 4UCUA 2DTZA 4QWEA 5DEQA 1AUVA 2JEJA 1IBMH 3D5RC 2XKPA 3PQJA 1ZETA 1U3EM 3RKWA 5KFKA 1S9HA 1YRNB 2BY1A 4M3EA 4NDLA 4UCRA 1SFXA 2YPRA 4RAZA 2X48A 1O7LA 3K4MA 3TGNA 4H0EA 3NZMA 4E7ZA 4U6PA 4BYYA 1T3NA 1USSA 1WQ2A 1IF1A 3QOPA 5E3OA 1J5EH 4F50A 4J9SA 3I12A 3ZR8X 1ON1A 2CQQA 2MSYA 1K79A 1YX5A 5D8LB 2Z33A 3EUKL 1A36A 2G7HA 4EVIA 2NOJB 5CPRB 2GPWA 1XNQH 5EWGA 2CUFA 2WB1A 3A01B 3D1NI 1X1DA 3DBRB 1RNLA 1T56A 3JRIA 1MMDA 1MKMA 3OYHA 1WRJA 5BMZA 3H5NA 3W6VA 4RAYA 2O6GE 2XB0X 4XKWA 3MR6A 1WPKA 3IC7A 3T1YH 1WCMJ 2DYSH 2JA6A 3H4DA 3V42A 4UNAA 2W00A 4APMA 1IV8A 3OS2A 2E2HA 5KFTA 2JA2A 1R00A 2Y48A 4B3TH 2BW3B 4A93J 2CQNA 3FK7A 2F5FA 2FD5A 2HVRA 4HRIA 2PX9A 4BY1J 5E63A 1K61A 3HKZN 2P0AA 2YL2A 3ZQFA 4LOCA 3L4JA 2DT5A 4M9SA 4ECQA 2G0EA 3EUHC 2UXCH 1S6LA 1D0ZA 2HDDA 1WWXA 4RNOA 2PMZA 5C8YF 1X3WB 2BHYA 1I3AA 2DT7B 1D0YA 5A74A 3KAKA 2L9RA 3FF5A 3C2GA 2FKLA 4GKJH 4RUAA 1RYRA 5I0AA 2OCEA 1Y1WG 2HYGD 4AVPA 4M3GA 1BN5A 2JSPA 2DLLA 5LXTF 4HNUA 5DCMA 3N97A 3GTKJ 2UUBH 4DZPA 2DFIA 5JUMA 3K4NA 4DR1H 1J59A 4RB1A 4IWXA 2R7ZA 3NRVA 2R92A 1U9OA 2R7QA 2ZSIB 3BPXA 1CS0A 5B66C 5EEGA 3BZ6A 3QPLA 3S2DJ 1J9IA 2QZ8A 1J7KA 5DTDA 2IP4A 3F0CA 2WWYA 3SE7A 5FJ8G 2A6EF 2XAJA 2ZMEA 1UHMA 2HKXA 2WAQN 3BDDA 3LWFA 4EATA 5GAHJ 2OWOA 2EV6A 5A78A 3LA3A 4HBLA 1N56A 3WG7H 2HKOA 3M1EA 3W6KB 2LQMA 2YZNA 3BJYA 3JRGA 3LQQA 1TT0A 2MC4A 4CSWA 2R7SA 5K5QA 3B73A 3BR5A 4CZCA 3K1MA 1YS7A 2EFPA 4U0WA 3OIQA 5DCMB 1K6OA 4QWAA 2R7KA 3ZQGA 2ZKZA 3Q0VA 3QZ7A 1BI2A 3VPRA 4XRSG 1ZHSA 4B3RH 4IF4A 4AYBA 1W36D 2A07F 1JKPC 1JLLB 3H9JA 4XNFA 1YW9A 3DTEA 5FLXZ 1UM2A 4YR0A 3HBLA 2FQ3A 2Y0SE 2XIGA 3OSNA 2ZMEB 4W97A 4I99C 4O4IF 2YS7A 1JKOC 1U5TA 2E1NA 2W4SA 3MAJA 4HYEA 2DN0A 1QVTA 4XKVA 4UCVA 1JI8A 2DMUA 1MDMA 4KHPH 4IQ4A 5KT3A 3RGZA 2HHHH 3F8BA 2XSJC 3J80Z 3MKLA 3QOEA 1R36A 4OIRF 4ZDPA 3MWDA 4A0ZA 4ETSA 3FBIB 2R7WA 4D7MA 1R9TJ 2ZDGA 1QZEA 3V4GA 3TW6A 2L7ZA 3CF2A 2YU9A 4BNCA 1TWFA 1O7FA 3OIPA 1MH3A 1D1BA 2ALZA 1BR4A 4WXDA 2HI3A 1EZ1A 3G6VA 2F5DA 2L2OA 3K2ZA 1U5TB 4DJAA 2XC7A 4A2AA 4IR1A 3GTQA 1PYVA 2EIKH 2ME6A 1YO5C 3RZOJ 1DDNA 1MDMB 4QWDA 3CF5F 2DMNA 4LF8H 4OX9H 2DYRH 5KFAA 5HLGA 2Z99A 2P0WA 4IPAA 3MMYB 2CV2A 2W57A 4A3IJ 5FPRA 3FHZA 3BTCA 4JP0A 2NS7A 2RVCA 3S3OA 3C18A 3BJ6A 1N36H 1S8NA 1R1UA 5DG8A 2F5VA 2L7KA 5FD5A 3OYMA 1OCPA 2K9MA 2BZTA 2Y75A 3Q9SA 2PJRB 2P8TA 2VBWA 1PUFA 3KP7A 3KAJA 3TL4X 1JVAA 3ZMUA 2LBFA 4UV9A 5HLTA 1CQJB 2R6FA 5KT4A 1VQ5I 5F04A 4EFBA 5KKNB 1ZG5A 2X0LA 3N40P 5IYCG 4J9LA 4IHYA 2BBYA 4YR2A 1SFOA 3R61A 4ZC3A 2YSRA 4II2A 1APLC 1JKJB 3GFIA 3KCCA 4OMZA 2VONA 3U9GA 5DQIA 3RYPA 4M9ZA 4HSRA 1GV2A 1FLIA 2FLDA 2R87A 4XR6A 1N78A 3KE2A 3CMMA 2FBHA 5HNFA 2JA7A 1VAJA 4R8HA 1E4EA 1U78A 4NLGA 2RDPA 4YAKB 1VBHA 5A2QK 3IAM2 4XSZF 1N32H 2M9HA 5J6XA 1TA8A 3J81W 1XMKA 2LMDA 1VZ0A 4PJJA 3E97A 2LBFB 4FQGA 3JRFA 3OTOH 2UU9H 5D1OA 4O3RA 1RI7A 2KJCA 1JIHA 4BY7G 3F8MA 5HLHA 2WAQA 4G6DA 1MBKA 5DD4A 3QRFF 1I27A 3PW4A 5C44J 3S3MA 1O3TA 1QU3A 1FBSA 4MQ9F 3RB0A 2F4LA 2W8LA 2KDOA 1Y14B 2PBZA 2DA4A 1VKZA 2RV8A 3OL4A 3VYRB 1YHQI 2IPQX 2XASA 2VUMG 4PJNA 3E3VA 2HTJA 1VQPI 1TL8A 3K1NA 1T39A 2Y9ZA 3IGDA 3JAMZ 4UN9A 4HX8A 1BJAA 4XBFA 4DBQA 1S68A 1B9MA 3CESA 4IAJA 1X3ZB 1WSUA 3Q8QB 1E4EB 5D8DA 4C5BA 1BOAA 4AABA 1BW6A 1B4AA 4YIIA 4G7HF 3MEXA 3K4JA 4FS2A 4HG2A 1RUOA 2GZWA 1WVRA 2M7AA 3W3CA 4BXXG 1G3SA 2ADUA 2F5EA 5IYDJ 3EPIA 3M9AA 4XORA 3HTSB 4XX0B 5D1OB 4J0MA 3CUQC 5TGTA 2B63A 4EYIB 3KPHA 4EJWA 1OYWA 2JRMA 2A6HF 3IL2A 2P6TA 3H4BA 2VODA 2YR2A 3LSJA 2I5UA 2P6SA 3CP2A 4XK4A 3G4SI 1SD5A 3AG1H 1ZRDA 2GPSA 1V4YA 3ELKA 4BQQA 1UB9A 4YG2F 3O6BB 4BACA 3LSIA 1FSHA 2QF7A 4KIFA 5IP6A 5KG5A 3AL0B 1Z2PX 1HKSA 1UJ8A 2GAUA 3JTHA 1BR2A 5JQWA 3A02A 2OCCH 2MCTA 1R4NB 3K70C 1F36A 3DU5A 1LVAA 4HZFA 2X51A 5AIQA 4ABZA 3VPBA 4DL4A 3UQ8A 4M6XA 2UUCH 2CW8A 5ILUA 1BIAA 3GFLA 2KDZA 3ZQQA 3L09A 4ON0A 5GPAA 2XROA 2H27A 3LNQA 3OYIA 4M6VA 4MO7A 1MI8A 1QQIA 2L4AA 2OV7A 2V9PA 3LSMA 3HOYJ 2XAHA 1SVLA 2H1LA 3M1CA 3TKYA 4XLPF 1AA7A 1O75A 2IA1A 1UHWA 2HTSA 3FWEA 4DR5H 1DFAA 3PNYA 3E6DA 2CW7A 3LSKA 4CZZA 4Y8VB 4JI0H 1OYYA 4H4KC 2R7RA 1W0TA 4LLNA 5H20A 2ASLA 4V2FA 3M4OJ 1Z6TA 2HOSA 3PNTA 3S2WA 2GXBA 2XF5A 3ONQA 3BT9A 2W9CA 1WJBA 2E1MB 1WI9A 4A3EJ 2DXIA 3VYUB 1K78B 2LYCA 4XLNF 3T8RA 2JNQA 4TV7A 2W9AA 2I8CA 1V5FA 2RQPA 2ISYA 4Z6YA 1YTYA 1D8JA 3GV5B 3TQ1A 4GCVA 5H6QA 3NWTA 4IEJA 5DLGA 5AKMA 4XOTA 2EQRA 4YISA 1SAXA 1R7MA 3RCOA 3WTUC 1HA8A 3KXYT 5J8FA 4XL9A 4XLAA 1MSEC 4FETA 3FD2A 3QZ8A 4A3BJ 1AKHA 1R5GA 2BVMA 4YR3A 4PK4A 5D5XB 3DEEA 4MNUA 1P7IA 3HSFA 4KT5C 3HHGA 2EFQA 4XLHA 2W25A 3L2PA 2K3PA 1H0MA 1IRXA 2W9CB 3BTIA 2JA5G 3PVXA 2L9NA 4GLXA 4L5EA 2X6WA 1V55H 2KIQA 4CC5A 3PO3G 3CLOA 3I4MJ 2NXNB 3JRWA 2W24A 5DLFA 2V79A 4AD9A 4CUGA 2BHZA 3G8CA 4DV0H 3MCZA 3OS0A 3QU6A 4LIVA 1Z2NX 4A3FG 5JLXA 4EJTA 2VN2A 4ED2A 1SCUB 4WBNF 1AKHB 4IR9A 5M3FJ 1IZ1A 1E4FT 1WR2A 3VDXA 2XD4A 3RYRA 2PLYA 2RF4A 4E7KA 3LFKA 2OZUA 3C2HA 5GP9A 3OYCA 4IJAA 4ESJA 2W85A 4D7NA 1I3QA 2JZYA 4ASNA 1C30A 1FOWA 4BEHB 4N0BA 4KIBA 5KFHA 2WY8Q 3ZMVA 1HBXG 3A1YA 2VJ5A 4UXNA 2DIKA 5ICFA 3IWZA 4HF1A 2JWTA 2FPPB 2DT6A 3RPUA 5FROA 1JGSA 3A0HC 3IAS2 5J47A 5E5OA 1GVJA 2WB1E 4UY8I 3GLKA 2LD5A 3N41B 2IVMA 2KISA 3WTVC 2QVOA 4HX4A 4JK1X 3OR1C 4XN0A 4XRSA 4HQ6A 1WI3A 4YBZB 5KFRA 3BTJA 2VPSA 2VIXA 3FXLA 4P9UA 4P9FA 1G3YA 3ZQ7A 2ZSHB 4FASD 1FBUA 2DOFA 1DGWY 2QCOA 5CVVA 4DL5A 1Y1VA 1X2NA 5AKNA 5KG7A 4D5FA 1VFCA 2ME0A 4BU2A 1ZHQA 2JA8J 1SVOA 5LGTA 3FXKA 4AVZA 2P81A 2OD5A 2K27A 3K1PA 3RGXA 3M8EA 2EH3A 4XICA 1XSDA 4RM3A 4WWCA 4OAZA 2JUCA 5KG0A 5L1IA 3F3XA 3FKIJ 1YI2I 2YCHA 3S2HJ 1KU2A 2DPIA 5E8GA 3R0AA 3DBHB 2W6OA 4JQFA 1KYWA 4N4NB 1FTZA 2R8GA 3L7WA 1TW3A 2CV0A 2IS2A 2QYOA 3K4BA 2R7ZG 2QEXI 4OAYA 1JT0A 1BL0A 2X0SA 2R92G 2P7VB 4RB3C 1AHDP 3WE2A 3GF2A 2DPUA 1TWGJ 4ZDOA 2W82A 2JT1A 1J5YA 4ESBA 3OSPA 2FSWA 5FJ8J 2K9SA 3Q8PB 1W5SA 5EF6A 4DUYH 4XMYA 1VQ8I 4BHCA 1X1BA 4F52A 5KT7A 1PVEA 2OUMA 4M6YA 4ZYHA 1XB4A 3DWLE 2HXIA 2R3SA 3AAFA 1VQNI 4O1RA 3C3WA 2DK5A 2KIMA 3ORQA 4HPQA 2WAFA 2DBBA 3CCUI 3R60A 4XKCA 1P9QC 4YELA 3J7AY 3L2RA 3K70D 3PZPA 1B24A 4EG0A 1K7AA 1PP8F 2IGNA 2O8KA 3HC7A 4XN3A 4YHXA 3BQYA 2DAOA 1T8IA 1MBJA 2LRDA 4JOMA 5LBQA 3KTMA 2IGMA 3CQZJ 2FK3A 1Q1HA 3V6HA 1Y56A 4AIKA 1Z21A 1C0WA 3BA9A 1EKEA 3G2BA 1R7JA 3R0JA 4ZYEA 4AYBE 1GDTA 2DJIA 4I01A 3DQVC 4L18B 1UMQA 3E5XA 1U0DA 3MVPA 3MR5A 1XN7A 2ELJA 3M8FA 1G6NA 1M7JA 2C22A 4Y3OA 2VQCA 2W6ZA 2P4WA 5CA1F 1ENHA 2B9SA 4ZTJA 3BQ0A 2VB6A 5LGNA 2CGPA 2NVYA 3GYHX 3KP6A 2A5YB 3QWLA 4B3SH 5KT6A 2LH9A 5F27A 3F23A 5TRDA 3E1SA 3HOXJ 4C5AA 2IS1A 4JI4H 3MFHA 1K83J 3KALA 4O4LF 3HUGA 3RPQA 3AG3H 4XKBA 1B6AA 2ZMEC 1DUXC 5FLMJ 2WC2A 4WK8F 3ZMSA 4E4HA 2HR3A 5FLVA 5C5JA 1S10A 3ZMZA 1MIJA 2E5LH 2XCPA 1MBGA 5LGUA 4JV0A 2VUMA 5FO5A 1P8KZ 4O4HF 4HA8A 3ABMH 2R4GA 2MA3A 4BKXA 3R5FA 1HNWH 3KIOA 1MBEA 3IP4B 5JR3A 4ECUA 2P7CB 1MMSA 2IN9A 1WJAA 2BXZA 2IBDA 3JRDA 2O03A 1GPPA 5ILVA 2KQRA 2NOGA 5CJ9A 2EZLA 4L5IA 2ESHA 3OYLA 1ZD7A 2Z2SB 2FBIA 4K2EA 1VNDA 4LIUA 5FRNA 3RB6A 3IH4A 3UKGA 5H2FC 2EFOA 3SEQA 5KFLA 3HUGB 3S1MJ 4DV7H 4RGXA 4DL3A 1YJ9I 3RSNA 1KU9A 1PK8A 3BG9A 1U5TC 5L3CA 2M8EA 2Q0OA 1S0OA 3BTLA 3B6CA 3E54A 3KX2A 4BQNA 1ERDA 1AM2A 4GRIA 1VQMI 2FPIB 2R8JA 1VTNC 3WNZA 4ESFA 1T9JA 4DV6H 1XD7A 1U2WA 3A4CA 4HQMA 1PX2A 4C9YA 3HGYA 2ICWG 1A35A 4MTEA 1JDEA 1TWAA 3JRCA 4EQQA 4HEA2 1MZBA 2XV4S 4HW0A 4A3MJ 1KBLA 2G9WA 4JBAA 3GBGA 2HS5A 3FIWA 2IJLA 2IW5A 2JA7G 1ZREA 3PW0A 4EGYA 2LKXA 2RGVA 3WTWC 2VKDA 1B33N 3GV7B 3GTLJ 4M72A 3W6JB 4LK1F 4AUXA 1F4KA 2M05A 3JW4A 5CVIA 3S17J 4KN7X 4HOBA 4OIQF 3GZNB 4O3SA 1SEIA 5C1PA 2UVWA 3OSFA 1Q1VA 1V5GA 1HC8A 4I55F 3ZN0A 5F0FA 2HGCA 1SD4A 3T5LA 4G3IA 3QPTA 2JMWA 5BPHA 4ZZDA 1XDSA 2C35B 1RRJA 2DCHX 3EQLF 3RAQA 2LG4A 4UN9G 1MSFC 2DTRA 5E1XA 3ZPLA 3PSFA 2R7FA 3LSRA 1Z05A 4Q8EA 1HSJA 4UB6C 5HVQC 4MFEA 4BBSG 3CTAA 2OTLI 4KDPA 5J2TF 1WJ5A 1XMQH 1PUEE 1FJGH 3JRXA 1RC9A 3BR3A 3GFJA 2UXDH 1ZARA 2W1OA 3FISA 3PM1A 4DL6A 2IMWP 5BMVF 2JVGA 1I5ZA 1IC8A 2LLKA 3GZ6A 3BJAA 2B63G 2L0KA 4R1HA 2ZXJA 3I53A 2XF7A 1T08B 4Z20A 1DGSA 4TV8F 1S7OA 3VEPA 4A2UA 2RREA 4PFPA 4Y7NJ 1MBHA 2VPLA 2V6EA 4RGSA 3IG0A 3DPUA 5KHDA 1ZG1A 2CWEA 2VOBA 3MD2A 3ULQB 5D1PA 1G3WA 1KA8A 2LF7A 1A0IA 3OOUA 1XGMA 2RC4A 5IOZA 3HOVJ 5BR8H 2E34A 3FDYA 4NB5A 4X64H 4O2BF 2J5OA 2CJJA 2XGCA 3LQRA 3HIFA 3LSPA 3BQ2A 5KVRA 2KRCA 2TDXA 5IYBG 1X58A 4Z1ZA 4GC6A 1JUMA 2XHKA 3BC8A 3O8HA 3RQIA 1ZG3A 2ZBKA 4PJLA 1HLVA 4ED3A 3R6SA 3REOA 2VI6A 4KISA 2ATLA 3LSHA 4RS8A 4R8UB 2IGOA 2O3FA 2OBPA 1M0WA 5E18F 4DL2A 2STTA 2E2IJ 1OR7A 5JH7F 4Q45A 2BW3A 1YQAA 2Q8KA 4CICA 3DKXA 3DKWA 2R93J 4UCSA 3TIIA 2WTEA 3R7PA 5C4XG 3AL0C 3GTMA 4P5OA 4Q4ZF 2VBXA 2CQKA 4G9YA 1AOYA 4KUMA 4U7BA 2EZIA 2DPJA 2GOMA 4ME6A 2FRHA 5KFBA 4XLEA 3BG6A 2XCLA 5C1OA 2AO9A 1LFBA 5B3SH 4F93B 1VQ4I 3WODF 4LF7H 1KJJA 3RTXA 3QYFA 3TP3A 5JHFA 5L1JA 2I8DA 4YFXF 2FMAA 1MGTA 4MEYF 3MX9A 1V4RA 3K3PA 2ZJTA 2ASDA 4NC7A 2ELKA 1FWZA 1P7JA 4EV0A 2KZVA 4LB6B 2UVUA 2CUJA 2L9SA 5J40A 1LPQA 4I2OA 2VJIA 5KG6A 2VKHA 4JYKA 2L54A 1MW7A 5L3DA 2VQFH 2KRHA 3K6GA 1YW7A 3LA7A 2JA5J 5KT2A 2E1MC 2R0QC 3C0FB 3M9MB 3RB3A 2O7OA 4ZYGA 2MFZA 1HOMA 2WV1A 3KYCB 1Z91A 3OIOA 2HQNA 1IAWA 3PO3J 1T38A 1YW8A 1MMGA 1WJCA 2EJRA 4YEJA 2E1OA 3HOUJ 1KQ8A 3HOTA 2VE9A 1BGWA 2UUAH 3LFUA 1N3FA 3MKWB 4LH7A 3CCEI 3HOWJ 3HSEA 4IRGA 1XSXA 4YY3H 4A3FJ 3BP8A 5HDNA 4MFDA 1WKMA 4A3LJ 3MZYA 2VBLB 1KGSA 2EIJH 4MTDA 4X1EA 1R23A 5D4RA 1H9TA 2HEOA 1FYLA 2XUBA 2A3SA 1P8LA 3KP3A 4KYWA 3JSLA 5ICEA 2AXLA 3E7LA 1LWTA 4X62H 4GYIA 5IP7G 5K5OA 5EJCA 3QYBA 5B1BH 1DPUA 2BY0A 1OWTA 4L0ZB 4IZOA 3RI4A 1V5EA 1T9IA 2KHMA 4KNYA 4A3GG 1R9TA 1LWSA 3FXOA 4I0BA 4A5MA 3H5RA 1MJAA 2W84A 3DFGA 2R7UA 4MV9A 1HW5A 3L9FA 5L3GA 3E6CC 1IN6A 1I6UA 5KFDA 2JA6J 3IHUA 2MW8A 4GC7A 2OZ6A 2CUEA 2PMHA 2WADA 2CQXA 4BL0B 5TISC 3WE3A 1M1EB 1TTYA 4RLFA 3S1QJ 3FXMA 2KJBA 5IWAH 3U21A 3PNVA 1OYIA 2Z1DA 3F9KA 4Q0YA 1Y1VG 1ZK8A 2H8WA 2K86A 2OQRA 2I87A 3Q8SB 2DOAA 4V2GA 2J6UA 1RJRA 2UUZA 1UZCA 3HXLA 2DA3A 2V59A 2M0CA 3BAAA 2W7PA 3G3ZA 3D0SA 3E5QA 3GW2A 3LSTA 4RAGA 4Q43A 1LJ9A 1XCBA 4DUZH 2FJZA 4UUTA 1VF9A 2Y0MA 1P6RA 4BGDA 3FM5A 5J1RA 3JRBA 3GIQA 2KSWA 2E5ZA 2JSCA 3MXAA 3T1HH 3OORA 2A5WA 1TQMA 1XX5A 3HOZJ 1RIOH 3V7SA 1RZ4A 2YX4A 4Y17A 1IN8A 2WY7Q 3IH2A 4OMYA 4JUZA 3S14J 5KG1A 4MAMA 2PJRA 1JXSA 4C3JJ 2R92J 2ECCA 2ISZA 1YJNI 3E5UA 2XCAA 4A0XA 1XGOA 2QM3A 2MD5A 1SD7A 3RKYA 4KL5A 5CYVA 3EPGA 4EJVA 4QWQA 3N8DA 4EM0B 2AGPA 2W6QA 5C3EG 4FM9A 2H09A 2VBZA 1IRGA 2EWNA 3LSGA 4LF9H 5FB2A 2L5QA 2PJPA 2VJJA 2VJ4A 5IT9Z 1JTXA 2M2EA 3ZN1A 3HHHA 3IH3A 2E35A 5M5WJ 4GYGA 1RK6A 4ENKA 3RKQA 2DQRA 3MFKA 3MN2A 2CFOA 2VC0A 4DGWB 1E3HA 4R79A 4IXAA 2NYXA 3I4NG 4B1RA 5HNHA 2FOKA 3GUDA 2X85A 5J8CA 4CYCA 2HWVA 2HOEA 5J1UA 4CA0A 2QSGX 1CE8A 2IAIA 2M3AA 2QA4I 1GUUA 1E3OC 5E79C 4HAMA 4LJZF 5AKFA 3HB9A 2R8HA 1OCOH 2DDAA 1G2HA 3WU0A 1WSCA 2DWCA 4EBEA 1QVUA 3W2WA 1ZTRA 4LLLA 4BDZA 4Z1XA 1I50A 5EDWA 2X4HA 4I02A 2LVSA 3K7AJ 4YFNF 2LCJA 2VXZA 5I47A 1YG2A 2NVUB 4BXUA 2B7EA 1IGNA 4MV6A 3UFXB 3G1OA 4O3NA 2ZJ2A 1F5TA 3BCBA 2COBA 4DV3H 1AF5A 5E1WA 1E2XA 1IBLH 1ZRFA 4F4WA 2GIVA 2X6XA 3K4LA 4LMYA 3ML6A 2VQHA 3IUOA 5GTIC 4CYCB 2MH2A 3G1MA 1BC8C 4CGZA 4MA5A 1YX3A 2LOOA 3U2RA 4QWBA 2DOEA 4RGUA 3ECHA 4Y13A 4A3JG 2NVQJ 5JLWA 2QWWA 3GEZA 1JKRC 3TMOA 1ZYRF 2XGDA 3H0GA 4EGJA 4DOZA 3PW7A 2D1VA 4MHGA 1IJWC 4B3AA 3CCRI 3MIPA 1GLVA 2XGQA 2HZDA 3PW2A 3ABUA 1LEAA 3HDDA 5CA0F 4JI6H 4NXNH 3N05A 4XONA 3KYLA 1BP7A 4FBTA 5DD8A 1K1SA 1X2MA 3A0BC 3LA2A 1O57A 3N43B 3GTQJ 4CCOA 1BI3A 4M7EA 2HFHA 3I64A 4AIJA 3N44B 3KFWX 3QYEA 4EEYA 3DXJF 1SC7A 1UELB 1YIJI 5LA6F 2Y69H 2ZFUA 2LTPA 2LKPA 1Z3XA 4BHPA 1GO3E 1ZKGA 5F64A 2D2WA 2GIZA 4DYQA 1E17A 2F6CA 1O3QA 4KN4X 4I09A 4DV4H 2J6TA 3IKTA 4B48A 3HRSA 5DGBA 5GAGJ 3MJFA 3Q3SA 3GLXA 3AG2H 4KITB 5FLXW 1KQ9A 2V26A 2P5VA 4TQSA 2NVXA 4MV3A 4BBRG 2UXNA 2CO5A 4F91B 4X6AJ 4LSXA 2CS3A 4JI3H 3KZIC 1RR8C 2XGEA 3WU1B 4C30A 1LDKB 1DU0A 4C2UA 1Z2OX 2W6MA 5F1JA 1LVKA 3GIJA 5J3LA 2ETHA 3IWFA 1ZLJA 1V54H 1W5TA 4XOPA 2WDTA 2IBKA 3ABTA 2V1NA 2Z5UA 5F0CA 1QA6A 5FKNA 4I4TF 1T95A 4Y15A 2FU4A 3J80W 1XGNA 4EBDA 4W1UA 2DU9A 3CJNA 3WTZA 3JSPA 4L1KA 1ACIA 4X65H 4KJZA 2QQ9A 1R5HA 1WHUA 3GXOA 3F6OA 1K78A 1E0EA 2JA7J 1GSOA 3OHBA 2XRNA 2DPDA 1OPCA 3ESWB 1S0MA 4WX9A 3B02A 3BOQA 2BV6A 2MC3A 5FKOA 2I10A 5TJJA 4EJUA 1XGSA 4UB8C 1KJ9A 1CGPA 4AC0A 3CMEI 1VBGA 4A3KG 2UV1A 2UVVA 1IG7A 4FX4A 2G7UA 5E5SA 1Y8RB 1Z7UA 5FRMA 4IOCF 2VE8A 1HNZH 1SMTA 3O8GA 4AWXB 5E20A 2EIMH 4F7ZA 3JRHA 1NTCA 1JE8A 2HQRA 4U7CA 2J6SA 4RZRA 2TCTA 2FPGB 2JRTA 5KFIA 1LDJA 3DTIA 1Y6IA 4ANJA 1TQPA 3HEFA 3Q0WA 4XLFA 2VQEH 2ZXWH 5C4JJ 3BJOA 1X1AA 1VS0A 3I3LA 3GZ5A 3MWEA 4E7SA 1A6IA 2VQGA 4S04A 4HDVA 1MBFA 3WGGA 3DU6A 1FIAA 4J9QA 1FOYA 3DF7A 2M45A 1BW5A 3CLQA 3V7RA 4S05A 4UUVA 2B63J 2Y9YA 1L3LA 3K3VA 3BA8A 1XCVA 2LK2A 3QP5A 4AQUA 3PW5A 2DLNA 2MBFA 2AHQA 3NGDA 4UNBA 3PO2J 3SZPA 2PEXA 2F2EA 2XAUA 3AG4H 3C0XA 3BQ1A 1GSHA 5F0HA 3GCMA 3SXYA 3VPDA 1F1ZA 2KEQA 1N25A 3FK6A 3RPUD 2VBJA 1R49A 1IXCA 2DDBA 3I0TA 4BEHA 1WCMG 3RAXA 1JHHA 4A6EA 3PN1A 4CCJA 3VSKA 2FF4A 1OFCX 1IN4A 1BC7C 4KFCA 2CQYA 2K4BA 4LH6A 1UG2A 2DA6A 2M5WA 3OYNA 9ANTA 2MG4A 4ZI7F 2XAQA 1SFEA 2M34A 2P5KA 3SDBA 1K4SA 5LOVF 2AGOA 1FOXA 4YB8B 4FT8A 2VBNB 4PSXA 2R7TA 4WXHA 1WFXA 1YLFA 4PCQA 3ZQHA 1SANA 4RBOA 2HYJA 1O3SA 2W6NA 2XPVA 3FXRA 5IP9G 3MR3A 4A3DG 5DG9A 3FM3A 3ZMDA 1YIOA 1EH8A 2ID3A 4FE4A 2L02A 4PGGA 5K1YA 3MR2A 2BVLA 3JREA 2BY3A 2OLSA 3ZCOA 1HCRA 2OJED 1TWCA 4JV5H 2YW2A 1SD6A 3ECOA 4DW6A 2KKOA 4OIOF 1I7NA 3JAMW 5LMNH 3DKYA 4KMUX 2HVSA 2VBJB 1YE9A 4AQYH 1FT9A 4NQWB 3AFHA 3KETA 4IQJA 3V6KA 4AIDA 4N4OB 2DK8A 2E7XA 2GBYA 4UUSB 3MKZA 2FNPA 1IOVA 4KZSA 3MXBA 3GTOJ 1FPQA 3K5HA 2EA2A 4ITVA 2ZDQA 2CG4A 4A69C 4HNTA 1YFHA 1U0JA 3FHNA 1DP3A 2MGQA 3QQYA 3P9IA 5KT5A 1U6GA 3L4KA 4B09A 4G6QA 3H5AA 5EDNA 4GGGA 2ZJQF 4LD5A 1Z1DA 3RTRA 4DR4H 3HRTA 4EM2A 3GX4X 1Z67A 2R7XA 1KU3A 4J00A 4RUCA 2HOAA 2X1DA 3JR9A 4XQFA 3RJPA 1Y39A 4FX0A 1H89C 1JTYA 1B59A 1BOBA 3OYDA 2CH0A 4FHTA 2Z9OA 4E2TA 2QK4A 2E36A 3F8CA 4ZZLA 1DP7P 5KFXA 1M5XA 4CCNA 3GTJA 2R7DA 4G8XA 1KZHA 4CXFA 5FGMA 3MXBB 3V4SA 1R1TA 2FBKA 2IA2A 4CCKA 3CCQI 4LG0A 5LD2C 2FP4B 2HDWA 1Y8QB 2H94A 4I76A 3I58A 4U87A 2VASA 5CQEA 2RDJA 4E2UA 2LSOA 4LQ0A 2EBIA 3CQZA 3H3ZA 1I1SA 1Y1WJ 4O2AF 2LY9A 4J9OA 3GIMA 1XSVA 3GILA 4MQVA 2A6TA 1XPXA 1R5ID 4MGRA 1OR7C 4B44A 1NG7A 3GIPA 4DL7A 1N75A 2LWYA 4BE0A 5HV6A 1J09A 1ZQ3P 1K1QA 3T1BA 1P92A 1LFUP 4HYKA 1FX7A 3DP7A 4LITA 5A2QZ 2FLNA 3TDUC 4GKKH 5DDGA 1I3QJ 1EYZA 2SCUB 2V6CA 2LP0A 2IMZA 4LG0B 3E6MA 2K7LA 2JUGA 3PR5B 1OCCH 2GM4A 5ED4A 2Q1ZB 1OCRH 4OIPF 3KO2A 4IWYA 4UFZA 3S1NJ 5GONF 4O6JA 1G3TA 5CB4F 2JJ7A 3GTGA 2NRAC 4IL6C 2C6YA 4NUBA 3NAUA 3M4IA 4AIHA 4FTHA 4KIGA 2BOLA 4IHWA 3F72A 2QQAA 2K02A 2KLOA 5EZHA 5CQGA 2R5ZB 4DV1H 3V4ZA 3CVZA 4D1QA 3GTPA 1DGRM 3NARA 2QLZA 1MNDA 3HGGA 5EG0B 4MV1A 4F4YA 2DFEA 3FDSA 4YFKF 1Y1VJ 5IY5H 4A3IG 1S9FA 1KEEA 2FXAA 4FS1A 3IKVA 4DBRA 3R5XA 2CSOA 5FD6A 3K9TA 2R7LA 3MWMA 3C2BA 3C7JA 3BR0A 4OOIA 3DTKA 3IV5A 2KIFA 1DV2A 2FMYA 3V8LA 4O5VA 2TRTA 4BXFA 4ZH4F 5D5UB 1PDNC 2LY1A 5LLQA 5A0MB 2AQ4A 3T8TA 4HV5A 1SEUA 2L7MP 1PJRA 1ZGAA 5ICGA 1ETYA 4BUPA 1Z3YA 2KT0A 2PI0A 1N3EA 4DLKA 2M30A 3PUFA 4A5NA 4C3HJ 3LAJA 1USTA 3JCUC 4I7HA 4KT6A 2ZJPF 1G9YA 2QYZA 3G6XA 2Q2UA 2EINH 1QHHD 5LEJA 3TO9A 4J01A 4RZQA 2VL8A 3PUBA 1GYFA 3I59A 2BR0A 2DFFA 2J5PA 3WTXC 4L9NA 3GLLA 2VPQA 3RIZA 4P1WA 1WH7A 3EDPA 4EEFG 4MV7A 3GMEA 1W0UA 3X2QH 4B3XA 2VKEA 4D0PA 3F22A 2E1CA 1O4XA 4J9RA 2JEIA 1WZ2A 4DV5H 3QAHA 1SFKA 5F6FA 2W7NA 4UN8A 2QQ8A 4WXCA 3M3YJ 3PFYA 3I54A 4UVCA 2XAGA 1RESA 1MMNA 1TAEA 1YYVA 2R7MA 2ZCWA 1OJLA 5C44G 1IN5A 2IT0A 1RR7A 1W5CC 3BZKA
chains in the Genus database with same CATH topology
1MW7A 2AQFA 3CMMA 5HNFA 4NC8A 4Y4RA 2VQFH 2KRHA 3K6GA 3W2AA 2E1MC 3C0FB 2WE6A 2MFZA 1BJTA 2CUZA 3IAM2 4HSTA 1N32H 1TA8A 2ZM6H 1MMGA 1WJCA 2WA0A 4YEJA 1BGWA 3J81W 2UUAH 3HOTA 1VZ0A 4PJJA 2LBFB 3LFUA 4KL6A 1N3FA 5D1OA 5CKTA 3MKWB 1MNEA 4LH7A 1DQ3A 2WAQA 4YY3H 2V9KA 3S3MA 1QU3A 1M0TA 4DIQA 2VBLB 3PL8A 2KDOA 4BQOA 4LF5H 4MTDA 3OL4A 3VYRB 2V4JC 4PJNA 3L2VA 2HPIA 4UN9A 3IGDA 1ZELA 3H9GA 4DBQA 4F55A 2DCEA 3CESA 4IZZA 1P8LA 3FBNB 1S68A 3JSLA 4DV2H 4JYAH 4X62H 2Y0SA 1LWTA 3L2WA 4BWSC 3QYBA 1X1CA 4Y33A 4AABA 1NG6A 3D5LA 3K4JA 2VBOB 1V5EA 4HG2A 1T9IA 4UCTA 4AADA 4RM2A 1LFPA 2KHMA 2M7AA 3W3CA 1LWSA 3EUAA 4XORA 4O1SA 3FKJA 3H5RA 5D1OB 4EEQA 2R7UA 3LMLA 3EPZA 4MV9A 4J0MA 5TGTA 4DR3H 2X1CA 1ZDEA 1I6UA 1U0CA 2M0MA 1G9ZA 4X66H 1TZLA 3CP2A 3H9QA 2GOXB 1X9NA 3SEZA 4BQQA 2WADA 3BLYA 2ZXIA 4BL0B 5E67A 2JVHA 4RB0A 1L2ZA 4RLFA 4BACA 3LSIA 5IWAH 3U21A 3PNVA 4PJMA 4X0GA 2Z1DA 3F9KA 4Q0YA 3AL0B 1Z2PX 3RJ0A 1BR2A 2UWMA 1D0XA 2DOAA 2MCTA 3ZRGA 3K70C 2UUZA 3DU5A 3HXLA 2UUCH 2X51A 5A0MA 3UQ8A 2Q2TA 2CW8A 3BAAA 4BJ5C 3ZQQA 1AN7A 3OYIA 4DUZH 2MD0A 1MI8A 4ZYAA 4BGDA 2VLAA 3OYFA 2OV7A 3LSMA 2QKLB 2KSWA 2E5ZA 3M1CA 1O75A 3MXAA 4AAGA 3T1HH 1AA7A 3OORA 5AK9A 2VS8A 4DR5H 2A5WA 1DFAA 3PNYA 3LSKA 2CW7A 4BJ6C 2WY7Q 4JI0H 4H4KC 2R7RA 2PJRA 3TBIA 4LSAA 4XM3A 3PNTA 4KL5A 2XF5A 4UT0A 3ONQA 4CC6A 1WJBA 2E1MB 2DXIA 3VYUB 1EA3A 2LYCA 3OYKA 2IGKA 2JNQA 1SAUA 1VDEA 4FM9A 3LSGA 4LF9H 2X6YA 2L5QA 1V5FA 1D1AA 2VJJA 2VJ4A 3MKYB 2EX5A 3NWTA 5AKMA 4NXMH 4XOTA 4YISA 1R7MA 2AQEA 3RCOA 3S8PA 1HA8A 2CFOA 3UR3C 4DGWB 3KXYT 4XL9A 4XLAA 4R79A 4FETA 3FD2A 1KONA 3HOSA 5HNHA 2KPMA 2X85A 1AT0A 4IX7A 2BVMA 4CA0A 4PK4A 2M3AA 3DEEA 3FMAA 4YRVA 5A72A 2X1EA 3OYEA 4XLHA 5AKFA 3L2PA 2K3PA 1SYXB 2ZXHA 2QOJZ 1IRXA 4PDBA 4QPOA 1WJDA 5KNLA 2L9NA 3W2WA 3BABA 4C2TA 4DR2H 4GLXA 1XMQH 2X6WA 3K4CA 4BDZA 4AAFA 1X4OA 4Z1XA 4CC5A 1X19A 3QODA 2R7OA 2LCJA 2VXZA 4JI8H 3C0WA 2VBLA 1K6YA 3VYSB 4CUGA 3PJRA 2XE0A 4BDYA 4DV0H 3OS0A 5EOYA 3BCBA 4DV3H 1AF5A 4RMNA 1IBLH 4LIVA 1Z2NX 4CH7A 3L2QA 2X6XA 3K4LA 4II3A 4LMYA 2VQHA 3IUOA 3NWSA 3OOLA 1YX3A 2V7FA 4ZJZA 2LOOA 2MABA 4G6TB 4E7LA 4AAEA 1E4FT 3I9V2 3VDXA 4B47A 2VBOA 3CP8A 4BS9A 4E7KA 4OZ6A 4UCOA 3EYYA 2HU9A 4YHXA 3TMOA 3C2HA 3OYCA 4DOZA 3MIPA 4JI6H 2HZDA 3JSNA 4NXNH 4BEHB 3H35A 3N05A 4XONA 5KCMA 2WY8Q 3KYLA 1MOWA 1BP7A 1HR0H 1XNRH 3N43B 3A1YA 2VJ5A 4ZDLA 4CCOA 2VQLA 4M7EA 2XE0B 2DT6A 3S32A 1B04A 4D9JA 1V9PA 5FROA 3N44B 2CMPA 3IAS2 2IXSA 5E5OA 1R6RA 3QYEA 3VYTB 1UELB 3N41B 4YHHH 2F4VH 1QHGA 2ZFUA 4D6OA 1Z3XA 4NNJA 1FVIA 3OR1C 4XN0A 3HPGA 2VPSA 2VIXA 2F6CA 4CCLA 2FE3A 5A2QW 4DV4H 4B48A 5LL6b 2ZSHB 4PSWA 4FASD 3OY9A 1DGWY 3OYGA 1BR1A 3K4KA 4KITB 5FLXW 5AKNA 2RGRA 2I3PA 4YITA 3W2VA 5A77A 2V26A 4BU2A 1ZHQA 4AQXA 4AVZA 4F91B 4LSXA 2Z16A 2CS3A 3CJQB 4JI3H 2HNHA 4C2UA 4C30A 1LDKB 2WBMA 1Z2OX 3RGXA 3DLAA 5FPOA 3L2UA 1LVKA 4RM3A 3MISA 4OAZA 3VWBA 2YCHA 4XOPA 1W36C 4E7HA 2WDTA 2E5NA 2V1NA 2IS6A 3F8NA 4JI1H 4LG3A 1T95A 3N42B 1N34H 3UNGC 4JQFA 3J80W 4XLCA 4N4NB 1MMAA 1E4GT 1WH2A 2CV0A 2IS2A 3K4BA 4X65H 4KJZA 4OAYA 1FMVA 1E0EA 2VS7A 2VUGA 4RB3C 3CZ6A 4ZDOA 3BG7A 4D6NA 2W82A 4ZTFA 1S03G 4RLQA 4GIGA 2FUG2 5LFAA 4DUYH 3PSIA 4XMYA 4BE1A 4LF6H 1FMWA 1WJFA 1X1BA 4F52A 4BE2A 2UV1A 2OUMA 2Q2EB 4BJTA 5E5SA 3OL3A 5FRMA 4R7RA 3DWLE 1HNZH 5HOOA 4O1RA 1WJEA 2RQQA 4HPQA 2WAFA 4CCMA 4DR7H 3VSLA 1N33H 1I94H 4UN7G 1XDNA 4DR6H 4EFEA 4DV1H 4XKCA 1P9QC 2K9LA 4YELA 4QPQA 3L2RA 3K70D 3J7AY 3DTIA 1B24A 3OR2C 1Y6IA 2OC6A 4ANJA 4E6KG 4E7JA 2IGNA 2KMUA 3HC7A 4XN3A 3OYAA 1Z7LA 2K5CA 3D5SC 1G8XA 3S3NA 4JOMA 2LRDA 4XLFA 2WYOA 2IGMA 2E60A 1X1AA 1VS0A 3I3LA 1UAAA 2O7MA 5LMUH 1HNXH 4E7SA 2VQGA 1Y56A 4B43A 2R7VA 1Z21A 2VQEH 2XDVA 3DU6A 3ZGKA 3A2KA 3G2BA 3BA9A 3DF7A 2LC2A 1UG0A 1EF0A 2UXBH 1XMOH 2DJIA 2VXDA 4UCUA 1N77A 3DQVC 2IN8A 1U0DA 3OMYA 3K3VA 3J7AK 1IBMH 3D5RC 2ELJA 2CV1A 3BA8A 4UNCA 4B3MH 4Y3OA 4K0KH 2VQCA 4AQUA 3AKZA 1S9HA 3DPTA 4ZTJA 4UNBA 4UCRA 2XAUA 3NZMA 1LKXA 4RAZA 3K4MA 4LFCH 2VB6A 3C0XA 4E7ZA 2KEQA 4B3SH 1GLNA 3RPUD 2LH9A 2VBJA 3E1SA 4BEHA 2IS1A 1J5EH 3HL2A 4JI4H 3OS1A 4IKFA 3PN1A 3ZR8X 3VSKA 4CCJA 3OTOH 2UU9H 1YX5A 3KALA 4LH6A 3HYIA 3EUKL 4XKBA 3OYNA 2NOJB 5CPRB 1XNQH 1G59A 3SDBA 2F4IA 2WB1A 3UVFA 1X1DA 2VBNB 4PSXA 2R7TA 1WFXA 4E4HA 5A0WA 4IAJA 2E5LH 1MMDA 3OYHA 2HPMA 3H5NA 4RAYA 1P8KZ 2BVLA 3HKZA 2R4GA 4XKWA 1OLTA 1HNWH 3ZCOA 3S93A 3IP4B 3T1YH 4JV5H 1DQUA 2IN9A 1WJAA 5LMNH 3V42A 1GPPA 2O03A 3JAMW 4UNAA 4LOXA 2W00A 3DKYA 2KQRA 3HG9A 2HVSA 1YE9A 3OS2A 3HYJA 2VBJB 4APMA 4AQYH 3OYLA 2JA2A 1ZD7A 4NQWB 4B3TH 2BW3B 2Z2SB 3AFHA 3HPHA 4LIUA 3M8JA 4IQJA 5FRNA 4N4OB 4AU7A 3MKZA 3SEQA 2HVRA 4HRIA 3HUGB 5E63A 3MXBA 3SYTA 4DV7H 3L4JA 4ITVA 3RSNA 3EUHC 4HNTA 2UXCH 1U0JA 1D0ZA 3FHNA 1DP3A 3QQYA 2PMZA 3E54A 3KX2A 4BQNA 1ERDA 2DT7B 1D0YA 3H5AA 4GRIA 1AM2A 5A74A 3C2GA 3KAKA 4GKJH 3RTRA 5I0AA 1T9JA 4DV6H 4DR4H 2R7XA 3A4CA 4UN8G 2KP6A 4J00A 4C9YA 2X1DA 4XQFA 2JSPA 4MTEA 4HNUA 2UUBH 3OYDA 1BOBA 4HEA2 1MZBA 2CH0A 3K4NA 4F92B 4DR1H 4E2TA 4OWRB 4RB1A 3E0JB 3GBGA 1M5XA 2R7QA 2ZSIB 4CCNA 3MXBB 2RGVA 4CCKA 2VKDA 5LD2C 4LF4H 3H20A 2HDWA 5CQEA 4U87A 4EFJA 2MYSA 2VASA 2HGSA 4E2UA 3OYJA 4LQ0A 1SEIA 4EATA 2OWOA 5A78A 3EH8A 1V5GA 3N6XA 3RQ4A 2A6TA 2LQMA 2LY2A 1IBKH 1OR7C 2R7SA 1TT0A 2MC4A 4B44A 4CSWA 4F3QA 1NG7A 4UN7A 2QKMB 2I3QA 4CZCA 1N75A 2LWYA 4BE0A 2XF6A 2DCHX 1J09A 3OIQA 2LREA 2LG4A 4E7IA 4UN9G 4JI7H 3PSFA 4LITA 5HVQC 2IS4A 1ZHSA 4B3RH 4GKKH 4AYBA 1W36D 2L8LA 2IMZA 3RF2A 3H9JA 4XNFA 3DTEA 1D1CA 3DPLC 2JUGA 1UM2A 1WJ5A 2RNGA 3LMMA 1FJGH 4PUSA 2HVQA 2Q1ZB 2AB5A 2XIGA 2UXDH 5IT9W 2W1OA 3KO2A 4A2BA 4UFZA 2JVGA 4LFBH 1X4PA 2W4SA 5K08A 4NUBA 4XKVA 3M4IA 4UCVA 1JI8A 2M4KA 2XF7A 1FKAH 3KEYA 2BOLA 4IQ4A 4Z20A 1DGSA 4KHPH 3RGZA 2HHHH 2KLOA 5CQGA 2RREA 2XSJC 4PFPA 2VPLA 3CJRB 2V6EA 2M4GA 3QOEA 4D1QA 4ZDPA 3CVZA 3IG0A 4ETSA 1DGRM 1MNDA 3DPUA 3FBIB 5KHDA 2R7WA 2VOBA 3MD2A 5D1PA 1T0FC 3CF2A 1A0IA 3OOUA 2VBNA 4DBRA 3OIPA 4JI2H 5BR8H 1D1BA 4MLOA 3FDYA 1BR4A 5FD6A 4X64H 3BCAA 3MWMA 4PFOA 3ZXSA 2KRCA 2L2OA 2XC7A 4DJAA 2JMZA 4Z1ZA 3DTKA 4A2AA 3BC8A 1PYVA 4PJLA 4BXFA 2KL4A 4KISA 2LY1A 5A0MB 3LSHA 4OX9H 4LF8H 1PJRA 2IGOA 2P0WA 2CV2A 1M0WA 3MMYB 4BUPA 1Z3YA 2W57A 5FPRA 2BW3A 1N3EA 2O5RA 3DKXA 2HQAA 3S3OA 4KT6A 1G9YA 4I7HA 4UCSA 1N36H 2M7BA 3SZGA 1QHHD 3R7PA 2Q2UA 2F5VA 2L7KA 3AL0C 4P5OA 5FD5A 3OYMA 4JI5H 2K9MA 3OWTA 4J01A 4RZQA 2VL8A 3PUBA 4U7BA 2PJRB 1GYFA 2IN0A 3RIZA 4P1WA 3KAJA 2GOMA 4MV7A 3TL4X 1JVAA 4XLEA 3BG6A 4B3XA 2LBFA 3K10A 3LL7A 5HLTA 4RB2C 4F93B 4LF7H 4EFBA 3IFJA 3N40P 3RTXA 3QYFA 4DV5H 1SFKA 5JHFA 4ZC3A 4II2A 3H0DA 2I8DA 2W7NA 4UN8A 3MX9A 3PFYA 2ZJTA 1MMNA 4NC7A 1TAEA 2KZVA 4HSRA 3L4KA 2CUJA 2L9SA 2FLDA 2VJIA 2WAEA 4XR6A 2VKHA 4LFAH 1N78A 3OYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EFJ A;  4O1R A;  1AT0 A;  4E2U A;  4LQ0 A;  4UN7 G;  5A78 A;  5A72 A;  3EH8 A;  5AKF A;  1B24 A;  2LQM A;  2QOJ Z;  4AQX A;  4YHX A;  2IN8 A;  4KL6 A;  1N3F A;  2I3Q A;  4UN7 A;  4AAF A;  2LWY A;  4Z1X A;  1DQ3 A;  2DCH X;  4UN9 G;  2O7M A;  2LCJ A;  3C0W A;  2VBL B;  2VBL A;  2XE0 A;  1EF0 A;  1AF5 A;  2L8L A;  2IMZ A;  4UN9 A;  3IGD A;  1UM2 A;  1U0D A;  4UNC A;  1LWT A;  2AB5 A;  3OOL A;  4AQU A;  3KO2 A;  4AAE A;  4AAB A;  4UNB A;  2VBO B;  2VBO A;  5K08 A;  4OZ6 A;  3NZM A;  4AAD A;  1T9I A;  3C0X A;  1LWS A;  2KEQ A;  4O1S A;  3MIP A;  2VBJ A;  4Z20 A;  1MOW A;  1BP7 A;  1ZDE A;  1U0C A;  1G9Z A;  3HYI A;  2XE0 B;  5E5O A;  5E67 A;  3UVF A;  2VBN B;  2VBN A;  5A0W A;  4D6O A;  1P8K Z;  2JMZ A;  4Z1Z A;  2IN9 A;  1GPP A;  5A0M B;  5AKN A;  4UNA A;  5A0M A;  4LOX A;  3HYJ A;  2CW8 A;  4YIT A;  2VBJ B;  5A77 A;  2I3P A;  1ZD7 A;  1N3E A;  1MI8 A;  1G9Y A;  3MXB A;  5E63 A;  3MXA A;  4AAG A;  3R7P A;  2VS8 A;  3OOR A;  5AK9 A;  3MIS A;  1DFA A;  2CW7 A;  3QQY A;  2IN0 A;  3E54 A;  1AM2 A;  5A74 A;  1JVA A;  4KL5 A;  5I0A A;  4UT0 A;  1T9J A;  4UN8 G;  2JNQ A;  3IFJ A;  2VS7 A;  1VDE A;  4D6N A;  2EX5 A;  4E2T A;  4GIG A;  4UN8 A;  5AKM A;  3MX9 A;  4YIS A;  1R7M A;  1M5X A;  3MXB B;  3FD2 A;  5E5S A;  2FLD A; 
#chains in the Genus database with same CATH topology
 2AQF A;  2EFN A;  2ELH A;  2CFX A;  4RDU A;  3Q1K A;  4ED1 A;  3W2A A;  3V7C A;  3M9N B;  1T0F A;  3I59 B;  3S16 J;  2RKH A;  3JTG A;  2YU3 A;  3H1C A;  5E17 F;  6PAX A;  4JX4 A;  1FEX A;  5IYC J;  1UC8 A;  2CW0 F;  3T5X A;  3KLN A;  5FLX K;  1JXL A;  1XTA A;  2V1X A;  4ECR A;  4I0A A;  1HW2 A;  2V58 A;  1IUY A;  1IUF A;  4FE7 A;  1VQO I;  2XRL A;  2H8R A;  4JX6 A;  4MIM A;  1M0T A;  4DIQ A;  3BRO A;  4BQO A;  3KEQ A;  5JVL A;  4EJO A;  2OF7 A;  1T98 A;  2XGX A;  1B9N A;  3ETJ A;  2H6B A;  5K2M A;  2DA7 A;  3H0G G;  2VBY A;  1P2F A;  3J80 K;  3L1P A;  3L2W A;  2NNY A;  4BWS C;  5K7Z A;  1BNC A;  4Y33 A;  1NG6 A;  4DYR A;  4BY7 J;  4RNN A;  1XMX A;  2VBO B;  2BQ3 A;  2D45 A;  4UCT A;  1X3U A;  3H3V H;  4N9H A;  4FCY A;  3TO7 A;  4S0H B;  1NK3 P;  1XC5 A;  4I50 F;  5LP6 F;  5CVJ A;  2YS9 A;  2W8K A;  3FKJ A;  4YIR X;  2RNJ A;  2IRF G;  4EEQ A;  3KLO A;  3LML A;  4Q8F A;  4UNO A;  4DR3 H;  2VUM J;  1B72 A;  2X1C A;  1U0C A;  2M0M A;  5B5E C;  3GID A;  1RK5 A;  2V9V A;  4LFU A;  4LGW A;  3H9Q A;  4J19 A;  1SMY F;  3SEZ A;  1ZRC A;  5KFG A;  2ZXI A;  5E67 A;  1W7P A;  2JVH A;  4ZOL F;  1L2Z A;  3GFM A;  1BBY A;  2D5V A;  5IT9 K;  3HOY G;  2LFB A;  4X0G A;  1JJ8 C;  5BPF A;  4BXX J;  1T2K A;  1AWC A;  2JK3 A;  4YAJ B;  4I6Z A;  5GAD J;  2Y30 A;  2ESN A;  3RKX A;  4IOA F;  1CQT A;  1BI0 A;  2DW4 A;  4B8X A;  2UWM A;  2WTF A;  1EV7 A;  1KYZ A;  2GA1 A;  2V1D A;  5HBR B;  3Q9V A;  2R7N A;  1FP1 D;  2Q2T A;  5D5V B;  1U9N A;  1VQ7 I;  4R8U A;  3HRM A;  4LX3 A;  1AN7 A;  4TUY F;  2BQU A;  2OTJ I;  1B72 B;  2MD0 A;  5KFN A;  2V4Q A;  4ZYA A;  1VQ6 I;  3GV8 B;  3OYF A;  5EWE A;  2QKL B;  3ASO H;  3ERM A;  4AAG A;  3DBL B;  1TWA J;  5AK9 A;  4PGH A;  3SI8 A;  2UVR A;  1WCM A;  1W7P B;  4EBC A;  2RN7 A;  1JJ6 C;  5KFP A;  1ETQ A;  2DMQ A;  3OV8 A;  4OU0 A;  4BJ6 C;  4GXO A;  4A12 A;  3ORR A;  2QSF X;  1QGP A;  1KC7 A;  3BG3 A;  1LQ1 A;  3V6J A;  3TBI A;  2M87 A;  3BPV A;  5KFV A;  4XM3 A;  2YX7 A;  4LLG F;  4O3Q A;  1D8K A;  2NS8 A;  3TO6 A;  4C2M J;  2FLL A;  2NUA B;  3ZP5 A;  3OYK A;  1SAU A;  1VDE A;  1OCT C;  5F1R A;  1VQ9 I;  3MFI A;  3MKY B;  1BA5 A;  1T36 A;  5HS7 A;  1GT0 C;  4QW9 A;  1PP7 U;  3TW7 A;  4NXM H;  2MLG A;  3TOA A;  4QSH A;  2A68 F;  3S8P A;  3PFI A;  3OUU A;  1BI1 A;  3UR3 C;  1ULZ A;  3BQZ A;  2NVT J;  5E1Z B;  1P4X A;  1KON A;  2W71 A;  4ZQI A;  4ECV A;  4Y52 J;  3I4M G;  1SFU A;  3HOS A;  3WO0 A;  2KPM A;  2RAE A;  1WGX A;  2EZK A;  1AT0 A;  2C2E A;  3RDI A;  4IX7 A;  3BZC A;  1HDP A;  2CRG A;  2JPC A;  4EM1 A;  3GTK A;  3GO5 A;  3FMA A;  5EWF A;  3OYE A;  3CJT B;  5KFE A;  3COA C;  4HLY A;  1SYX B;  4WD3 A;  5DG7 A;  2ZXH A;  2OA4 A;  2QOJ Z;  2YYA A;  4G94 A;  3CCL I;  3HJE A;  3JAM K;  1JDB B;  4PDB A;  3BAB A;  2FJ1 A;  4DR2 H;  4AAF A;  4A3C G;  1TWH J;  1X19 A;  3QOD A;  3ZMT A;  2C2R A;  2R7O A;  4XYM B;  4YJ3 F;  3KHH A;  3RB4 A;  4KA4 A;  2VBL A;  1K6Y A;  3VYS B;  3PJR A;  2IA6 A;  1JT6 A;  5EOY A;  1TNT A;  1UFM A;  2FOW A;  2EA4 A;  3FMS A;  5IOY A;  4GFB A;  1H88 C;  5KFO A;  2BE5 F;  5L1L A;  4II3 A;  3G1L A;  5BPD A;  1N48 A;  2W48 A;  3QP6 A;  3V8K A;  4ZJZ A;  3TED A;  3OOL A;  5BQT A;  4E7L A;  4HX7 A;  3SZT A;  3I9V 2;  1MNM C;  4MV8 A;  3CP8 A;  4OZ6 A;  2HYF A;  2HU9 A;  1S7A A;  5E3L A;  1B6R A;  2R86 A;  5KG2 A;  4YP3 A;  3SFZ A;  2YZM A;  5AIP A;  2QBY A;  4NHJ A;  1QRY A;  3H35 A;  5KCM A;  5E8I A;  1MOW A;  1HR0 H;  2DO7 A;  4ZDL A;  4HNV A;  3KHL A;  4ZYD A;  5IP9 J;  3L2C A;  2PBI A;  3EYI A;  4A3D J;  2NAZ A;  5ICC A;  1B04 A;  4D9J A;  2JA8 G;  3CCM I;  1QZY A;  2IXS A;  2VQD A;  3VYT B;  4YQW A;  5DM7 F;  5FKL A;  1U8R A;  1RET A;  3OSG A;  3LP8 A;  4YHH H;  4G7Z F;  1QHG A;  5EZY F;  4D6O A;  4NNJ A;  1FVI A;  1R4M B;  3B6A A;  4IRK A;  2XGP A;  4PDK A;  3IRR A;  3FKI G;  4UVB A;  4ENJ A;  1S7E A;  3GTM J;  3RBE A;  1FYM A;  3ZQL A;  3KZZ A;  3RBD A;  3K4K A;  1HKQ A;  1KJI A;  5KFU A;  4YIT A;  2QBY B;  3K5I A;  4TQR A;  2CYY A;  4L5J A;  4CHU A;  1B6S A;  4FBU A;  2Z16 A;  1KU7 A;  2EB7 A;  3TOB A;  1FSE A;  2HNH A;  4DNC A;  3J81 Z;  3DLA A;  5FPO A;  5CVU A;  3L2U A;  1F43 A;  1TW2 A;  1RKW A;  2XAF A;  4WF2 A;  1GHC A;  2VR1 A;  5DQH A;  3BWG A;  2F4M B;  3TQT A;  2VA3 A;  4RNM A;  1HST A;  2E5N A;  2E2H J;  4AM3 A;  3F8N A;  2PMU A;  4JI1 H;  4LG3 A;  3UNG C;  3CDI A;  2JQ7 A;  2GXG A;  4XLC A;  5JFR A;  3DV8 A;  5J4Y A;  1MMA A;  1AU7 A;  2EZH A;  3FXQ A;  1EUD B;  1FMV A;  4IO9 F;  1JKQ C;  2VUG A;  3H40 A;  3CZ6 A;  3ETH A;  1I6H J;  1IO2 A;  2GXA A;  3VPC A;  1S03 G;  4GIG A;  1GXP A;  2FUG 2;  1RJQ A;  3PSI A;  4BE1 A;  1FMW A;  3DCF A;  5FFX A;  4BE2 A;  3G6E I;  5EZG A;  1ETX A;  4R7R A;  3WTY C;  3PIO F;  1DIK A;  2IEK A;  2DMP A;  3SQN A;  1ONV A;  1WJE A;  2DI3 A;  2K40 A;  2OH2 A;  2RQQ A;  3T0Y A;  2R7Z J;  3U1K A;  4DR7 H;  1N33 H;  3BG5 A;  1I94 H;  4DR6 H;  3C1D A;  4EFE A;  4QPQ A;  4IHV A;  3KP5 A;  1W4M A;  1HXD A;  1P4A A;  2CKZ B;  3OR2 C;  4E7J A;  2OC6 A;  4E6K G;  2KMU A;  5LL6 b;  1D5V A;  2K5C A;  2WYO A;  1GGO A;  3QPS A;  5DYM A;  4J9N A;  1ETV A;  1MH4 A;  2E60 A;  3FMR A;  5LMU H;  5LHI A;  2AGQ A;  3VFZ A;  5M5Y J;  2K9N A;  3FXJ A;  4G7O F;  5DM6 F;  5KFF A;  3WTS C;  2GLT A;  3HOX G;  2LC2 A;  2BQR A;  1UG0 A;  1EF0 A;  2UXB H;  3ABL H;  1N77 A;  3M9O B;  4P55 A;  3J7A O;  5L3B A;  4N9I A;  1ZHF A;  4O3M A;  3ZQC A;  3OMY A;  4ZHQ F;  3J7A K;  5H80 A;  5CAE B;  2CV1 A;  4BQA A;  1FJL A;  4UNC A;  4B3M H;  1UNN C;  3BR2 A;  1Z77 A;  3AKZ A;  5FLM G;  3DPT A;  1YIT I;  2JEF A;  1LKX A;  4LFC H;  1IRZ A;  5KFQ A;  1EF4 A;  4ENM A;  1GLN A;  2CZG A;  5KFZ A;  4I98 B;  1S0N A;  2WV0 A;  3WGH A;  4C3I J;  3G6Y A;  1Z6R A;  3LAP A;  5HS9 A;  2XPW A;  3HL2 A;  1KJ8 A;  3OS1 A;  4IKF A;  2R8K A;  4QIW E;  2KRF A;  1J0R A;  2YUS A;  3HYI A;  1I7L A;  2E19 A;  5D8K B;  4A0Y A;  1G59 A;  2RDI A;  2F4I A;  1RYS A;  3UVF A;  3TDZ C;  5GTH C;  4MEX F;  5A0W A;  3LWB A;  3R5H A;  2HPM A;  2LNB A;  1J2X A;  4NC6 A;  2HZT A;  3HKZ A;  2DZD A;  1OLT A;  5HOD A;  3PR4 A;  3S93 A;  1ITY A;  3I71 A;  2YU9 J;  2PG4 A;  1DQU A;  2DA5 A;  5HDK A;  2ACJ A;  3GIK A;  1TWF J;  4Z2Y A;  5L3E A;  3CDH A;  3FZV A;  1B8I A;  3HYJ A;  4LOX A;  5DQG A;  1IRF A;  3HG9 A;  3P7N A;  3K69 A;  1YOV B;  3P9K A;  4K0K H;  4IRD A;  1A6Q A;  3HPH A;  3GWZ A;  3M8J A;  2BXY A;  4XZ3 B;  1EH6 A;  1XDU A;  2CU7 A;  4AU7 A;  1HW1 A;  3N4M A;  3ZOB A;  5KFS A;  3OOP A;  3QFF A;  2VT3 A;  4A3M G;  3SYT A;  1QBJ A;  4G12 A;  1LNW A;  4V19 K;  3EET A;  3WO1 A;  1ORK A;  5M3M J;  1VQK I;  1KQ0 A;  5KAF C;  1PUF B;  2QGU A;  1ZN2 A;  4Q47 A;  3SDG A;  1OMI A;  1S3J A;  2OU2 A;  1QNT A;  5KFJ A;  2JPB A;  2K3F A;  1A5J A;  2DJN A;  2HOT A;  3J7Z I;  4ED6 A;  4U7D A;  4HLX A;  1FC3 A;  2KP6 A;  4UN8 G;  4FU0 A;  1EUC B;  2DMT A;  2FA5 A;  2Z3Y A;  4B4C A;  5DS9 A;  5M5X J;  3Q5F A;  1T94 A;  1B8I B;  3J7Y J;  1O3R A;  2FB9 A;  2PN1 A;  3R23 A;  2W9B A;  4F92 B;  4OWR B;  1LUJ B;  1ZR2 A;  1T33 A;  3MQ0 A;  3PIP F;  4KMF A;  3E0J B;  3JZI A;  5KG3 A;  2ZDH A;  4QWC A;  2A05 A;  1NH3 A;  4LF4 H;  2X9D A;  3H20 A;  4M9U A;  3DLL F;  1I50 J;  4EFJ A;  2MYS A;  4GO1 A;  2HGS A;  2A69 F;  5IPA A;  1SFO J;  3WTT C;  3OYJ A;  4E70 A;  1RJP A;  4UHT A;  1FNN A;  1BJZ A;  2C28 A;  1ZAO A;  4IHT A;  1R22 A;  4KIC A;  3DF8 A;  3I56 I;  3EH8 A;  2AU0 A;  3N6X A;  4EYH B;  1RKT A;  3RQ4 A;  2XKO A;  1A31 A;  2LY2 A;  5CLS A;  1QPM A;  3OHA A;  1IBK H;  1W96 A;  2I3Q A;  4F3Q A;  1P4W A;  4XRM A;  1YJW I;  2D1H A;  2QKM B;  2O9L A;  4UN7 A;  2VT2 A;  2F4O B;  2XF6 A;  1TC3 C;  1RUN A;  2C00 A;  1M6V A;  2LRE A;  4OIN F;  1EH7 A;  4E7I A;  2W9B B;  4JV2 A;  1TP4 A;  1H9G A;  2Y0S N;  3HSR A;  4DYC A;  5EGO A;  4ENN A;  4JI7 H;  4QLC U;  2O8X A;  3CMY A;  3H0G J;  2IS4 A;  3RV3 A;  5K7F A;  2L8L A;  1I1G A;  3RF2 A;  3CMA I;  1ZR4 A;  2BY2 A;  1D1C A;  2DA2 A;  3DPL C;  3M7G A;  1Z9C A;  2V4R A;  4F4Z A;  2RNG A;  1GV5 A;  3LMM A;  3KEO A;  3A03 A;  3WGI A;  4PUS A;  2HVQ A;  3ROU A;  3JRA A;  2AB5 A;  2R82 A;  2VOP A;  2V9W A;  3S15 J;  4J9P A;  4A2B A;  5IT9 W;  1ZGJ A;  3EUH A;  4LFB H;  3HOV G;  1H8A C;  3PQK A;  1X4P A;  5K08 A;  2IA0 A;  4O3P A;  2K4J A;  5BNG A;  2AS5 F;  2EIL H;  2M4K A;  2O0Y A;  4UV8 A;  2OPT A;  3KEY A;  4BBS J;  2PVP A;  1FKA H;  5IT3 A;  1FBQ A;  2Y31 A;  3QPH A;  2KZG A;  2L4M A;  4O3O A;  1S29 A;  3CJR B;  2M4G A;  5EGO B;  1UHS A;  3O2P E;  1DPR A;  4PWQ A;  4UVA A;  4A6D A;  1T0F C;  4Q5S F;  1REP C;  4CDG A;  2VBN A;  1K4T A;  4JI2 H;  1XMA A;  4Q48 A;  2NVX J;  4MLO A;  5BS6 A;  2R93 G;  2UZK A;  1MJB A;  4JV1 A;  3BCA A;  3F8F A;  5L1K A;  2GLO A;  4PFO A;  4LK0 F;  5ERI A;  3ZXS A;  2VA2 A;  2ZNY A;  3U9S A;  2JMZ A;  4ECS A;  1U8B A;  2HXO A;  4M71 A;  4QIW N;  3GTO A;  4ED7 A;  1R1V A;  2KL4 A;  2FNA A;  3CCS I;  1JGG A;  2F48 A;  4RU9 A;  1LEB A;  3SJM A;  3TQN A;  4BH9 A;  2EPF A;  3E5N A;  4RGR A;  4TV9 F;  3T5J A;  3L00 A;  4NQW A;  2O5R A;  3DEU A;  4UUS A;  2HQA A;  3SHF A;  1CQI B;  2M7B A;  3SZG A;  2EFW A;  1EJ9 A;  1MJ9 A;  1OKR A;  4JI5 H;  4A93 G;  3OWT A;  3CC7 I;  1W93 A;  5HDG A;  2ZO4 A;  5IYB J;  5J1Y A;  1OIS A;  1IOW A;  1TNS A;  1KJQ A;  1TQI A;  4BY1 G;  2IN0 A;  1L0O C;  1FYK A;  1F9N A;  1D3Y A;  2QQB A;  5L9X A;  3U9T A;  4ECY A;  2MLK A;  1HKT A;  3E6B A;  3K10 A;  3LL7 A;  2ZJR F;  1ZLK A;  4RB2 C;  2YRW A;  3IFJ A;  4XSX F;  2I80 A;  3Q2O A;  1POG A;  5CVR A;  1IV6 A;  3FKI A;  1DV1 A;  3HOU G;  3K0L A;  3H0D A;  5C4X J;  3KP2 A;  2MH9 A;  4BAY A;  3IN5 A;  1Y1W A;  1C3O A;  3HOW G;  3ZQI A;  4J9M A;  1STZ A;  2DFH A;  5D6E A;  3FX3 A;  4EMS A;  1NK2 P;  2WAE A;  4J9K A;  5KAI C;  4LFA H;  2DOD A;  4A3L G;  2J9G A;  3OYB A;  2BEO A;  4NC8 A;  5DUK A;  3SFI A;  3KHG A;  4Y4R A;  3GQC A;  1OCZ H;  3JSO A;  3S1R J;  3KZY A;  1S72 I;  5BPI A;  2WE6 A;  1TWG A;  4PZJ A;  1ZGW A;  3H3V K;  1FP2 A;  1SVM A;  2CUZ A;  5FKM A;  1BJT A;  4HST A;  1ETO A;  4A3C J;  4L9T A;  2ZM6 H;  2WA0 A;  4L9J A;  3HTU A;  1XG1 A;  4KL6 A;  2YRX A;  5CKT A;  4IRI A;  1MNE A;  2L3D A;  2AXT C;  2K9Q A;  1DQ3 A;  5KFY A;  1WH5 A;  3M07 A;  2V9K A;  3HZJ A;  2A61 A;  4NBQ A;  1FZP B;  3WU2 C;  2LF8 A;  3PL8 A;  2NU8 B;  4LF5 H;  5H6R A;  4QW8 A;  5KFC A;  2Y2Z A;  4YJ2 F;  2W70 A;  1QZZ A;  2V4J C;  4M73 A;  3O3K A;  3L2V A;  2E7W A;  2HPI A;  5E3M A;  1ZEL A;  3H9G A;  4F55 A;  5JVG F;  2DCE A;  4IZZ A;  2JA6 G;  3FBN B;  3CC2 I;  4DV2 H;  4HF2 A;  4JYA H;  2Y0S A;  1MD0 A;  3RV4 A;  3I55 I;  5JVD F;  3H3U A;  2ASJ A;  2ZNZ A;  1X1C A;  2N8G A;  3D5L A;  1B1B A;  1BIB A;  5JHU A;  4RM2 A;  1LFP A;  4AAD A;  3CO7 C;  1ODD A;  3EUA A;  4IVN A;  4DQ2 A;  3I5U A;  4O1S A;  3ABK H;  3EPZ A;  3MZ8 A;  1J75 A;  3ISP A;  4HV6 A;  5LHH A;  4XID A;  2R5Z A;  1ZDE A;  5KK1 A;  4RAF A;  2HJW A;  1W1W E;  5LEK A;  1TWC J;  1G9Z A;  4X66 H;  5EG0 A;  1TZL A;  1FY7 A;  2FQ4 A;  2GOX B;  5FKK A;  5IP7 J;  3OUZ A;  1X9N A;  3BLY A;  4RB0 A;  2W6P A;  3G71 I;  3TIG A;  5T14 A;  4IHS A;  3Q8R B;  1YS6 A;  5F08 A;  2DA1 A;  4PJM A;  2PMZ E;  2QSH X;  3Q0U A;  4A3G J;  3RJ0 A;  3HOZ G;  1GXQ A;  2OQG A;  2YS6 A;  2BGC A;  1HDD C;  1JUS A;  1D0X A;  2B0L A;  1OQY A;  5KG4 A;  1K83 A;  3ZRG A;  1S97 A;  1AUX A;  5A0M A;  4U0V A;  3BY6 A;  3VOE A;  4BJ5 C;  3GVA A;  2R5Y A;  3TIN A;  4PJ0 C;  2P5L C;  2CQ7 A;  5E3N A;  1LE8 A;  1X1P A;  4MV4 A;  4U88 A;  2VLA A;  5D5W B;  4QIW A;  1JUP A;  4HF0 A;  2VS8 A;  4U0Y A;  1ETW A;  4GDF A;  1UCR A;  1A9X A;  2R8I A;  4ECZ A;  1I39 A;  1Z0X A;  3LOC A;  2XC9 A;  3G73 A;  4HDU A;  2R85 A;  4MA0 A;  3H92 A;  3GTJ J;  3H36 A;  4LSA A;  1CF7 A;  3RZD J;  1LB2 A;  3HM5 A;  4UT0 A;  2XVC A;  3WG9 A;  4CC6 A;  4M3B A;  1GSA A;  5K7H A;  1EA3 A;  2L7F P;  2NU6 B;  2IGK A;  3FXU A;  4IHX A;  4DZJ A;  2X6Y A;  1JX4 A;  2XPU A;  1D1A A;  4C5C A;  2R5Y B;  3V8J A;  2EX5 A;  4XYL B;  4JX5 A;  1LE8 B;  3KYD B;  2GA2 A;  2AQE A;  3CUQ A;  4CO8 A;  4QFQ A;  4BHB A;  2ECB A;  2F5C A;  5DGA A;  2H6C A;  2ZB9 A;  4M3F A;  5GPC A;  5FFZ A;  4ECX A;  1E3P A;  2FML A;  3KHR A;  2QEN A;  2LDU A;  2L9V A;  2IP2 A;  1VI0 A;  4CYD A;  2V5A A;  4YRV A;  5C3E J;  2X1E A;  3CUO A;  1CF7 B;  5A72 A;  5D6F A;  5LYJ F;  5F9N A;  4ED8 A;  1R71 A;  2NNN A;  1WJD A;  4QPO A;  5KNL A;  2STW A;  1FTT A;  4C2T A;  4M9X A;  3WHC A;  1V51 A;  2R84 A;  3K4C A;  4YIF A;  3F21 A;  5DCF A;  1X4O A;  2ZFW A;  3GTL A;  2HDC A;  1V3F A;  2C2D A;  1IXS B;  4EGQ A;  4JI8 H;  3TP0 A;  2E2J J;  3GTG J;  3I4N J;  1I6X A;  4FIS A;  3C0W A;  4QJF A;  3RUP A;  3T5K A;  2FEZ A;  2XE0 A;  3CUQ B;  4BDY A;  4IRH A;  3ASN H;  4EGZ A;  2DQL A;  3BR6 A;  5IYZ F;  3HRU A;  4RMN A;  5BOX A;  2VOO A;  2VPR A;  4CH7 A;  3L2Q A;  3T5H A;  3NWS A;  4L9V A;  1BM9 A;  3GTP J;  5DV5 A;  2V7F A;  2MAB A;  4G6T B;  1XS9 A;  4P96 A;  3F6V A;  3J81 K;  4AAE A;  1IDY A;  4B47 A;  2VBO A;  4BS9 A;  1GVD A;  3QU3 A;  3CDL A;  2GQQ A;  2ID6 A;  3EYY A;  5LHG A;  4WCG A;  4RA2 A;  4UCO A;  1R58 A;  1Y0N A;  5AON A;  5B1A H;  3KP4 A;  3CO6 C;  2WB1 N;  2HQ5 A;  1BXR A;  3JSN A;  1W7P D;  2FK2 A;  3MZH A;  4ECT A;  5DUI A;  1XNR H;  5KX5 F;  2M1B A;  3NEU A;  4ECW A;  2GWR A;  5IYD G;  3CCV I;  1ON2 A;  4HQE A;  1EHI A;  2VQL A;  2K85 A;  2XE0 B;  3S32 A;  1V9P A;  4ED0 A;  2NVY J;  2NS0 A;  2UXX A;  2CMP A;  2NU7 B;  1R6R A;  1A04 A;  1Y0U A;  5J2U F;  5KFM A;  5HLI A;  2M8G X;  5HS8 A;  4A3J J;  2F4V H;  2QUF A;  2H1K A;  5KFW A;  3HPG A;  3GII A;  1IDZ A;  5JI6 A;  2VKV A;  3HKZ E;  1T6S A;  4CCL A;  2FE3 A;  3ERE D;  5GAE J;  5A2Q W;  5LRR A;  4PSW A;  3OY9 A;  2PQ8 A;  1BR1 A;  3CCY A;  3OYG A;  2X6O A;  4HR7 A;  2RGR A;  2I3P A;  1FOK A;  5A77 A;  3W2V A;  1LDD A;  3AYH B;  1DU6 A;  5LRS A;  3CJQ B;  2PMZ N;  2KIU A;  4D5C A;  3CCJ I;  2WBM A;  1IN7 A;  1S5L C;  2Q2E A;  3DEW A;  3MIS A;  4XRF A;  4C2M A;  4F4X A;  3IRQ A;  3VWB A;  2EV0 A;  1ULY A;  5F9L A;  1W36 C;  2KFD A;  4E7H A;  2V1U A;  2XB5 A;  3QQA A;  1HF0 A;  4L0Y B;  1FIP A;  3R4K A;  3CD6 I;  5EYR A;  2IS6 A;  2ZC2 A;  3N42 B;  1N34 H;  5K5R A;  3RIR A;  1JHF A;  2FX0 A;  1NHA A;  2JN6 A;  2O61 A;  2JEG A;  1E4G T;  3NQO A;  2E2I A;  1WH2 A;  2EV5 A;  1RPW A;  2EK5 A;  1IXR C;  4BBR J;  1ZH5 A;  2R93 A;  4M3D A;  2PN6 A;  2VS7 A;  2WAQ E;  3VB2 A;  4IHJ F;  3BG7 A;  2YZG A;  4D6N A;  2VC1 A;  4ZTF A;  4RLQ A;  2OAZ A;  4A3E G;  5LFA A;  1IW7 F;  4LF6 H;  1WJF A;  5EEH A;  3FMQ A;  1TLH B;  2Q2E B;  3P5J A;  4BJT A;  5JVT A;  2JTV A;  3OL3 A;  4LB5 A;  3VOD A;  2W7O A;  5HOO A;  3CC4 I;  2XSD C;  1D5Y A;  1QO0 D;  3K2A A;  5J4V A;  3WHB A;  1TWH A;  4CCM A;  4E4T A;  3VSL A;  2NU9 B;  4UN7 G;  1XDN A;  1YRN A;  3I4P A;  2BYV E;  4A3B G;  2K9L A;  4IRC A;  1TT5 B;  1HQC A;  1VQL I;  4AQX A;  3VMM A;  1G4D A;  3U1D A;  2L01 A;  3OYA A;  3S3N A;  2IN8 A;  4AYB N;  1Z7L A;  3BR1 A;  3D5S C;  1G8X A;  3PO2 G;  1ZQ7 A;  2LKS A;  3P9C A;  4A3K J;  1UAA A;  2O7M A;  2COM A;  1QPI A;  1UC9 A;  5L3F A;  1HNX H;  2PFB A;  2FLP A;  2JA5 A;  4B43 A;  2LR8 A;  2R7V A;  5D4S A;  4Q44 A;  4QTR A;  2FK1 A;  1TBX A;  2XDV A;  4M74 A;  3ZGK A;  3A2K A;  1ETK A;  5ILS A;  5EEA A;  3RFC A;  1XMO H;  2E71 A;  2VXD A;  3A01 A;  4UCU A;  2DTZ A;  4QWE A;  5DEQ A;  1AUV A;  2JEJ A;  1IBM H;  3D5R C;  2XKP A;  3PQJ A;  1ZET A;  1U3E M;  3RKW A;  5KFK A;  1S9H A;  1YRN B;  2BY1 A;  4M3E A;  4NDL A;  4UCR A;  1SFX A;  2YPR A;  4RAZ A;  2X48 A;  1O7L A;  3K4M A;  3TGN A;  4H0E A;  3NZM A;  4E7Z A;  4U6P A;  4BYY A;  1T3N A;  1USS A;  1WQ2 A;  1IF1 A;  3QOP A;  5E3O A;  1J5E H;  4F50 A;  4J9S A;  3I12 A;  3ZR8 X;  1ON1 A;  2CQQ A;  2MSY A;  1K79 A;  1YX5 A;  5D8L B;  2Z33 A;  3EUK L;  1A36 A;  2G7H A;  4EVI A;  2NOJ B;  5CPR B;  2GPW A;  1XNQ H;  5EWG A;  2CUF A;  2WB1 A;  3A01 B;  3D1N I;  1X1D A;  3DBR B;  1RNL A;  1T56 A;  3JRI A;  1MMD A;  1MKM A;  3OYH A;  1WRJ A;  5BMZ A;  3H5N A;  3W6V A;  4RAY A;  2O6G E;  2XB0 X;  4XKW A;  3MR6 A;  1WPK A;  3IC7 A;  3T1Y H;  1WCM J;  2DYS H;  2JA6 A;  3H4D A;  3V42 A;  4UNA A;  2W00 A;  4APM A;  1IV8 A;  3OS2 A;  2E2H A;  5KFT A;  2JA2 A;  1R00 A;  2Y48 A;  4B3T H;  2BW3 B;  4A93 J;  2CQN A;  3FK7 A;  2F5F A;  2FD5 A;  2HVR A;  4HRI A;  2PX9 A;  4BY1 J;  5E63 A;  1K61 A;  3HKZ N;  2P0A A;  2YL2 A;  3ZQF A;  4LOC A;  3L4J A;  2DT5 A;  4M9S A;  4ECQ A;  2G0E A;  3EUH C;  2UXC H;  1S6L A;  1D0Z A;  2HDD A;  1WWX A;  4RNO A;  2PMZ A;  5C8Y F;  1X3W B;  2BHY A;  1I3A A;  2DT7 B;  1D0Y A;  5A74 A;  3KAK A;  2L9R A;  3FF5 A;  3C2G A;  2FKL A;  4GKJ H;  4RUA A;  1RYR A;  5I0A A;  2OCE A;  1Y1W G;  2HYG D;  4AVP A;  4M3G A;  1BN5 A;  2JSP A;  2DLL A;  5LXT F;  4HNU A;  5DCM A;  3N97 A;  3GTK J;  2UUB H;  4DZP A;  2DFI A;  5JUM A;  3K4N A;  4DR1 H;  1J59 A;  4RB1 A;  4IWX A;  2R7Z A;  3NRV A;  2R92 A;  1U9O A;  2R7Q A;  2ZSI B;  3BPX A;  1CS0 A;  5B66 C;  5EEG A;  3BZ6 A;  3QPL A;  3S2D J;  1J9I A;  2QZ8 A;  1J7K A;  5DTD A;  2IP4 A;  3F0C A;  2WWY A;  3SE7 A;  5FJ8 G;  2A6E F;  2XAJ A;  2ZME A;  1UHM A;  2HKX A;  2WAQ N;  3BDD A;  3LWF A;  4EAT A;  5GAH J;  2OWO A;  2EV6 A;  5A78 A;  3LA3 A;  4HBL A;  1N56 A;  3WG7 H;  2HKO A;  3M1E A;  3W6K B;  2LQM A;  2YZN A;  3BJY A;  3JRG A;  3LQQ A;  1TT0 A;  2MC4 A;  4CSW A;  2R7S A;  5K5Q A;  3B73 A;  3BR5 A;  4CZC A;  3K1M A;  1YS7 A;  2EFP A;  4U0W A;  3OIQ A;  5DCM B;  1K6O A;  4QWA A;  2R7K A;  3ZQG A;  2ZKZ A;  3Q0V A;  3QZ7 A;  1BI2 A;  3VPR A;  4XRS G;  1ZHS A;  4B3R H;  4IF4 A;  4AYB A;  1W36 D;  2A07 F;  1JKP C;  1JLL B;  3H9J A;  4XNF A;  1YW9 A;  3DTE A;  5FLX Z;  1UM2 A;  4YR0 A;  3HBL A;  2FQ3 A;  2Y0S E;  2XIG A;  3OSN A;  2ZME B;  4W97 A;  4I99 C;  4O4I F;  2YS7 A;  1JKO C;  1U5T A;  2E1N A;  2W4S A;  3MAJ A;  4HYE A;  2DN0 A;  1QVT A;  4XKV A;  4UCV A;  1JI8 A;  2DMU A;  1MDM A;  4KHP H;  4IQ4 A;  5KT3 A;  3RGZ A;  2HHH H;  3F8B A;  2XSJ C;  3J80 Z;  3MKL A;  3QOE A;  1R36 A;  4OIR F;  4ZDP A;  3MWD A;  4A0Z A;  4ETS A;  3FBI B;  2R7W A;  4D7M A;  1R9T J;  2ZDG A;  1QZE A;  3V4G A;  3TW6 A;  2L7Z A;  3CF2 A;  2YU9 A;  4BNC A;  1TWF A;  1O7F A;  3OIP A;  1MH3 A;  1D1B A;  2ALZ A;  1BR4 A;  4WXD A;  2HI3 A;  1EZ1 A;  3G6V A;  2F5D A;  2L2O A;  3K2Z A;  1U5T B;  4DJA A;  2XC7 A;  4A2A A;  4IR1 A;  3GTQ A;  1PYV A;  2EIK H;  2ME6 A;  1YO5 C;  3RZO J;  1DDN A;  1MDM B;  4QWD A;  3CF5 F;  2DMN A;  4LF8 H;  4OX9 H;  2DYR H;  5KFA A;  5HLG A;  2Z99 A;  2P0W A;  4IPA A;  3MMY B;  2CV2 A;  2W57 A;  4A3I J;  5FPR A;  3FHZ A;  3BTC A;  4JP0 A;  2NS7 A;  2RVC A;  3S3O A;  3C18 A;  3BJ6 A;  1N36 H;  1S8N A;  1R1U A;  5DG8 A;  2F5V A;  2L7K A;  5FD5 A;  3OYM A;  1OCP A;  2K9M A;  2BZT A;  2Y75 A;  3Q9S A;  2PJR B;  2P8T A;  2VBW A;  1PUF A;  3KP7 A;  3KAJ A;  3TL4 X;  1JVA A;  3ZMU A;  2LBF A;  4UV9 A;  5HLT A;  1CQJ B;  2R6F A;  5KT4 A;  1VQ5 I;  5F04 A;  4EFB A;  5KKN B;  1ZG5 A;  2X0L A;  3N40 P;  5IYC G;  4J9L A;  4IHY A;  2BBY A;  4YR2 A;  1SFO A;  3R61 A;  4ZC3 A;  2YSR A;  4II2 A;  1APL C;  1JKJ B;  3GFI A;  3KCC A;  4OMZ A;  2VON A;  3U9G A;  5DQI A;  3RYP A;  4M9Z A;  4HSR A;  1GV2 A;  1FLI A;  2FLD A;  2R87 A;  4XR6 A;  1N78 A;  3KE2 A;  3CMM A;  2FBH A;  5HNF A;  2JA7 A;  1VAJ A;  4R8H A;  1E4E A;  1U78 A;  4NLG A;  2RDP A;  4YAK B;  1VBH A;  5A2Q K;  3IAM 2;  4XSZ F;  1N32 H;  2M9H A;  5J6X A;  1TA8 A;  3J81 W;  1XMK A;  2LMD A;  1VZ0 A;  4PJJ A;  3E97 A;  2LBF B;  4FQG A;  3JRF A;  3OTO H;  2UU9 H;  5D1O A;  4O3R A;  1RI7 A;  2KJC A;  1JIH A;  4BY7 G;  3F8M A;  5HLH A;  2WAQ A;  4G6D A;  1MBK A;  5DD4 A;  3QRF F;  1I27 A;  3PW4 A;  5C44 J;  3S3M A;  1O3T A;  1QU3 A;  1FBS A;  4MQ9 F;  3RB0 A;  2F4L A;  2W8L A;  2KDO A;  1Y14 B;  2PBZ A;  2DA4 A;  1VKZ A;  2RV8 A;  3OL4 A;  3VYR B;  1YHQ I;  2IPQ X;  2XAS A;  2VUM G;  4PJN A;  3E3V A;  2HTJ A;  1VQP I;  1TL8 A;  3K1N A;  1T39 A;  2Y9Z A;  3IGD A;  3JAM Z;  4UN9 A;  4HX8 A;  1BJA A;  4XBF A;  4DBQ A;  1S68 A;  1B9M A;  3CES A;  4IAJ A;  1X3Z B;  1WSU A;  3Q8Q B;  1E4E B;  5D8D A;  4C5B A;  1BOA A;  4AAB A;  1BW6 A;  1B4A A;  4YII A;  4G7H F;  3MEX A;  3K4J A;  4FS2 A;  4HG2 A;  1RUO A;  2GZW A;  1WVR A;  2M7A A;  3W3C A;  4BXX G;  1G3S A;  2ADU A;  2F5E A;  5IYD J;  3EPI A;  3M9A A;  4XOR A;  3HTS B;  4XX0 B;  5D1O B;  4J0M A;  3CUQ C;  5TGT A;  2B63 A;  4EYI B;  3KPH A;  4EJW A;  1OYW A;  2JRM A;  2A6H F;  3IL2 A;  2P6T A;  3H4B A;  2VOD A;  2YR2 A;  3LSJ A;  2I5U A;  2P6S A;  3CP2 A;  4XK4 A;  3G4S I;  1SD5 A;  3AG1 H;  1ZRD A;  2GPS A;  1V4Y A;  3ELK A;  4BQQ A;  1UB9 A;  4YG2 F;  3O6B B;  4BAC A;  3LSI A;  1FSH A;  2QF7 A;  4KIF A;  5IP6 A;  5KG5 A;  3AL0 B;  1Z2P X;  1HKS A;  1UJ8 A;  2GAU A;  3JTH A;  1BR2 A;  5JQW A;  3A02 A;  2OCC H;  2MCT A;  1R4N B;  3K70 C;  1F36 A;  3DU5 A;  1LVA A;  4HZF A;  2X51 A;  5AIQ A;  4ABZ A;  3VPB A;  4DL4 A;  3UQ8 A;  4M6X A;  2UUC H;  2CW8 A;  5ILU A;  1BIA A;  3GFL A;  2KDZ A;  3ZQQ A;  3L09 A;  4ON0 A;  5GPA A;  2XRO A;  2H27 A;  3LNQ A;  3OYI A;  4M6V A;  4MO7 A;  1MI8 A;  1QQI A;  2L4A A;  2OV7 A;  2V9P A;  3LSM A;  3HOY J;  2XAH A;  1SVL A;  2H1L A;  3M1C A;  3TKY A;  4XLP F;  1AA7 A;  1O75 A;  2IA1 A;  1UHW A;  2HTS A;  3FWE A;  4DR5 H;  1DFA A;  3PNY A;  3E6D A;  2CW7 A;  3LSK A;  4CZZ A;  4Y8V B;  4JI0 H;  1OYY A;  4H4K C;  2R7R A;  1W0T A;  4LLN A;  5H20 A;  2ASL A;  4V2F A;  3M4O J;  1Z6T A;  2HOS A;  3PNT A;  3S2W A;  2GXB A;  2XF5 A;  3ONQ A;  3BT9 A;  2W9C A;  1WJB A;  2E1M B;  1WI9 A;  4A3E J;  2DXI A;  3VYU B;  1K78 B;  2LYC A;  4XLN F;  3T8R A;  2JNQ A;  4TV7 A;  2W9A A;  2I8C A;  1V5F A;  2RQP A;  2ISY A;  4Z6Y A;  1YTY A;  1D8J A;  3GV5 B;  3TQ1 A;  4GCV A;  5H6Q A;  3NWT A;  4IEJ A;  5DLG A;  5AKM A;  4XOT A;  2EQR A;  4YIS A;  1SAX A;  1R7M A;  3RCO A;  3WTU C;  1HA8 A;  3KXY T;  5J8F A;  4XL9 A;  4XLA A;  1MSE C;  4FET A;  3FD2 A;  3QZ8 A;  4A3B J;  1AKH A;  1R5G A;  2BVM A;  4YR3 A;  4PK4 A;  5D5X B;  3DEE A;  4MNU A;  1P7I A;  3HSF A;  4KT5 C;  3HHG A;  2EFQ A;  4XLH A;  2W25 A;  3L2P A;  2K3P A;  1H0M A;  1IRX A;  2W9C B;  3BTI A;  2JA5 G;  3PVX A;  2L9N A;  4GLX A;  4L5E A;  2X6W A;  1V55 H;  2KIQ A;  4CC5 A;  3PO3 G;  3CLO A;  3I4M J;  2NXN B;  3JRW A;  2W24 A;  5DLF A;  2V79 A;  4AD9 A;  4CUG A;  2BHZ A;  3G8C A;  4DV0 H;  3MCZ A;  3OS0 A;  3QU6 A;  4LIV A;  1Z2N X;  4A3F G;  5JLX A;  4EJT A;  2VN2 A;  4ED2 A;  1SCU B;  4WBN F;  1AKH B;  4IR9 A;  5M3F J;  1IZ1 A;  1E4F T;  1WR2 A;  3VDX A;  2XD4 A;  3RYR A;  2PLY A;  2RF4 A;  4E7K A;  3LFK A;  2OZU A;  3C2H A;  5GP9 A;  3OYC A;  4IJA A;  4ESJ A;  2W85 A;  4D7N A;  1I3Q A;  2JZY A;  4ASN A;  1C30 A;  1FOW A;  4BEH B;  4N0B A;  4KIB A;  5KFH A;  2WY8 Q;  3ZMV A;  1HBX G;  3A1Y A;  2VJ5 A;  4UXN A;  2DIK A;  5ICF A;  3IWZ A;  4HF1 A;  2JWT A;  2FPP B;  2DT6 A;  3RPU A;  5FRO A;  1JGS A;  3A0H C;  3IAS 2;  5J47 A;  5E5O A;  1GVJ A;  2WB1 E;  4UY8 I;  3GLK A;  2LD5 A;  3N41 B;  2IVM A;  2KIS A;  3WTV C;  2QVO A;  4HX4 A;  4JK1 X;  3OR1 C;  4XN0 A;  4XRS A;  4HQ6 A;  1WI3 A;  4YBZ B;  5KFR A;  3BTJ A;  2VPS A;  2VIX A;  3FXL A;  4P9U A;  4P9F A;  1G3Y A;  3ZQ7 A;  2ZSH B;  4FAS D;  1FBU A;  2DOF A;  1DGW Y;  2QCO A;  5CVV A;  4DL5 A;  1Y1V A;  1X2N A;  5AKN A;  5KG7 A;  4D5F A;  1VFC A;  2ME0 A;  4BU2 A;  1ZHQ A;  2JA8 J;  1SVO A;  5LGT A;  3FXK A;  4AVZ A;  2P81 A;  2OD5 A;  2K27 A;  3K1P A;  3RGX A;  3M8E A;  2EH3 A;  4XIC A;  1XSD A;  4RM3 A;  4WWC A;  4OAZ A;  2JUC A;  5KG0 A;  5L1I A;  3F3X A;  3FKI J;  1YI2 I;  2YCH A;  3S2H J;  1KU2 A;  2DPI A;  5E8G A;  3R0A A;  3DBH B;  2W6O A;  4JQF A;  1KYW A;  4N4N B;  1FTZ A;  2R8G A;  3L7W A;  1TW3 A;  2CV0 A;  2IS2 A;  2QYO A;  3K4B A;  2R7Z G;  2QEX I;  4OAY A;  1JT0 A;  1BL0 A;  2X0S A;  2R92 G;  2P7V B;  4RB3 C;  1AHD P;  3WE2 A;  3GF2 A;  2DPU A;  1TWG J;  4ZDO A;  2W82 A;  2JT1 A;  1J5Y A;  4ESB A;  3OSP A;  2FSW A;  5FJ8 J;  2K9S A;  3Q8P B;  1W5S A;  5EF6 A;  4DUY H;  4XMY A;  1VQ8 I;  4BHC A;  1X1B A;  4F52 A;  5KT7 A;  1PVE A;  2OUM A;  4M6Y A;  4ZYH A;  1XB4 A;  3DWL E;  2HXI A;  2R3S A;  3AAF A;  1VQN I;  4O1R A;  3C3W A;  2DK5 A;  2KIM A;  3ORQ A;  4HPQ A;  2WAF A;  2DBB A;  3CCU I;  3R60 A;  4XKC A;  1P9Q C;  4YEL A;  3J7A Y;  3L2R A;  3K70 D;  3PZP A;  1B24 A;  4EG0 A;  1K7A A;  1PP8 F;  2IGN A;  2O8K A;  3HC7 A;  4XN3 A;  4YHX A;  3BQY A;  2DAO A;  1T8I A;  1MBJ A;  2LRD A;  4JOM A;  5LBQ A;  3KTM A;  2IGM A;  3CQZ J;  2FK3 A;  1Q1H A;  3V6H A;  1Y56 A;  4AIK A;  1Z21 A;  1C0W A;  3BA9 A;  1EKE A;  3G2B A;  1R7J A;  3R0J A;  4ZYE A;  4AYB E;  1GDT A;  2DJI A;  4I01 A;  3DQV C;  4L18 B;  1UMQ A;  3E5X A;  1U0D A;  3MVP A;  3MR5 A;  1XN7 A;  2ELJ A;  3M8F A;  1G6N A;  1M7J A;  2C22 A;  4Y3O A;  2VQC A;  2W6Z A;  2P4W A;  5CA1 F;  1ENH A;  2B9S A;  4ZTJ A;  3BQ0 A;  2VB6 A;  5LGN A;  2CGP A;  2NVY A;  3GYH X;  3KP6 A;  2A5Y B;  3QWL A;  4B3S H;  5KT6 A;  2LH9 A;  5F27 A;  3F23 A;  5TRD A;  3E1S A;  3HOX J;  4C5A A;  2IS1 A;  4JI4 H;  3MFH A;  1K83 J;  3KAL A;  4O4L F;  3HUG A;  3RPQ A;  3AG3 H;  4XKB A;  1B6A A;  2ZME C;  1DUX C;  5FLM J;  2WC2 A;  4WK8 F;  3ZMS A;  4E4H A;  2HR3 A;  5FLV A;  5C5J A;  1S10 A;  3ZMZ A;  1MIJ A;  2E5L H;  2XCP A;  1MBG A;  5LGU A;  4JV0 A;  2VUM A;  5FO5 A;  1P8K Z;  4O4H F;  4HA8 A;  3ABM H;  2R4G A;  2MA3 A;  4BKX A;  3R5F A;  1HNW H;  3KIO A;  1MBE A;  3IP4 B;  5JR3 A;  4ECU A;  2P7C B;  1MMS A;  2IN9 A;  1WJA A;  2BXZ A;  2IBD A;  3JRD A;  2O03 A;  1GPP A;  5ILV A;  2KQR A;  2NOG A;  5CJ9 A;  2EZL A;  4L5I A;  2ESH A;  3OYL A;  1ZD7 A;  2Z2S B;  2FBI A;  4K2E A;  1VND A;  4LIU A;  5FRN A;  3RB6 A;  3IH4 A;  3UKG A;  5H2F C;  2EFO A;  3SEQ A;  5KFL A;  3HUG B;  3S1M J;  4DV7 H;  4RGX A;  4DL3 A;  1YJ9 I;  3RSN A;  1KU9 A;  1PK8 A;  3BG9 A;  1U5T C;  5L3C A;  2M8E A;  2Q0O A;  1S0O A;  3BTL A;  3B6C A;  3E54 A;  3KX2 A;  4BQN A;  1ERD A;  1AM2 A;  4GRI A;  1VQM I;  2FPI B;  2R8J A;  1VTN C;  3WNZ A;  4ESF A;  1T9J A;  4DV6 H;  1XD7 A;  1U2W A;  3A4C A;  4HQM A;  1PX2 A;  4C9Y A;  3HGY A;  2ICW G;  1A35 A;  4MTE A;  1JDE A;  1TWA A;  3JRC A;  4EQQ A;  4HEA 2;  1MZB A;  2XV4 S;  4HW0 A;  4A3M J;  1KBL A;  2G9W A;  4JBA A;  3GBG A;  2HS5 A;  3FIW A;  2IJL A;  2IW5 A;  2JA7 G;  1ZRE A;  3PW0 A;  4EGY A;  2LKX A;  2RGV A;  3WTW C;  2VKD A;  1B33 N;  3GV7 B;  3GTL J;  4M72 A;  3W6J B;  4LK1 F;  4AUX A;  1F4K A;  2M05 A;  3JW4 A;  5CVI A;  3S17 J;  4KN7 X;  4HOB A;  4OIQ F;  3GZN B;  4O3S A;  1SEI A;  5C1P A;  2UVW A;  3OSF A;  1Q1V A;  1V5G A;  1HC8 A;  4I55 F;  3ZN0 A;  5F0F A;  2HGC A;  1SD4 A;  3T5L A;  4G3I A;  3QPT A;  2JMW A;  5BPH A;  4ZZD A;  1XDS A;  2C35 B;  1RRJ A;  2DCH X;  3EQL F;  3RAQ A;  2LG4 A;  4UN9 G;  1MSF C;  2DTR A;  5E1X A;  3ZPL A;  3PSF A;  2R7F A;  3LSR A;  1Z05 A;  4Q8E A;  1HSJ A;  4UB6 C;  5HVQ C;  4MFE A;  4BBS G;  3CTA A;  2OTL I;  4KDP A;  5J2T F;  1WJ5 A;  1XMQ H;  1PUE E;  1FJG H;  3JRX A;  1RC9 A;  3BR3 A;  3GFJ A;  2UXD H;  1ZAR A;  2W1O A;  3FIS A;  3PM1 A;  4DL6 A;  2IMW P;  5BMV F;  2JVG A;  1I5Z A;  1IC8 A;  2LLK A;  3GZ6 A;  3BJA A;  2B63 G;  2L0K A;  4R1H A;  2ZXJ A;  3I53 A;  2XF7 A;  1T08 B;  4Z20 A;  1DGS A;  4TV8 F;  1S7O A;  3VEP A;  4A2U A;  2RRE A;  4PFP A;  4Y7N J;  1MBH A;  2VPL A;  2V6E A;  4RGS A;  3IG0 A;  3DPU A;  5KHD A;  1ZG1 A;  2CWE A;  2VOB A;  3MD2 A;  3ULQ B;  5D1P A;  1G3W A;  1KA8 A;  2LF7 A;  1A0I A;  3OOU A;  1XGM A;  2RC4 A;  5IOZ A;  3HOV J;  5BR8 H;  2E34 A;  3FDY A;  4NB5 A;  4X64 H;  4O2B F;  2J5O A;  2CJJ A;  2XGC A;  3LQR A;  3HIF A;  3LSP A;  3BQ2 A;  5KVR A;  2KRC A;  2TDX A;  5IYB G;  1X58 A;  4Z1Z A;  4GC6 A;  1JUM A;  2XHK A;  3BC8 A;  3O8H A;  3RQI A;  1ZG3 A;  2ZBK A;  4PJL A;  1HLV A;  4ED3 A;  3R6S A;  3REO A;  2VI6 A;  4KIS A;  2ATL A;  3LSH A;  4RS8 A;  4R8U B;  2IGO A;  2O3F A;  2OBP A;  1M0W A;  5E18 F;  4DL2 A;  2STT A;  2E2I J;  1OR7 A;  5JH7 F;  4Q45 A;  2BW3 A;  1YQA A;  2Q8K A;  4CIC A;  3DKX A;  3DKW A;  2R93 J;  4UCS A;  3TII A;  2WTE A;  3R7P A;  5C4X G;  3AL0 C;  3GTM A;  4P5O A;  4Q4Z F;  2VBX A;  2CQK A;  4G9Y A;  1AOY A;  4KUM A;  4U7B A;  2EZI A;  2DPJ A;  2GOM A;  4ME6 A;  2FRH A;  5KFB A;  4XLE A;  3BG6 A;  2XCL A;  5C1O A;  2AO9 A;  1LFB A;  5B3S H;  4F93 B;  1VQ4 I;  3WOD F;  4LF7 H;  1KJJ A;  3RTX A;  3QYF A;  3TP3 A;  5JHF A;  5L1J A;  2I8D A;  4YFX F;  2FMA A;  1MGT A;  4MEY F;  3MX9 A;  1V4R A;  3K3P A;  2ZJT A;  2ASD A;  4NC7 A;  2ELK A;  1FWZ A;  1P7J A;  4EV0 A;  2KZV A;  4LB6 B;  2UVU A;  2CUJ A;  2L9S A;  5J40 A;  1LPQ A;  4I2O A;  2VJI A;  5KG6 A;  2VKH A;  4JYK A;  2L54 A;  1MW7 A;  5L3D A;  2VQF H;  2KRH A;  3K6G A;  1YW7 A;  3LA7 A;  2JA5 J;  5KT2 A;  2E1M C;  2R0Q C;  3C0F B;  3M9M B;  3RB3 A;  2O7O A;  4ZYG A;  2MFZ A;  1HOM A;  2WV1 A;  3KYC B;  1Z91 A;  3OIO A;  2HQN A;  1IAW A;  3PO3 J;  1T38 A;  1YW8 A;  1MMG A;  1WJC A;  2EJR A;  4YEJ A;  2E1O A;  3HOU J;  1KQ8 A;  3HOT A;  2VE9 A;  1BGW A;  2UUA H;  3LFU A;  1N3F A;  3MKW B;  4LH7 A;  3CCE I;  3HOW J;  3HSE A;  4IRG A;  1XSX A;  4YY3 H;  4A3F J;  3BP8 A;  5HDN A;  4MFD A;  1WKM A;  4A3L J;  3MZY A;  2VBL B;  1KGS A;  2EIJ H;  4MTD A;  4X1E A;  1R23 A;  5D4R A;  1H9T A;  2HEO A;  1FYL A;  2XUB A;  2A3S A;  1P8L A;  3KP3 A;  4KYW A;  3JSL A;  5ICE A;  2AXL A;  3E7L A;  1LWT A;  4X62 H;  4GYI A;  5IP7 G;  5K5O A;  5EJC A;  3QYB A;  5B1B H;  1DPU A;  2BY0 A;  1OWT A;  4L0Z B;  4IZO A;  3RI4 A;  1V5E A;  1T9I A;  2KHM A;  4KNY A;  4A3G G;  1R9T A;  1LWS A;  3FXO A;  4I0B A;  4A5M A;  3H5R A;  1MJA A;  2W84 A;  3DFG A;  2R7U A;  4MV9 A;  1HW5 A;  3L9F A;  5L3G A;  3E6C C;  1IN6 A;  1I6U A;  5KFD A;  2JA6 J;  3IHU A;  2MW8 A;  4GC7 A;  2OZ6 A;  2CUE A;  2PMH A;  2WAD A;  2CQX A;  4BL0 B;  5TIS C;  3WE3 A;  1M1E B;  1TTY A;  4RLF A;  3S1Q J;  3FXM A;  2KJB A;  5IWA H;  3U21 A;  3PNV A;  1OYI A;  2Z1D A;  3F9K A;  4Q0Y A;  1Y1V G;  1ZK8 A;  2H8W A;  2K86 A;  2OQR A;  2I87 A;  3Q8S B;  2DOA A;  4V2G A;  2J6U A;  1RJR A;  2UUZ A;  1UZC A;  3HXL A;  2DA3 A;  2V59 A;  2M0C A;  3BAA A;  2W7P A;  3G3Z A;  3D0S A;  3E5Q A;  3GW2 A;  3LST A;  4RAG A;  4Q43 A;  1LJ9 A;  1XCB A;  4DUZ H;  2FJZ A;  4UUT A;  1VF9 A;  2Y0M A;  1P6R A;  4BGD A;  3FM5 A;  5J1R A;  3JRB A;  3GIQ A;  2KSW A;  2E5Z A;  2JSC A;  3MXA A;  3T1H H;  3OOR A;  2A5W A;  1TQM A;  1XX5 A;  3HOZ J;  1RIO H;  3V7S A;  1RZ4 A;  2YX4 A;  4Y17 A;  1IN8 A;  2WY7 Q;  3IH2 A;  4OMY A;  4JUZ A;  3S14 J;  5KG1 A;  4MAM A;  2PJR A;  1JXS A;  4C3J J;  2R92 J;  2ECC A;  2ISZ A;  1YJN I;  3E5U A;  2XCA A;  4A0X A;  1XGO A;  2QM3 A;  2MD5 A;  1SD7 A;  3RKY A;  4KL5 A;  5CYV A;  3EPG A;  4EJV A;  4QWQ A;  3N8D A;  4EM0 B;  2AGP A;  2W6Q A;  5C3E G;  4FM9 A;  2H09 A;  2VBZ A;  1IRG A;  2EWN A;  3LSG A;  4LF9 H;  5FB2 A;  2L5Q A;  2PJP A;  2VJJ A;  2VJ4 A;  5IT9 Z;  1JTX A;  2M2E A;  3ZN1 A;  3HHH A;  3IH3 A;  2E35 A;  5M5W J;  4GYG A;  1RK6 A;  4ENK A;  3RKQ A;  2DQR A;  3MFK A;  3MN2 A;  2CFO A;  2VC0 A;  4DGW B;  1E3H A;  4R79 A;  4IXA A;  2NYX A;  3I4N G;  4B1R A;  5HNH A;  2FOK A;  3GUD A;  2X85 A;  5J8C A;  4CYC A;  2HWV A;  2HOE A;  5J1U A;  4CA0 A;  2QSG X;  1CE8 A;  2IAI A;  2M3A A;  2QA4 I;  1GUU A;  1E3O C;  5E79 C;  4HAM A;  4LJZ F;  5AKF A;  3HB9 A;  2R8H A;  1OCO H;  2DDA A;  1G2H A;  3WU0 A;  1WSC A;  2DWC A;  4EBE A;  1QVU A;  3W2W A;  1ZTR A;  4LLL A;  4BDZ A;  4Z1X A;  1I50 A;  5EDW A;  2X4H A;  4I02 A;  2LVS A;  3K7A J;  4YFN F;  2LCJ A;  2VXZ A;  5I47 A;  1YG2 A;  2NVU B;  4BXU A;  2B7E A;  1IGN A;  4MV6 A;  3UFX B;  3G1O A;  4O3N A;  2ZJ2 A;  1F5T A;  3BCB A;  2COB A;  4DV3 H;  1AF5 A;  5E1W A;  1E2X A;  1IBL H;  1ZRF A;  4F4W A;  2GIV A;  2X6X A;  3K4L A;  4LMY A;  3ML6 A;  2VQH A;  3IUO A;  5GTI C;  4CYC B;  2MH2 A;  3G1M A;  1BC8 C;  4CGZ A;  4MA5 A;  1YX3 A;  2LOO A;  3U2R A;  4QWB A;  2DOE A;  4RGU A;  3ECH A;  4Y13 A;  4A3J G;  2NVQ J;  5JLW A;  2QWW A;  3GEZ A;  1JKR C;  3TMO A;  1ZYR F;  2XGD A;  3H0G A;  4EGJ A;  4DOZ A;  3PW7 A;  2D1V A;  4MHG A;  1IJW C;  4B3A A;  3CCR I;  3MIP A;  1GLV A;  2XGQ A;  2HZD A;  3PW2 A;  3ABU A;  1LEA A;  3HDD A;  5CA0 F;  4JI6 H;  4NXN H;  3N05 A;  4XON A;  3KYL A;  1BP7 A;  4FBT A;  5DD8 A;  1K1S A;  1X2M A;  3A0B C;  3LA2 A;  1O57 A;  3N43 B;  3GTQ J;  4CCO A;  1BI3 A;  4M7E A;  2HFH A;  3I64 A;  4AIJ A;  3N44 B;  3KFW X;  3QYE A;  4EEY A;  3DXJ F;  1SC7 A;  1UEL B;  1YIJ I;  5LA6 F;  2Y69 H;  2ZFU A;  2LTP A;  2LKP A;  1Z3X A;  4BHP A;  1GO3 E;  1ZKG A;  5F64 A;  2D2W A;  2GIZ A;  4DYQ A;  1E17 A;  2F6C A;  1O3Q A;  4KN4 X;  4I09 A;  4DV4 H;  2J6T A;  3IKT A;  4B48 A;  3HRS A;  5DGB A;  5GAG J;  3MJF A;  3Q3S A;  3GLX A;  3AG2 H;  4KIT B;  5FLX W;  1KQ9 A;  2V26 A;  2P5V A;  4TQS A;  2NVX A;  4MV3 A;  4BBR G;  2UXN A;  2CO5 A;  4F91 B;  4X6A J;  4LSX A;  2CS3 A;  4JI3 H;  3KZI C;  1RR8 C;  2XGE A;  3WU1 B;  4C30 A;  1LDK B;  1DU0 A;  4C2U A;  1Z2O X;  2W6M A;  5F1J A;  1LVK A;  3GIJ A;  5J3L A;  2ETH A;  3IWF A;  1ZLJ A;  1V54 H;  1W5T A;  4XOP A;  2WDT A;  2IBK A;  3ABT A;  2V1N A;  2Z5U A;  5F0C A;  1QA6 A;  5FKN A;  4I4T F;  1T95 A;  4Y15 A;  2FU4 A;  3J80 W;  1XGN A;  4EBD A;  4W1U A;  2DU9 A;  3CJN A;  3WTZ A;  3JSP A;  4L1K A;  1ACI A;  4X65 H;  4KJZ A;  2QQ9 A;  1R5H A;  1WHU A;  3GXO A;  3F6O A;  1K78 A;  1E0E A;  2JA7 J;  1GSO A;  3OHB A;  2XRN A;  2DPD A;  1OPC A;  3ESW B;  1S0M A;  4WX9 A;  3B02 A;  3BOQ A;  2BV6 A;  2MC3 A;  5FKO A;  2I10 A;  5TJJ A;  4EJU A;  1XGS A;  4UB8 C;  1KJ9 A;  1CGP A;  4AC0 A;  3CME I;  1VBG A;  4A3K G;  2UV1 A;  2UVV A;  1IG7 A;  4FX4 A;  2G7U A;  5E5S A;  1Y8R B;  1Z7U A;  5FRM A;  4IOC F;  2VE8 A;  1HNZ H;  1SMT A;  3O8G A;  4AWX B;  5E20 A;  2EIM H;  4F7Z A;  3JRH A;  1NTC A;  1JE8 A;  2HQR A;  4U7C A;  2J6S A;  4RZR A;  2TCT A;  2FPG B;  2JRT A;  5KFI A;  1LDJ A;  3DTI A;  1Y6I A;  4ANJ A;  1TQP A;  3HEF A;  3Q0W A;  4XLF A;  2VQE H;  2ZXW H;  5C4J J;  3BJO A;  1X1A A;  1VS0 A;  3I3L A;  3GZ5 A;  3MWE A;  4E7S A;  1A6I A;  2VQG A;  4S04 A;  4HDV A;  1MBF A;  3WGG A;  3DU6 A;  1FIA A;  4J9Q A;  1FOY A;  3DF7 A;  2M45 A;  1BW5 A;  3CLQ A;  3V7R A;  4S05 A;  4UUV A;  2B63 J;  2Y9Y A;  1L3L A;  3K3V A;  3BA8 A;  1XCV A;  2LK2 A;  3QP5 A;  4AQU A;  3PW5 A;  2DLN A;  2MBF A;  2AHQ A;  3NGD A;  4UNB A;  3PO2 J;  3SZP A;  2PEX A;  2F2E A;  2XAU A;  3AG4 H;  3C0X A;  3BQ1 A;  1GSH A;  5F0H A;  3GCM A;  3SXY A;  3VPD A;  1F1Z A;  2KEQ A;  1N25 A;  3FK6 A;  3RPU D;  2VBJ A;  1R49 A;  1IXC A;  2DDB A;  3I0T A;  4BEH A;  1WCM G;  3RAX A;  1JHH A;  4A6E A;  3PN1 A;  4CCJ A;  3VSK A;  2FF4 A;  1OFC X;  1IN4 A;  1BC7 C;  4KFC A;  2CQY A;  2K4B A;  4LH6 A;  1UG2 A;  2DA6 A;  2M5W A;  3OYN A;  9ANT A;  2MG4 A;  4ZI7 F;  2XAQ A;  1SFE A;  2M34 A;  2P5K A;  3SDB A;  1K4S A;  5LOV F;  2AGO A;  1FOX A;  4YB8 B;  4FT8 A;  2VBN B;  4PSX A;  2R7T A;  4WXH A;  1WFX A;  1YLF A;  4PCQ A;  3ZQH A;  1SAN A;  4RBO A;  2HYJ A;  1O3S A;  2W6N A;  2XPV A;  3FXR A;  5IP9 G;  3MR3 A;  4A3D G;  5DG9 A;  3FM3 A;  3ZMD A;  1YIO A;  1EH8 A;  2ID3 A;  4FE4 A;  2L02 A;  4PGG A;  5K1Y A;  3MR2 A;  2BVL A;  3JRE A;  2BY3 A;  2OLS A;  3ZCO A;  1HCR A;  2OJE D;  1TWC A;  4JV5 H;  2YW2 A;  1SD6 A;  3ECO A;  4DW6 A;  2KKO A;  4OIO F;  1I7N A;  3JAM W;  5LMN H;  3DKY A;  4KMU X;  2HVS A;  2VBJ B;  1YE9 A;  4AQY H;  1FT9 A;  4NQW B;  3AFH A;  3KET A;  4IQJ A;  3V6K A;  4AID A;  4N4O B;  2DK8 A;  2E7X A;  2GBY A;  4UUS B;  3MKZ A;  2FNP A;  1IOV A;  4KZS A;  3MXB A;  3GTO J;  1FPQ A;  3K5H A;  2EA2 A;  4ITV A;  2ZDQ A;  2CG4 A;  4A69 C;  4HNT A;  1YFH A;  1U0J A;  3FHN A;  1DP3 A;  2MGQ A;  3QQY A;  3P9I A;  5KT5 A;  1U6G A;  3L4K A;  4B09 A;  4G6Q A;  3H5A A;  5EDN A;  4GGG A;  2ZJQ F;  4LD5 A;  1Z1D A;  3RTR A;  4DR4 H;  3HRT A;  4EM2 A;  3GX4 X;  1Z67 A;  2R7X A;  1KU3 A;  4J00 A;  4RUC A;  2HOA A;  2X1D A;  3JR9 A;  4XQF A;  3RJP A;  1Y39 A;  4FX0 A;  1H89 C;  1JTY A;  1B59 A;  1BOB A;  3OYD A;  2CH0 A;  4FHT A;  2Z9O A;  4E2T A;  2QK4 A;  2E36 A;  3F8C A;  4ZZL A;  1DP7 P;  5KFX A;  1M5X A;  4CCN A;  3GTJ A;  2R7D A;  4G8X A;  1KZH A;  4CXF A;  5FGM A;  3MXB B;  3V4S A;  1R1T A;  2FBK A;  2IA2 A;  4CCK A;  3CCQ I;  4LG0 A;  5LD2 C;  2FP4 B;  2HDW A;  1Y8Q B;  2H94 A;  4I76 A;  3I58 A;  4U87 A;  2VAS A;  5CQE A;  2RDJ A;  4E2U A;  2LSO A;  4LQ0 A;  2EBI A;  3CQZ A;  3H3Z A;  1I1S A;  1Y1W J;  4O2A F;  2LY9 A;  4J9O A;  3GIM A;  1XSV A;  3GIL A;  4MQV A;  2A6T A;  1XPX A;  1R5I D;  4MGR A;  1OR7 C;  4B44 A;  1NG7 A;  3GIP A;  4DL7 A;  1N75 A;  2LWY A;  4BE0 A;  5HV6 A;  1J09 A;  1ZQ3 P;  1K1Q A;  3T1B A;  1P92 A;  1LFU P;  4HYK A;  1FX7 A;  3DP7 A;  4LIT A;  5A2Q Z;  2FLN A;  3TDU C;  4GKK H;  5DDG A;  1I3Q J;  1EYZ A;  2SCU B;  2V6C A;  2LP0 A;  2IMZ A;  4LG0 B;  3E6M A;  2K7L A;  2JUG A;  3PR5 B;  1OCC H;  2GM4 A;  5ED4 A;  2Q1Z B;  1OCR H;  4OIP F;  3KO2 A;  4IWY A;  4UFZ A;  3S1N J;  5GON F;  4O6J A;  1G3T A;  5CB4 F;  2JJ7 A;  3GTG A;  2NRA C;  4IL6 C;  2C6Y A;  4NUB A;  3NAU A;  3M4I A;  4AIH A;  4FTH A;  4KIG A;  2BOL A;  4IHW A;  3F72 A;  2QQA A;  2K02 A;  2KLO A;  5EZH A;  5CQG A;  2R5Z B;  4DV1 H;  3V4Z A;  3CVZ A;  4D1Q A;  3GTP A;  1DGR M;  3NAR A;  2QLZ A;  1MND A;  3HGG A;  5EG0 B;  4MV1 A;  4F4Y A;  2DFE A;  3FDS A;  4YFK F;  1Y1V J;  5IY5 H;  4A3I G;  1S9F A;  1KEE A;  2FXA A;  4FS1 A;  3IKV A;  4DBR A;  3R5X A;  2CSO A;  5FD6 A;  3K9T A;  2R7L A;  3MWM A;  3C2B A;  3C7J A;  3BR0 A;  4OOI A;  3DTK A;  3IV5 A;  2KIF A;  1DV2 A;  2FMY A;  3V8L A;  4O5V A;  2TRT A;  4BXF A;  4ZH4 F;  5D5U B;  1PDN C;  2LY1 A;  5LLQ A;  5A0M B;  2AQ4 A;  3T8T A;  4HV5 A;  1SEU A;  2L7M P;  1PJR A;  1ZGA A;  5ICG A;  1ETY A;  4BUP A;  1Z3Y A;  2KT0 A;  2PI0 A;  1N3E A;  4DLK A;  2M30 A;  3PUF A;  4A5N A;  4C3H J;  3LAJ A;  1UST A;  3JCU C;  4I7H A;  4KT6 A;  2ZJP F;  1G9Y A;  2QYZ A;  3G6X A;  2Q2U A;  2EIN H;  1QHH D;  5LEJ A;  3TO9 A;  4J01 A;  4RZQ A;  2VL8 A;  3PUB A;  1GYF A;  3I59 A;  2BR0 A;  2DFF A;  2J5P A;  3WTX C;  4L9N A;  3GLL A;  2VPQ A;  3RIZ A;  4P1W A;  1WH7 A;  3EDP A;  4EEF G;  4MV7 A;  3GME A;  1W0U A;  3X2Q H;  4B3X A;  2VKE A;  4D0P A;  3F22 A;  2E1C A;  1O4X A;  4J9R A;  2JEI A;  1WZ2 A;  4DV5 H;  3QAH A;  1SFK A;  5F6F A;  2W7N A;  4UN8 A;  2QQ8 A;  4WXC A;  3M3Y J;  3PFY A;  3I54 A;  4UVC A;  2XAG A;  1RES A;  1MMN A;  1TAE A;  1YYV A;  2R7M A;  2ZCW A;  1OJL A;  5C44 G;  1IN5 A;  2IT0 A;  1RR7 A;  1W5C C;  3BZK A; 
#chains in the Genus database with same CATH homology
 1MW7 A;  2AQF A;  3CMM A;  5HNF A;  4NC8 A;  4Y4R A;  2VQF H;  2KRH A;  3K6G A;  3W2A A;  2E1M C;  3C0F B;  2WE6 A;  2MFZ A;  1BJT A;  2CUZ A;  3IAM 2;  4HST A;  1N32 H;  1TA8 A;  2ZM6 H;  1MMG A;  1WJC A;  2WA0 A;  4YEJ A;  1BGW A;  3J81 W;  2UUA H;  3HOT A;  1VZ0 A;  4PJJ A;  2LBF B;  3LFU A;  4KL6 A;  1N3F A;  5D1O A;  5CKT A;  3MKW B;  1MNE A;  4LH7 A;  1DQ3 A;  2WAQ A;  4YY3 H;  2V9K A;  3S3M A;  1QU3 A;  1M0T A;  4DIQ A;  2VBL B;  3PL8 A;  2KDO A;  4BQO A;  4LF5 H;  4MTD A;  3OL4 A;  3VYR B;  2V4J C;  4PJN A;  3L2V A;  2HPI A;  4UN9 A;  3IGD A;  1ZEL A;  3H9G A;  4DBQ A;  4F55 A;  2DCE A;  3CES A;  4IZZ A;  1P8L A;  3FBN B;  1S68 A;  3JSL A;  4DV2 H;  4JYA H;  4X62 H;  2Y0S A;  1LWT A;  3L2W A;  4BWS C;  3QYB A;  1X1C A;  4Y33 A;  4AAB A;  1NG6 A;  3D5L A;  3K4J A;  2VBO B;  1V5E A;  4HG2 A;  1T9I A;  4UCT A;  4AAD A;  4RM2 A;  1LFP A;  2KHM A;  2M7A A;  3W3C A;  1LWS A;  3EUA A;  4XOR A;  4O1S A;  3FKJ A;  3H5R A;  5D1O B;  4EEQ A;  2R7U A;  3LML A;  3EPZ A;  4MV9 A;  4J0M A;  5TGT A;  4DR3 H;  2X1C A;  1ZDE A;  1I6U A;  1U0C A;  2M0M A;  1G9Z A;  4X66 H;  1TZL A;  3CP2 A;  3H9Q A;  2GOX B;  1X9N A;  3SEZ A;  4BQQ A;  2WAD A;  3BLY A;  2ZXI A;  4BL0 B;  5E67 A;  2JVH A;  4RB0 A;  1L2Z A;  4RLF A;  4BAC A;  3LSI A;  5IWA H;  3U21 A;  3PNV A;  4PJM A;  4X0G A;  2Z1D A;  3F9K A;  4Q0Y A;  3AL0 B;  1Z2P X;  3RJ0 A;  1BR2 A;  2UWM A;  1D0X A;  2DOA A;  2MCT A;  3ZRG A;  3K70 C;  2UUZ A;  3DU5 A;  3HXL A;  2UUC H;  2X51 A;  5A0M A;  3UQ8 A;  2Q2T A;  2CW8 A;  3BAA A;  4BJ5 C;  3ZQQ A;  1AN7 A;  3OYI A;  4DUZ H;  2MD0 A;  1MI8 A;  4ZYA A;  4BGD A;  2VLA A;  3OYF A;  2OV7 A;  3LSM A;  2QKL B;  2KSW A;  2E5Z A;  3M1C A;  1O75 A;  3MXA A;  4AAG A;  3T1H H;  1AA7 A;  3OOR A;  5AK9 A;  2VS8 A;  4DR5 H;  2A5W A;  1DFA A;  3PNY A;  3LSK A;  2CW7 A;  4BJ6 C;  2WY7 Q;  4JI0 H;  4H4K C;  2R7R A;  2PJR A;  3TBI A;  4LSA A;  4XM3 A;  3PNT A;  4KL5 A;  2XF5 A;  4UT0 A;  3ONQ A;  4CC6 A;  1WJB A;  2E1M B;  2DXI A;  3VYU B;  1EA3 A;  2LYC A;  3OYK A;  2IGK A;  2JNQ A;  1SAU A;  1VDE A;  4FM9 A;  3LSG A;  4LF9 H;  2X6Y A;  2L5Q A;  1V5F A;  1D1A A;  2VJJ A;  2VJ4 A;  3MKY B;  2EX5 A;  3NWT A;  5AKM A;  4NXM H;  4XOT A;  4YIS A;  1R7M A;  2AQE A;  3RCO A;  3S8P A;  1HA8 A;  2CFO A;  3UR3 C;  4DGW B;  3KXY T;  4XL9 A;  4XLA A;  4R79 A;  4FET A;  3FD2 A;  1KON A;  3HOS A;  5HNH A;  2KPM A;  2X85 A;  1AT0 A;  4IX7 A;  2BVM A;  4CA0 A;  4PK4 A;  2M3A A;  3DEE A;  3FMA A;  4YRV A;  5A72 A;  2X1E A;  3OYE A;  4XLH A;  5AKF A;  3L2P A;  2K3P A;  1SYX B;  2ZXH A;  2QOJ Z;  1IRX A;  4PDB A;  4QPO A;  1WJD A;  5KNL A;  2L9N A;  3W2W A;  3BAB A;  4C2T A;  4DR2 H;  4GLX A;  1XMQ H;  2X6W A;  3K4C A;  4BDZ A;  4AAF A;  1X4O A;  4Z1X A;  4CC5 A;  1X19 A;  3QOD A;  2R7O A;  2LCJ A;  2VXZ A;  4JI8 H;  3C0W A;  2VBL A;  1K6Y A;  3VYS B;  4CUG A;  3PJR A;  2XE0 A;  4BDY A;  4DV0 H;  3OS0 A;  5EOY A;  3BCB A;  4DV3 H;  1AF5 A;  4RMN A;  1IBL H;  4LIV A;  1Z2N X;  4CH7 A;  3L2Q A;  2X6X A;  3K4L A;  4II3 A;  4LMY A;  2VQH A;  3IUO A;  3NWS A;  3OOL A;  1YX3 A;  2V7F A;  4ZJZ A;  2LOO A;  2MAB A;  4G6T B;  4E7L A;  4AAE A;  1E4F T;  3I9V 2;  3VDX A;  4B47 A;  2VBO A;  3CP8 A;  4BS9 A;  4E7K A;  4OZ6 A;  4UCO A;  3EYY A;  2HU9 A;  4YHX A;  3TMO A;  3C2H A;  3OYC A;  4DOZ A;  3MIP A;  4JI6 H;  2HZD A;  3JSN A;  4NXN H;  4BEH B;  3H35 A;  3N05 A;  4XON A;  5KCM A;  2WY8 Q;  3KYL A;  1MOW A;  1BP7 A;  1HR0 H;  1XNR H;  3N43 B;  3A1Y A;  2VJ5 A;  4ZDL A;  4CCO A;  2VQL A;  4M7E A;  2XE0 B;  2DT6 A;  3S32 A;  1B04 A;  4D9J A;  1V9P A;  5FRO A;  3N44 B;  2CMP A;  3IAS 2;  2IXS A;  5E5O A;  1R6R A;  3QYE A;  3VYT B;  1UEL B;  3N41 B;  4YHH H;  2F4V H;  1QHG A;  2ZFU A;  4D6O A;  1Z3X A;  4NNJ A;  1FVI A;  3OR1 C;  4XN0 A;  3HPG A;  2VPS A;  2VIX A;  2F6C A;  4CCL A;  2FE3 A;  5A2Q W;  4DV4 H;  4B48 A;  5LL6 b;  2ZSH B;  4PSW A;  4FAS D;  3OY9 A;  1DGW Y;  3OYG A;  1BR1 A;  3K4K A;  4KIT B;  5FLX W;  5AKN A;  2RGR A;  2I3P A;  4YIT A;  3W2V A;  5A77 A;  2V26 A;  4BU2 A;  1ZHQ A;  4AQX A;  4AVZ A;  4F91 B;  4LSX A;  2Z16 A;  2CS3 A;  3CJQ B;  4JI3 H;  2HNH A;  4C2U A;  4C30 A;  1LDK B;  2WBM A;  1Z2O X;  3RGX A;  3DLA A;  5FPO A;  3L2U A;  1LVK A;  4RM3 A;  3MIS A;  4OAZ A;  3VWB A;  2YCH A;  4XOP A;  1W36 C;  4E7H A;  2WDT A;  2E5N A;  2V1N A;  2IS6 A;  3F8N A;  4JI1 H;  4LG3 A;  1T95 A;  3N42 B;  1N34 H;  3UNG C;  4JQF A;  3J80 W;  4XLC A;  4N4N B;  1MMA A;  1E4G T;  1WH2 A;  2CV0 A;  2IS2 A;  3K4B A;  4X65 H;  4KJZ A;  4OAY A;  1FMV A;  1E0E A;  2VS7 A;  2VUG A;  4RB3 C;  3CZ6 A;  4ZDO A;  3BG7 A;  4D6N A;  2W82 A;  4ZTF A;  1S03 G;  4RLQ A;  4GIG A;  2FUG 2;  5LFA A;  4DUY H;  3PSI A;  4XMY A;  4BE1 A;  4LF6 H;  1FMW A;  1WJF A;  1X1B A;  4F52 A;  4BE2 A;  2UV1 A;  2OUM A;  2Q2E B;  4BJT A;  5E5S A;  3OL3 A;  5FRM A;  4R7R A;  3DWL E;  1HNZ H;  5HOO A;  4O1R A;  1WJE A;  2RQQ A;  4HPQ A;  2WAF A;  4CCM A;  4DR7 H;  3VSL A;  1N33 H;  1I94 H;  4UN7 G;  1XDN A;  4DR6 H;  4EFE A;  4DV1 H;  4XKC A;  1P9Q C;  2K9L A;  4YEL A;  4QPQ A;  3L2R A;  3K70 D;  3J7A Y;  3DTI A;  1B24 A;  3OR2 C;  1Y6I A;  2OC6 A;  4ANJ A;  4E6K G;  4E7J A;  2IGN A;  2KMU A;  3HC7 A;  4XN3 A;  3OYA A;  1Z7L A;  2K5C A;  3D5S C;  1G8X A;  3S3N A;  4JOM A;  2LRD A;  4XLF A;  2WYO A;  2IGM A;  2E60 A;  1X1A A;  1VS0 A;  3I3L A;  1UAA A;  2O7M A;  5LMU H;  1HNX H;  4E7S A;  2VQG A;  1Y56 A;  4B43 A;  2R7V A;  1Z21 A;  2VQE H;  2XDV A;  3DU6 A;  3ZGK A;  3A2K A;  3G2B A;  3BA9 A;  3DF7 A;  2LC2 A;  1UG0 A;  1EF0 A;  2UXB H;  1XMO H;  2DJI A;  2VXD A;  4UCU A;  1N77 A;  3DQV C;  2IN8 A;  1U0D A;  3OMY A;  3K3V A;  3J7A K;  1IBM H;  3D5R C;  2ELJ A;  2CV1 A;  3BA8 A;  4UNC A;  4B3M H;  4Y3O A;  4K0K H;  2VQC A;  4AQU A;  3AKZ A;  1S9H A;  3DPT A;  4ZTJ A;  4UNB A;  4UCR A;  2XAU A;  3NZM A;  1LKX A;  4RAZ A;  3K4M A;  4LFC H;  2VB6 A;  3C0X A;  4E7Z A;  2KEQ A;  4B3S H;  1GLN A;  3RPU D;  2LH9 A;  2VBJ A;  3E1S A;  4BEH A;  2IS1 A;  1J5E H;  3HL2 A;  4JI4 H;  3OS1 A;  4IKF A;  3PN1 A;  3ZR8 X;  3VSK A;  4CCJ A;  3OTO H;  2UU9 H;  1YX5 A;  3KAL A;  4LH6 A;  3HYI A;  3EUK L;  4XKB A;  3OYN A;  2NOJ B;  5CPR B;  1XNQ H;  1G59 A;  3SDB A;  2F4I A;  2WB1 A;  3UVF A;  1X1D A;  2VBN B;  4PSX A;  2R7T A;  1WFX A;  4E4H A;  5A0W A;  4IAJ A;  2E5L H;  1MMD A;  3OYH A;  2HPM A;  3H5N A;  4RAY A;  1P8K Z;  2BVL A;  3HKZ A;  2R4G A;  4XKW A;  1OLT A;  1HNW H;  3ZCO A;  3S93 A;  3IP4 B;  3T1Y H;  4JV5 H;  1DQU A;  2IN9 A;  1WJA A;  5LMN H;  3V42 A;  1GPP A;  2O03 A;  3JAM W;  4UNA A;  4LOX A;  2W00 A;  3DKY A;  2KQR A;  3HG9 A;  2HVS A;  1YE9 A;  3OS2 A;  3HYJ A;  2VBJ B;  4APM A;  4AQY H;  3OYL A;  2JA2 A;  1ZD7 A;  4NQW B;  4B3T H;  2BW3 B;  2Z2S B;  3AFH A;  3HPH A;  4LIU A;  3M8J A;  4IQJ A;  5FRN A;  4N4O B;  4AU7 A;  3MKZ A;  3SEQ A;  2HVR A;  4HRI A;  3HUG B;  5E63 A;  3MXB A;  3SYT A;  4DV7 H;  3L4J A;  4ITV A;  3RSN A;  3EUH C;  4HNT A;  2UXC H;  1U0J A;  1D0Z A;  3FHN A;  1DP3 A;  3QQY A;  2PMZ A;  3E54 A;  3KX2 A;  4BQN A;  1ERD A;  2DT7 B;  1D0Y A;  3H5A A;  4GRI A;  1AM2 A;  5A74 A;  3C2G A;  3KAK A;  4GKJ H;  3RTR A;  5I0A A;  1T9J A;  4DV6 H;  4DR4 H;  2R7X A;  3A4C A;  4UN8 G;  2KP6 A;  4J00 A;  4C9Y A;  2X1D A;  4XQF A;  2JSP A;  4MTE A;  4HNU A;  2UUB H;  3OYD A;  1BOB A;  4HEA 2;  1MZB A;  2CH0 A;  3K4N A;  4F92 B;  4DR1 H;  4E2T A;  4OWR B;  4RB1 A;  3E0J B;  3GBG A;  1M5X A;  2R7Q A;  2ZSI B;  4CCN A;  3MXB B;  2RGV A;  4CCK A;  2VKD A;  5LD2 C;  4LF4 H;  3H20 A;  2HDW A;  5CQE A;  4U87 A;  4EFJ A;  2MYS A;  2VAS A;  2HGS A;  4E2U A;  3OYJ A;  4LQ0 A;  1SEI A;  4EAT A;  2OWO A;  5A78 A;  3EH8 A;  1V5G A;  3N6X A;  3RQ4 A;  2A6T A;  2LQM A;  2LY2 A;  1IBK H;  1OR7 C;  2R7S A;  1TT0 A;  2MC4 A;  4B44 A;  4CSW A;  4F3Q A;  1NG7 A;  4UN7 A;  2QKM B;  2I3Q A;  4CZC A;  1N75 A;  2LWY A;  4BE0 A;  2XF6 A;  2DCH X;  1J09 A;  3OIQ A;  2LRE A;  2LG4 A;  4E7I A;  4UN9 G;  4JI7 H;  3PSF A;  4LIT A;  5HVQ C;  2IS4 A;  1ZHS A;  4B3R H;  4GKK H;  4AYB A;  1W36 D;  2L8L A;  2IMZ A;  3RF2 A;  3H9J A;  4XNF A;  3DTE A;  1D1C A;  3DPL C;  2JUG A;  1UM2 A;  1WJ5 A;  2RNG A;  3LMM A;  1FJG H;  4PUS A;  2HVQ A;  2Q1Z B;  2AB5 A;  2XIG A;  2UXD H;  5IT9 W;  2W1O A;  3KO2 A;  4A2B A;  4UFZ A;  2JVG A;  4LFB H;  1X4P A;  2W4S A;  5K08 A;  4NUB A;  4XKV A;  3M4I A;  4UCV A;  1JI8 A;  2M4K A;  2XF7 A;  1FKA H;  3KEY A;  2BOL A;  4IQ4 A;  4Z20 A;  1DGS A;  4KHP H;  3RGZ A;  2HHH H;  2KLO A;  5CQG A;  2RRE A;  2XSJ C;  4PFP A;  2VPL A;  3CJR B;  2V6E A;  2M4G A;  3QOE A;  4D1Q A;  4ZDP A;  3CVZ A;  3IG0 A;  4ETS A;  1DGR M;  1MND A;  3DPU A;  3FBI B;  5KHD A;  2R7W A;  2VOB A;  3MD2 A;  5D1P A;  1T0F C;  3CF2 A;  1A0I A;  3OOU A;  2VBN A;  4DBR A;  3OIP A;  4JI2 H;  5BR8 H;  1D1B A;  4MLO A;  3FDY A;  1BR4 A;  5FD6 A;  4X64 H;  3BCA A;  3MWM A;  4PFO A;  3ZXS A;  2KRC A;  2L2O A;  2XC7 A;  4DJA A;  2JMZ A;  4Z1Z A;  3DTK A;  4A2A A;  3BC8 A;  1PYV A;  4PJL A;  4BXF A;  2KL4 A;  4KIS A;  2LY1 A;  5A0M B;  3LSH A;  4OX9 H;  4LF8 H;  1PJR A;  2IGO A;  2P0W A;  2CV2 A;  1M0W A;  3MMY B;  4BUP A;  1Z3Y A;  2W57 A;  5FPR A;  2BW3 A;  1N3E A;  2O5R A;  3DKX A;  2HQA A;  3S3O A;  4KT6 A;  1G9Y A;  4I7H A;  4UCS A;  1N36 H;  2M7B A;  3SZG A;  1QHH D;  3R7P A;  2Q2U A;  2F5V A;  2L7K A;  3AL0 C;  4P5O A;  5FD5 A;  3OYM A;  4JI5 H;  2K9M A;  3OWT A;  4J01 A;  4RZQ A;  2VL8 A;  3PUB A;  4U7B A;  2PJR B;  1GYF A;  2IN0 A;  3RIZ A;  4P1W A;  3KAJ A;  2GOM A;  4MV7 A;  3TL4 X;  1JVA A;  4XLE A;  3BG6 A;  4B3X A;  2LBF A;  3K10 A;  3LL7 A;  5HLT A;  4RB2 C;  4F93 B;  4LF7 H;  4EFB A;  3IFJ A;  3N40 P;  3RTX A;  3QYF A;  4DV5 H;  1SFK A;  5JHF A;  4ZC3 A;  4II2 A;  3H0D A;  2I8D A;  2W7N A;  4UN8 A;  3MX9 A;  3PFY A;  2ZJT A;  1MMN A;  4NC7 A;  1TAE A;  2KZV A;  4HSR A;  3L4K A;  2CUJ A;  2L9S A;  2FLD A;  2VJI A;  2WAE A;  4XR6 A;  2VKH A;  4LFA H;  1N78 A;  3OYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...