2CW8A

Crystal structure of intein homing endonuclease ii
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
537
structure length
537
Chain Sequence
SILPEEWLPVLEEGEVHFVRIGELIDRMMEENAGKVKREGETEVLEVSGLEVPSFNRRTNKAELKRVKALIRHDYSGKVYTIRLKSGRRIKITSGHSLFSVRNGELVEVTGDELKPGDLVAVPRRLELPERNHVLNLVELLLGTPEEETLDIVMTIPVKGKKNFFKGMLRTLRWIFGEEKRPRTARRYLRHLEDLGYVRLKKIGYEVLDWDSLKNYRRLYEALVENVRYNGNKREYLVEFNSIRDAVGIMPLKELKEWKIGTLNGFRMRKLIEVDESLAKLLGYYVSEGYARKQRNPKNGWSYSVKLYNEDPEVLDDMERLASRFFGKVRRGRNYVEIPKKIGYLLFENMCGVLAENKRIPEFVFTSPKGVRLAFLEGYFIGDGDVHPNKRLRLSTKSELLANQLVLLLNSVGVSAVKLGHDSGVYRVYINEELPFVKLDKKKNAYYSHVIPKEVLSEVFGKVFQKNVSPQTFRKMVEDGRLDPEKAQRLSWLIEGDVVLDRVESVDVEDYDGYVYDLSVEDNENFLVGFGLVYAHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endonuclease PI-PkoII
publication title Crystal structure of intein homing endonuclease II encoded in DNA polymerase gene from hyperthermophilic archaeon Thermococcus kodakaraensis strain KOD1
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 153
structure length 537
sequence length 537
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2005-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14528 LAGLIDADG_3 LAGLIDADG-like domain
A PF14890 Intein_splicing Intein splicing domain
A PF18714 PI-TkoII_IV DNA polymerase II intein Domain IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1010 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2cw8A02
2.170.16.10 Mainly Beta Beta Complex Endonuclease - Pi-scei; Chain A, domain 1 Hedgehog/Intein (Hint) domain 2cw8A01
3.10.28.10 Alpha Beta Roll Endonuclease I-creI Homing endonucleases 2cw8A03
3.30.1490.210 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2cw8A04
3R7PA 2IN9A 4EFJA 4GIGA 3MISA 1LWSA 3QQYA 3KO2A 2VBOA 1T9JA 2VBNB 1DFAA 2QOJZ 4AADA 1MOWA 1N3EA 1ZD7A 4O1RA 5E67A 1LWTA 3IFJA 2DCHX 2JMZA 1GPPA 4O1SA 3MXAA 2VBLA 4LOXA 4Z1ZA 4AAEA 5AKNA 4UT0A 2AB5A 4AABA 5AKFA 3EH8A 5E63A 2VBJA 2I3PA 5A72A 1VDEA 1AF5A 5I0AA 5A78A 3MXBB 4E2UA 2FLDA 4AAGA 1ZDEA 1G9ZA 5A0MA 3HYJA 2CW7A 5A74A 4OZ6A 5E5SA 4UN8G 4YITA 3FD2A 4AAFA 3C0WA 2XE0A 5AKMA 3MIPA 2IN0A 4YHXA 1EF0A 2VS7A 2LWYA 1R7MA 1AM2A 4UN7G 3C0XA 2O7MA 1UM2A 4UNBA 4D6NA 2VBOB 1DQ3A 2EX5A 2VBNA 2VS8A 3E54A 1B24A 4UN9G 3MX9A 5AK9A 1G9YA 4Z1XA 4D6OA 1P8KZ 2IN8A 4KL5A 2KEQA 1JVAA 5A0WA 4AQUA 5E5OA 4UNCA 2VBLB 4LQ0A 1U0CA 4UN9A 3OORA 1AT0A 1BP7A 3IGDA 2LCJA 2VBJB 4YISA 1MI8A 3HYIA 2JNQA 4UN8A 4E2TA 1M5XA 3MXBA 2CW8A 4UNAA 4AQXA 3UVFA 4UN7A 2LQMA 4Z20A 1N3FA 2IMZA 1U0DA 3NZMA 5A0MB 3OOLA 5A77A 2L8LA 1T9IA 2I3QA 5K08A 4KL6A 2XE0B
chains in the Genus database with same CATH superfamily
2L4MA 2HS5A 5A2QW 2R93A 1XMAA 2DW4A 4Y13A 3EUHA 2LSOA 4NC7A 2RGVA 1J75A 5J8CA 2EH3A 2EINH 1YX5A 3IHUA 1XNRH 4IF4A 4JV0A 2WY7Q 1UCRA 2JA2A 5DM7F 2JZYA 4Q43A 2QOJZ 3PR4A 1YW7A 4EVIA 4E4TA 1WFXA 3MEXA 3CZ6A 1R00A 1OKRA 2QSFX 4BQNA 4DL3A 4O2BF 2DCHX 1ZRCA 3O8HA 3CQZA 3H4BA 2W57A 4N0BA 3PNYA 2RN7A 4A2UA 3I54A 5LLQA 3RB3A 4G12A 3K1NA 1SEUA 1HR0H 2H6BA 4M9ZA 3UR3C 5IYCJ 2AB5A 3DEWA 4L5IA 2DOFA 1RUOA 4UVCA 4E7KA 4A6EA 1FYMA 3GTJJ 4AVPA 1OMIA 2WB1E 5D8KB 3HOXJ 4J01A 1BJAA 4LFCH 3GV8B 4I55F 2AXLA 1RESA 2FA5A 3G8CA 1TNTA 5KG1A 2XF5A 4TQSA 3BWGA 1FMVA 2Z1DA 1RJQA 2AQ4A 4JYAH 4LF5H 2A6EF 4BQQA 4JYKA 2KP6A 2NVYJ 2HKOA 3TOBA 4JI6H 3EYYA 1MDMB 1ZQ3P 2Y0MA 3K2ZA 3GTLA 3GLXA 1NK3P 1V51A 2W9CB 2M4GA 5KHDA 2HEOA 1Z05A 2CG4A 1BXRA 4XSXF 2E1OA 4F7ZA 4A5NA 1MMNA 3K4CA 1EF0A 2M05A 1E3HA 5A2QZ 5T14A 4BBRJ 2UXCH 1WJAA 5KT3A 3MFHA 3PUBA 5F9NA 4UNBA 1XC5A 4PJLA 4Q5SF 3GILA 3H20A 1FC3A 1SFUA 1REPC 4KITB 2P7CB 5IT9W 3BP8A 2L02A 4UN9G 2WYOA 2R7ZG 4NC6A 2E2HA 5LP6F 2HQAA 4S04A 4A3CJ 3B73A 1EA3A 5HODA 4A3FG 3ZMZA 5E8IA 6PAXA 2YX7A 4QFQA 5E5OA 5FB2A 4LF7H 4R1HA 1FJLA 3MKWB 2X9DA 3CD6I 2FK1A 5LOVF 4HF1A 5M5WJ 1IGNA 3WTYC 3OORA 3RIZA 1E2XA 3QYEA 1KJQA 1QBJA 3AG3H 1HQCA 2R5YB 2KFDA 4XSZF 2ASLA 4ZTFA 2EFNA 4BAYA 2DJNA 4F91B 2WAQN 4EBDA 3I64A 5CQEA 2DFIA 1XX5A 3GZ6A 3SI8A 1P2FA 4RM2A 4IRDA 2EA2A 2QF7A 1IOVA 2LLKA 5C44G 1CQJB 1GVJA 1RRJA 4O3NA 5FKLA 4B09A 2DK5A 4DJAA 4LX3A 3OYCA 4CO8A 2KJBA 2PJRB 1Y1WJ 3SZPA 1KU3A 4MEXF 3BPXA 2F4OB 3SXYA 3GTQJ 1YI2I 3RGZA 4HV6A 4XX0B 1A9XA 1R4NB 1LDJA 3K1PA 2EIJH 4OWRB 4XK4A 4XLHA 2NU7B 2R8IA 4ECZA 3GTKA 3Q3SA 4EG0A 1M1EB 3H0GA 3OYFA 3GTOJ 3H0DA 3FDYA 3H3UA 2ICWG 2DA3A 2IN9A 3FKIA 5IPAA 2CUZA 1B6SA 4PJ0C 3MWDA 3DWLE 2ZJTA 5DLGA 3S15J 5GONF 3WODF 3RQ4A 3AYHB 1JGGA 2NU6B 4UCTA 1JJ8C 4OMYA 2HGSA 3QP5A 4EEYA 5IT9Z 4CGZA 4A0ZA 2BY1A 4O3PA 2IGMA 1IV8A 5KT7A 1PUEE 4X62H 1X1CA 1ZQ7A 4MNUA 4BJ5C 4GYGA 2HJWA 5KAIC 4PZJA 3HSEA 3PNTA 2DQRA 3H36A 3GTGJ 3VODA 1A04A 1Z91A 3TO9A 3CO7C 5KKNB 2IN8A 4RAZA 2CZGA 4LF4H 5M3FJ 3WG9A 5BMZA 2F4LA 2VKHA 5EZGA 2OCEA 2YR2A 1RPWA 3LMLA 4GKJH 4ANJA 1EH6A 1LQ1A 2I3PA 2QZ8A 1D0XA 1MMAA 1SANA 3DCFA 4XL9A 1XMKA 4WXHA 1ETOA 4HDUA 3E0JB 4JQFA 1VDEA 2A5WA 5JVLA 2F48A 2VKEA 2NAZA 2ESHA 3FK7A 2MD0A 3HRTA 4U7BA 4D1QA 4YJ2F 1OQYA 2FLNA 4ZZDA 1WCMJ 1MJ9A 3VYRB 2BVLA 4B8XA 3GW2A 3ASNH 2XCPA 5KG3A 1KONA 2JTVA 3ROUA 1PUFB 1WH2A 1D3YA 3GBGA 2ZMEB 4RB1A 2CW7A 4JV5H 3OYHA 5B1AH 2FP4B 3DTKA 3T5XA 4GYIA 3OL3A 4HNTA 3AKZA 3J81W 1WZ2A 3Q5FA 2GPSA 2DA5A 4IVNA 3TIGA 2IGOA 1G6NA 2KT0A 4IZZA 1K79A 4RUAA 4P9UA 5JLWA 2CQKA 2ID3A 5HOOA 2FMYA 4RLQA 1P7IA 5KFMA 3HDDA 1FX7A 4EJVA 1B24A 2M9HA 5KFYA 4I02A 3ZGKA 3BC8A 3R61A 5EJCA 1T98A 2LKSA 1W1WE 1FT9A 1WI9A 2VODA 3DQVC 4ZYEA 2XGCA 3IL2A 1D5VA 4G7HF 1JGSA 2EPFA 1I50A 2LDUA 3BG5A 3JZIA 3D5LA 1I1GA 4XLEA 3C3WA 3I0TA 3L2VA 2DMQA 2Y9YA 3DEUA 3ERED 2R6FA 3FMAA 2KDOA 3KAKA 3U9TA 2VQFH 4LLGF 4O3RA 1XNQH 4ED0A 3HOYG 1YLFA 4B4CA 5M5XJ 4YRVA 4LF6H 2PMUA 4M9XA 5F04A 3IG0A 1FEXA 3T5LA 1O3TA 1F5TA 3KAJA 3U1DA 2BXZA 1RUNA 4L9TA 4UN8A 1S97A 1M5XA 1N32H 2HOEA 3DPUA 3DU5A 2HGCA 2JJ7A 2HHHH 2E71A 4MFEA 3OS0A 3DKXA 5KFZA 4IHWA 2VQGA 4DL7A 3LMMA 2GA1A 4ECTA 2IMZA 3OOPA 5DQIA 2RQQA 4DL5A 5JR3A 3TO7A 1HSJA 4HEA2 3AFHA 5A77A 3MQ0A 2YU9A 1WVRA 4N9HA 2M30A 1BJTA 4C3IJ 5LHHA 3GLKA 2I10A 3J81Z 1B6RA 5B66C 4QWEA 1OCPA 5B5EC 3BTJA 4N4NB 2E5LH 4JI5H 5K5QA 3ZMDA 1F36A 2IVMA 4N4OB 1T2KA 5D8LB 3WU0A 3G1OA 2IT0A 5KK1A 1LWSA 1TLHB 2SCUB 1MBHA 2FQ3A 3FZVA 3ZQ7A 4LFUA 5J1UA 2R7RA 3BPVA 3K3VA 4ECUA 3OYNA 3E5UA 1W7PA 1V54H 3FIWA 4AD9A 4LG3A 1T38A 2WA0A 1MH3A 1NG7A 3HG9A 3OYKA 3LQQA 4GCVA 4EFEA 2J9GA 1XDSA 2DMTA 3MWMA 1GSOA 1RNLA 2R7FA 2YUSA 2LKPA 1LWTA 5FD5A 4M9SA 3H40A 3BR1A 2ZB9A 3QPLA 3TO6A 2XD4A 2EJRA 3BTCA 3H92A 1DGSA 1K83J 2V1UA 2K27A 3SDGA 4AAEA 2PN1A 2HTSA 2V5AA 4F4ZA 1HKSA 4KMUX 5AIPA 3QFFA 2J6UA 5C4XG 1LVKA 2RDIA 5ICGA 2C2EA 2LC2A 3OHBA 2DA2A 2YZMA 5KFLA 2QKMB 1RJRA 2E1NA 3ZXSA 2HVQA 3CCVI 3LSMA 4A3LG 3TDUC 4O4HF 2OAZA 4G7ZF 3S1QJ 4C5CA 3DU6A 3HOZJ 4M73A 2JUGA 1X1DA 2XSDC 4Y4RA 5DG8A 1U2WA 1D0ZA 1R5HA 4A3BJ 1TZLA 5DDGA 3BZKA 1SD4A 4HV5A 4BDYA 4N9IA 3CLQA 1FYLA 1TA8A 4PFPA 5CVIA 5J1RA 3IP4B 2MG4A 4V2FA 2CV1A 4U0WA 3C7JA 2XGPA 2ZKZA 1BR4A 2CH0A 5FO5A 2WAQA 4CA0A 1HOMA 1DQ3A 1YYVA 3KHRA 2AGPA 3JTGA 5IYZF 1ZLJA 4J0MA 2H94A 4XRSG 4MV6A 2ZJRF 2HOSA 1SVLA 3ZMVA 4JX6A 3DF8A 4Y52J 2G7HA 1JHHA 1H9TA 1G3TA 1GV5A 3DLAA 3FKIJ 2XF7A 3TQ1A 3WHBA 4FASD 3PSFA 5EEAA 3GIMA 2V1NA 4UN9A 3Q2OA 2X0LA 1VQMI 2R7ZA 1TWGJ 4BY7G 4LITA 3NEUA 4KFCA 3DXJF 4BWSC 5HV6A 3LSHA 1V5FA 1TWCA 3RKYA 3ORRA 1YIJI 2M45A 1TQIA 1X4OA 1KQ0A 1MBJA 5LGUA 1ZRDA 4R8UA 1H89C 2GBYA 2F2EA 3F8BA 4GRIA 4AQXA 1FSEA 1ZLKA 1HC8A 1EUDB 2EIMH 3KP2A 4CSWA 4BH9A 4BS9A 2XGXA 2JWTA 2EFQA 2QM3A 1JJ6C 5C1PA 2CJJA 2L3DA 3LA2A 3A03A 3SFIA 4ENMA 3B6CA 4KIFA 3E6MA 1LE8A 5K08A 4D5CA 1T0FC 4S05A 5FLMJ 4GLXA 2N8GA 4J9NA 4I6ZA 1HXDA 2JN6A 3WE3A 2VKVA 3HIFA 4KT6A 1GGOA 4Z2YA 1FYKA 5KT6A 3E7LA 4BUPA 4NXNH 2K5CA 2P6TA 3LNQA 1P9QC 3OHAA 4EGQA 1S0MA 1XG1A 4FBUA 1Z2NX 2P8TA 4AU7A 3IN5A 2OA4A 5L1LA 3LAPA 2VQDA 3MWEA 5K1YA 4LMYA 5GPAA 1NG6A 2PX9A 1OYYA 5TISC 3SJMA 1B8IA 2BQUA 3TEDA 4BXXG 5KT4A 3MD2A 3MKZA 3HC7A 2Q8KA 2VBYA 2JMZA 2PQ8A 1S7AA 4F3QA 2F4IA 4AYBE 1FIPA 3CMYA 2AGOA 2LMDA 4IOAF 2UUBH 5EZHA 2XB0X 4P96A 3R5XA 3BQ1A 4LGWA 4M6YA 1DDNA 2ZMEC 1MH4A 4JP0A 5J40A 2BV6A 3H9GA 2VJIA 4PUSA 3D0SA 2JPCA 1A35A 3AG1H 2VJ5A 4D5FA 5J4VA 2B7EA 3CDIA 3WTXC 3OY9A 2FLDA 3V4SA 2XUBA 4U6PA 1S9FA 4F93B 2IMWP 2Y30A 5DCFA 2X6YA 3WG7H 5DQHA 3JREA 4O3OA 2W6QA 5KNLA 1G2HA 4HAMA 3ZQFA 1W96A 3ETHA 2W6ZA 5HLIA 3ABUA 2FJ1A 1F1ZA 1GXQA 5CKTA 2C00A 3GTMA 1Z0XA 5DM6F 3L00A 4EGYA 5JHUA 4FU0A 1XMXA 3KCCA 3C0WA 2VT2A 5D8DA 3HEFA 4YR0A 3PM1A 2QKLB 5KG4A 3ZPLA 1VQNI 1XSVA 2O7MA 2E5ZA 1I3QJ 2D45A 3RZOJ 2DIKA 3BR0A 3BR6A 2HZDA 3QQAA 3AL0C 3Q0VA 1I7NA 4PSWA 1W7PB 2IA0A 2LKXA 3N05A 2HVSA 1ZHFA 4Y15A 1TWHA 2ALZA 1WHUA 2J5OA 2YU9J 4ECVA 2JA7J 5K5OA 1EYZA 1ETVA 3OYDA 4I0AA 4RAGA 2ZC2A 4DL2A 2W48A 5LD2C 4IZOA 3FBIB 3G2BA 2CYYA 3PR5B 2W85A 3CJTB 2JA5J 3S1RJ 3GIDA 2FBHA 1Z77A 4DQ2A 3TQTA 2A68F 4HNVA 3N97A 5HS8A 3JSLA 2OJED 1KEEA 3JSNA 1TQPA 3FX3A 2H8RA 2VOBA 2B63J 4I98B 2BOLA 1VF9A 2UVWA 3GO5A 4JI4H 2NNYA 1Y1VJ 4IHJF 2P6SA 2EILH 3HRMA 1IRZA 5IYBJ 3F8FA 2B9SA 4ED2A 3T1HH 2NS0A 1KJIA 3OV8A 1U0DA 3BABA 4BE1A 4J9QA 3VPDA 1FWZA 4BBSJ 1ZR4A 4X1EA 4A3KJ 4ZDPA 3D5RC 3R60A 4ESBA 1SFXA 3H3VK 1VZ0A 4TV9F 3BJYA 3QP6A 4MIMA 3ZMUA 4X64H 4I0BA 2TDXA 1HA8A 4MA0A 2JT1A 4EJOA 4F4WA 4LF9H 1E4FT 4ZDLA 2GXGA 4MEYF 3AAFA 3D5SC 3A2KA 2A6HF 3E3VA 2R3SA 2RNGA 5HLHA 1T9JA 4UCUA 2IBKA 1I6XA 5HDKA 2M87A 4EV0A 2O61A 1XCBA 1IN4A 3OMYA 3QAHA 2ZNYA 3OYLA 2PJPA 3HRSA 4AADA 4ED1A 3ECHA 2EFPA 2L2OA 2FD5A 3RV4A 2VLAA 1IG7A 3GYHX 4JOMA 1U5TA 5BMVF 2XCAA 2VA3A 2CQQA 4JX5A 4J9RA 2XC7A 3HSFA 3L7WA 2Y75A 3QU3A 4V19K 1RR7A 2R7TA 1SFOA 1HKTA 3ZQQA 1R22A 2XPWA 3OYIA 2W70A 1VBGA 1ZRFA 1BNCA 3GF2A 5DYMA 1CF7A 4QW8A 2OC6A 1ZG1A 4HQ6A 3I4NG 4HPQA 4LSAA 4RUCA 3FHNA 2STTA 2CSOA 1UC8A 2GOMA 2EB7A 4NXMH 1T39A 3T8RA 1U8BA 5L3GA 2Z2SB 1AUXA 2X6OA 3PFYA 4I01A 3P9KA 1HKQA 1UG0A 3CMMA 4WX9A 3MFKA 2HR3A 5CVRA 3K0LA 4ASNA 1MBEA 3HB9A 4YG2F 2F5CA 4XN3A 1IN5A 1VBHA 4Q47A 2FUG2 2NVTJ 1O75A 2BVMA 3ETJA 3Q8QB 3G6YA 2DDBA 1AOYA 3S3OA 1LE8B 2CRGA 2FRHA 3OWTA 2ECCA 3SZGA 4ZYDA 1TWCJ 2MC4A 4YITA 3HKZA 2VC0A 4HG2A 5BS6A 3PW7A 3IV5A 2R5ZA 4EYHB 1IXCA 1WSCA 1DPRA 2PMHA 5C3EG 3BZCA 2OQGA 3PQKA 1SVMA 5CJ9A 2LWYA 3C0XA 4MV7A 3HOVG 4BKXA 5EWFA 4A3EG 2DOEA 3ZQLA 4A3JJ 2CQNA 4YFXF 2VJJA 3O6BB 2F5VA 3J7AK 2YS9A 3KALA 1TQMA 1EHIA 1SD5A 2DI3A 5KFPA 4GFBA 4DR5H 2KQRA 3U21A 2R7SA 2MH9A 4K0KH 1SAUA 2MW8A 4ZH4F 2CMPA 4DV7H 3R5HA 4XYMB 3LSIA 2V9WA 2GPWA 3RIRA 3F23A 1RKWA 1B8IB 1GV2A 3ZR8X 2D5VA 2H8WA 4M74A 2QENA 2WAEA 2Z9OA 1SEIA 3RV3A 1BJZA 1Y0UA 5ICFA 3E5XA 1Z9CA 1BGWA 2EK5A 1F43A 2OH2A 4ENKA 2NVXA 3PW0A 1XPXA 4XRSA 1MMGA 4DUYH 2ZSHB 4HX8A 1CQTA 4UCSA 3V4ZA 1WH7A 2K85A 5FKNA 2H1KA 5CQGA 1MI8A 2FSWA 1B04A 3G6EI 1I27A 2L01A 4A3MJ 4ECRA 1PDNC 1OCOH 4QIWA 5CYVA 2QSGX 5B3SH 1T0FA 4A3DJ 1Z67A 2GQQA 3CCMI 4BQAA 4KISA 2LFBA 3DTEA 2DXIA 5DLFA 5FKMA 2HYGD 1YO5C 2DYRH 3C2HA 4BHBA 1WR2A 4DLKA 4C2MA 5L1IA 2YPRA 2OBPA 3ZMTA 4KHPH 3WGGA 5C4JJ 1JXLA 1X3WB 4II2A 2GWRA 3EQLF 4UY8I 2DBBA 3CF2A 4X6AJ 2JA8G 1ETQA 1K6OA 3GV5B 1XD7A 4LLNA 4E6KG 3R6SA 3GFLA 3M9NB 1R5ID 2FB9A 4L5EA 2NXNB 3BY6A 4L9JA 4BY1G 1DFAA 2RDJA 4KN7X 3VOEA 2DU9A 3JRCA 3PW4A 1TTYA 2VPSA 1RI7A 3HGYA 1JDEA 3BROA 3T8TA 1ZTRA 2UU9H 1U0JA 4WD3A 4IRKA 4E7JA 3PIPF 1GYFA 3IAS2 3I9V2 1Y39A 4DV1H 4IRHA 5FLXK 1U3EM 2FJZA 2W82A 1DP7P 5E3OA 1X3ZB 2GZWA 2IAIA 3MMYB 4BU2A 1ETYA 3WGIA 2EQRA 3ERMA 3CC7I 2Q1ZB 2XVCA 3RZDJ 1D8KA 2IGNA 2E2JJ 3I53A 1TWHJ 2NVUB 3DKYA 2EIKH 1QZEA 3CCYA 4TV7A 1D1AA 4OAYA 2JA7G 2VPLA 4RB3C 5A78A 2QBYA 3Q8SB 2O3FA 2V7FA 2TRTA 1M6VA 1NH3A 4J9PA 5EYRA 2C28A 1PP8F 1LUJB 4AAGA 1ZDEA 3Q9SA 4RA2A 5F0HA 5JVTA 2JA5G 4E7IA 2RC4A 2RKHA 2A5YB 2K9MA 3BQZA 1YOVB 5A74A 1ORKA 3C2GA 4JI0H 5GPCA 1KJ9A 1G4DA 3I4MG 1ONVA 1IXSB 1IXRC 3KYDB 3HPHA 3Q0UA 3RBEA 1T3NA 3LA3A 4LD5A 2H09A 2E2IJ 4Q4ZF 4DV3H 1DP3A 1AM2A 4G6QA 4UN7G 2O6GE 2E7WA 2HYFA 2WBMA 5L3EA 3E6CC 4CHUA 5IYDJ 1U6GA 1Y1VG 3G1LA 3RB4A 4QPQA 4D6NA 4AIHA 2R86A 2K9NA 1GSAA 4BYYA 3L4JA 4QPOA 1D0YA 1H8AC 1BA5A 3CJNA 1E17A 4MO7A 5EDWA 1BW5A 2A61A 2BHYA 2KEQA 3GV7B 1SMTA 1U5TB 2EV5A 4MQVA 2KRHA 4P5OA 5GTHC 2P5VA 5HLGA 1O3SA 4L5JA 3EPGA 3G6XA 5JLXA 3ZP5A 2ZXWH 3VYTB 5TRDA 4LQ0A 1JX4A 4H4KC 2Q2TA 5EOYA 3BG9A 4YR2A 2VUMJ 3N44B 4C2TA 4HYKA 1MIJA 2WTEA 4QWDA 3UFXB 2M0CA 1DU6A 1YS6A 1CF7B 4YELA 2W8KA 4I2OA 2ZSIB 2JNQA 4Y17A 3PO2J 3I12A 2BR0A 1Z2OX 1LDKB 5KT5A 3RBDA 1P92A 4M7EA 2IS2A 4H0EA 2JVHA 5E3LA 1Y14B 4DNCA 1RZ4A 2QYOA 3HOUJ 1YW9A 1N3FA 2WAQE 4EFBA 1N77A 2Q0OA 3JSOA 3NGDA 4IR1A 1IZ1A 3K69A 5GP9A 1HW1A 1ETXA 2L8LA 5IP7G 1E3PA 4ME6A 2VXZA 2QUFA 2R5ZB 4M3EA 2R8HA 2VPRA 3RKWA 1P4WA 2DT5A 1BI2A 3L09A 5F08A 4YIFA 2CWEA 2VI6A 4QWAA 2BE5F 2BGCA 3KO2A 3BOQA 1P6RA 4MLOA 2UVVA 2R7LA 5KFJA 4FISA 3GMEA 2XCLA 1EJ9A 5FKKA 5L9XA 4IHTA 1KBLA 4ED3A 1J5EH 3H3VH 2B0LA 2G9WA 1TAEA 1DV2A 1TWAA 5IOYA 2Z33A 3OIPA 5H6RA 1R23A 1USTA 3I3LA 3FXLA 4G8XA 4LOXA 4JI3H 4G3IA 1RYSA 4M72A 4XRFA 2AHQA 4XQFA 3J7AY 1RK6A 1JE8A 3L4KA 4J9OA 2VIXA 3BT9A 2VE9A 4A3IJ 1Y8RB 4IQ4A 2BHZA 2JRMA 5A2QK 2JA6J 1BI1A 2ZJ2A 4KT5C 3F6VA 2V4RA 4CYDA 4EM1A 2CQYA 4OIPF 3KE2A 2R92G 5D6EA 2XF6A 3VYUB 3VYSB 4ESJA 2VQEH 3E6BA 1L3LA 2W6NA 3Q1KA 3BR3A 2IRFG 1ZGWA 2L9SA 4L9NA 3KHHA 2F4VH 3U2RA 5JH7F 4R7RA 1JT6A 2NVXJ 3V6HA 1TNSA 4EBCA 1POGA 1C3OA 2W00A 4DZJA 4EGJA 4HBLA 2A69F 1JHFA 2UUZA 4XLPF 5C1OA 4AAFA 2KZGA 1X3UA 3BCBA 5HS9A 2X6XA 1KC7A 2BXYA 3K2AA 3J7YJ 5ICEA 1KYWA 2XKPA 2PVPA 2FOKA 1YIOA 2HPIA 5GAEJ 4MFDA 4A3DG 1B4AA 4Q48A 1ZH5A 4IHYA 1LFPA 2MH2A 4G6TB 1AHDP 2VBNA 5FGMA 4PJMA 5H2FC 3DLLF 2BY3A 1K61A 4E70A 3K70C 2BW3B 3JAMW 4IWXA 1V55H 4JV1A 3TOAA 1YS7A 1IC8A 1TW2A 4HW0A 4MTDA 2HQRA 4B47A 4LB6B 2R7UA 5A0WA 3KYCB 4PJNA 2OCCH 3ECOA 4XLFA 1BI0A 1G8XA 5JFRA 2M1BA 1VKZA 4L1KA 3CJQB 3T1BA 3E5NA 1XS9A 3OYJA 1STZA 1FBUA 1QPIA 1TL8A 1V4YA 1ZHSA 4IXAA 3M1EA 1M7JA 1EUCB 3CUOA 5LBQA 1JUPA 1R7JA 4B44A 2QBYB 3DPLC 3HOTA 4MV1A 5JHFA 5JUMA 4UNAA 3X2QH 4ENNA 4ED7A 4IHVA 3HL2A 2A05A 3WHCA 3PO3G 3CVZA 4FE4A 1BC7C 4ZI7F 3KEYA 2XPUA 3F8NA 1JKRC 2VC1A 4P9FA 2E60A 2ZJQF 1ZELA 2BZTA 4TV8F 4LF8H 1MBKA 2VUGA 3H5AA 1T8IA 3AL0B 1S10A 2ZM6H 2R93J 3BJAA 1V5GA 4NLGA 4DR3H 2XSJC 5D1PA 2R7MA 2CV2A 1BR2A 1FOWA 4FETA 4R79A 2JEFA 3JRAA 3COAC 4GIGA 2BY0A 2LK2A 1SAXA 1OYIA 1W4MA 1EZ1A 3N6XA 5I47A 3S3MA 4F4XA 2NYXA 4CH7A 4A3GJ 2DMUA 1RK5A 2HXOA 1MBFA 3CCSI 2JSPA 3OS1A 3JAMZ 3M8JA 2QQBA 3WTUC 1N3EA 3CQZJ 1NHAA 3GIPA 5HBRB 4GDFA 3IWZA 1F4KA 2ZDHA 3K7AJ 4NNJA 5IYCG 3BG3A 2A07F 4O1SA 2LYCA 2W7OA 2X1EA 3LSPA 4BXUA 1XSXA 1J09A 2OQRA 3A4CA 2V59A 5DGAA 5K7FA 2W7NA 4AABA 2XGQA 2CV0A 2C35B 3A0HC 2FPGB 3HOXG 2VBJA 4X0GA 3ZQHA 5E79C 2HYJA 3WTTC 4DR4H 5KFNA 3GWZA 3ASOH 1OPCA 3CTAA 4L9VA 4Y8VB 3O8GA 3ABLH 4EEFG 2JPBA 3DV8A 4QWQA 3WU1B 2WTFA 3EUKL 2H27A 1UFMA 1V3FA 3O3KA 3GTLJ 5HS7A 5LRSA 5K5RA 2DFFA 1XSDA 4D0PA 1YTYA 3S16J 2OLSA 2XDVA 5KG2A 2X51A 3SFZA 1T56A 2FPIB 4ECYA 1OR7A 5KG6A 3TGNA 3L2QA 4BNCA 4BBRG 4IHSA 9ANTA 2VBXA 2JEIA 1F9NA 1VQ9I 2XE0A 2M3AA 1U5TC 1LDDA 3OSPA 4HR7A 1HDPA 3OS2A 2NS8A 1K7AA 2E2HJ 5HVQC 4TQRA 1OYWA 4IR9A 1E0EA 4XOPA 4A3CG 2NRAC 1I6HJ 2YYAA 3LFUA 1ACIA 5KFVA 1IDYA 5F1JA 5AK9A 2DCEA 3HPGA 4D6OA 3CF5F 2X0SA 2CFOA 1FOKA 2O03A 4IRIA 2X4HA 2NNNA 1U9NA 4DV4H 2DA4A 3WTWC 3G71I 1JI8A 4K2EA 3RKXA 2WB1A 3ZQCA 2DPUA 1U0CA 1HF0A 5IWAH 2V9KA 5L3FA 5FJ8J 2JSCA 2Y69H 1A5JA 3IGDA 3TDZC 3RKQA 3FHZA 5FRNA 2I8DA 4PSXA 3M9AA 3QPSA 4DR2H 2HFHA 4QW9A 3T5HA 2HTJA 1RKTA 3QYFA 5FFXA 4WBNF 4NQWA 3KZIC 2JQ7A 2R7VA 3C0FB 3V4GA 1UZCA 1YJNI 5L3CA 1Y1WG 4DV5H 3TP0A 3LFKA 1VAJA 1TWAJ 1WJDA 2EFOA 2W25A 4C3HJ 2L9NA 3CJRB 4XKBA 3GLLA 3UVFA 4FQGA 1J5YA 4O2AF 3ZN0A 3GTKJ 2O8XA 2WE6A 4OIQF 4APMA 3H0GJ 4A3IG 5D4RA 2W6MA 4RNOA 3HKZN 2JA6G 2Y2ZA 3S2WA 3L2PA 1QPMA 2AQEA 4CCKA 4S0HB 5L3BA 1J2XA 1TWFA 1XGSA 2AGQA 5H80A 3KTMA 5CLSA 3IKTA 1J7KA 3KP6A 3I56I 3DTIA 4O3QA 1W7PD 2K4BA 2UZKA 5BOXA 1S68A 1FBQA 4XOTA 3WTVC 1ITYA 3K4MA 1U78A 2VBNB 3HTUA 2Q2UA 2XGEA 5HNFA 1TP4A 4IWYA 2F5DA 1U8RA 3K6GA 1I39A 1IRXA 1X58A 1MOWA 4XICA 3CDHA 4JUZA 2KLOA 1N36H 1O3QA 2KJCA 1JKQC 1IUFA 2YL2A 5KFGA 4RNMA 5BPHA 1KU9A 1LJ9A 3DBLB 3RDIA 1VQOI 2L7MP 5CPRB 5D4SA 5AKNA 4DUZH 3V8LA 5LYJF 2RREA 3FM5A 3KZZA 2L9VA 5E63A 1Z3YA 4QWBA 4DL6A 3LA7A 3AG2H 3E97A 1WCMG 1QNTA 3JRXA 5F9LA 3TIIA 4A93J 4QIWN 4EATA 4JBAA 3QU6A 2O0YA 3S1NJ 4HYEA 2FLPA 3ML6A 4FHTA 1JKPC 2E5NA 2X6WA 3CUQA 3F3XA 3G3ZA 4ITVA 4RM3A 5DCMA 4D9JA 2RDPA 2KKOA 1WWXA 1ZREA 3RUPA 2ZBKA 3IC7A 1IN6A 3PVXA 2R92A 5L3DA 2WV0A 1LFUP 3I5UA 3PIOF 5CAEB 5M3MJ 5GTIC 5DGBA 3FD2A 4YQWA 4ZHQF 2IJLA 1SD7A 3CCQI 5AKMA 3BR5A 1WI3A 2K7LA 3F0CA 4DW6A 1R7MA 2VONA 3IH2A 2W71A 5KFIA 4EQQA 3ABKH 5F64A 2JEJA 3DFGA 3S93A 3J7ZI 2EZLA 4LH6A 2X1CA 3HTSB 2EX5A 1G3WA 4W1UA 4EM0B 2C2RA 5HNHA 4BE2A 5EDNA 4DR7H 1I50J 3HHHA 1G9YA 1YQAA 2STWA 1SFEA 3E5QA 2IP2A 2IS1A 4KL5A 2ELHA 2K3PA 2QEXI 3T5KA 2PEXA 2R93G 4OAZA 1H9GA 4Z6YA 4IX7A 4DGWB 2IPQX 3KIOA 2FF4A 3V7CA 5KFCA 1BN5A 5LEKA 3ZCOA 4MQ9F 4ON0A 3ZQIA 5GADJ 2Y9ZA 3M8FA 4BQOA 2XROA 5E1XA 1W36C 1QRYA 3I58A 4BDZA 4Q8EA 2D2WA 2VBJB 2FEZA 4O4IF 5LRRA 3KEQA 3JRBA 3TINA 2VKDA 5D6FA 2XAHA 2IS6A 2DO7A 2FU4A 3BLYA 5DD8A 3QPTA 1W0TA 3LP8A 2E1CA 4UV8A 3MXBA 5KFAA 2FNAA 4UCOA 3PQJA 5IP9J 2IS4A 1UB9A 3VPBA 1NK2P 2QK4A 1OISA 1UNNC 2UXBH 4RMNA 1N34H 2UWMA 2V4JC 4XMYA 3CC4I 3OOLA 1HCRA 5IOZA 1JIHA 3QOPA 4MA5A 3GTPA 1N33H 4EJTA 2EWNA 2MABA 2Z3YA 4KUMA 3K5HA 2XAUA 2XE0B 4QLCU 4HF2A 1AN7A 5C5JA 1RR8C 4RS8A 3R7PA 3JRWA 1IRFA 2JUCA 2L7FP 1D8JA 3SEZA 3VMMA 2VBWA 3L9FA 3W2VA 3A01A 3VSKA 4L0ZB 3HOWJ 2WADA 3K3PA 4G9YA 1S0OA 3CMAI 2IA2A 3SZTA 2DFHA 1Y56A 2MLGA 4B3MH 3N4MA 3RAQA 2W84A 1DGRM 1ZARA 5B1BH 4ESFA 2FMAA 1X2MA 4JI2H 3H5RA 4EM2A 4LJZF 5JVDF 3A0BC 2KIUA 3G73A 4PCQA 4QWCA 4I50F 2K3FA 1LB2A 1BL0A 2RAEA 4KIGA 1FP2A 1XGMA 3KPHA 2ZJPF 2YSRA 1AWCA 2BQRA 3GEZA 3ZOBA 2HOTA 2DTRA 1IBKH 3LAJA 3F9KA 1FNNA 1I3AA 2P5KA 2Z5UA 4C3JJ 1X9NA 3K70D 4J00A 2MYSA 1M0WA 3RPUA 4HDVA 5KT2A 5H6QA 4LB5A 3KX2A 2V9PA 2Y0SN 4NQWB 1KYZA 3HOZG 5I0AA 4C5AA 5FKOA 3RAXA 1MSEC 4QSHA 5J2TF 4O3SA 4ZZLA 2GXAA 3GTJA 2G0EA 4UUSA 2DWCA 5HDGA 1I7LA 1IBLH 4A3BG 4XORA 4HLYA 5EEHA 1E4GT 2HZTA 4ENJA 1WJ5A 2A6TA 3E1SA 5KVRA 3V6JA 3PZPA 4M6XA 5FJ8G 4B3AA 5D5UB 4IPAA 1KU7A 2ZXHA 4C30A 2MA3A 2BYVE 4IO9F 3BG6A 2NVYA 2DMNA 4DV6H 1M0TA 2ZDQA 5F0FA 2XIGA 4CXFA 3LWFA 1AKHA 3WGHA 2HDDA 2XKOA 3FM3A 4MV8A 3OR2C 2F4MB 2L54A 2M34A 3JRIA 1YHQI 2KSWA 4FX0A 4NHJA 1FLIA 2V6CA 4HSRA 4FM9A 2K9LA 4PGHA 1RIOH 4UCRA 1B9NA 4UHTA 4XKWA 5F6FA 3GFIA 2R85A 3WO0A 1ON2A 4CZCA 2VOOA 1ZHQA 2MLKA 3M4OJ 3MKYB 3FKIG 3H1CA 2VE8A 5LL6b 3ABMH 1ZK8A 1I1SA 1JKJB 3U9SA 2R7ZJ 2MCTA 1S3JA 1OCZH 3W2WA 1VTNC 1CGPA 1K78A 3RI4A 4UNCA 2CUEA 2ELKA 2PMZN 5ILSA 5FLXW 3J80W 1ERDA 1NTCA 1SFKA 3KFWX 4A3FJ 3VWBA 1GHCA 1J0RA 2KRCA 3MN2A 4FTHA 1Z1DA 4L18B 1W93A 5EG0A 2LF8A 3C18A 4ZC3A 2GLOA 4PJJA 1XDUA 2DT6A 2OD5A 2L7ZA 3UKGA 2ZDGA 4YR3A 1QVTA 5J6XA 3BA8A 4CDGA 2W6OA 2I80A 3CCRI 4E2TA 1FPQA 3CDLA 2ASJA 4IRGA 4P1WA 1E4EA 3K10A 1T33A 2MFZA 1MJBA 3CUQB 5FRMA 5K2MA 4E7SA 5DCMB 3WTSC 4EGZA 2R7XA 5FLMG 3RPQA 4J9SA 4U88A 2VPQA 1Y1WA 2ZFUA 2CFXA 4UB6C 1H88C 2FMLA 3GTQA 2HQ5A 4W97A 1W5SA 4YHHH 4HX4A 2W1OA 2EZKA 1DU0A 2FQ4A 1APLC 2RF4A 1IW7F 1ENHA 3Q9VA 3GTOA 3KHLA 1FP1D 2QGUA 3U1KA 3J80Z 2K9SA 1IJWC 2LG4A 2C2DA 4EJUA 1BC8C 2G7UA 2R8KA 1SC7A 2FXAA 2Q2EA 2KIMA 3L2CA 1UELB 2GXBA 3OSNA 1S5LC 2UUCH 4YFNF 4LSXA 3T1YH 4QTRA 2RQPA 4Y33A 5KG0A 5FLXZ 4GXOA 2WAFA 3CP8A 4KN4X 1FOXA 3V7SA 3GTGA 3WO1A 1TW3A 1G3YA 3B6AA 2R7WA 1X4PA 4B1RA 3S17J 1X1AA 1BM9A 2CUFA 5LA6F 2LOOA 4LFAH 3FXOA 2DFEA 4RB0A 1DPUA 5KFSA 1FJGH 4IQJA 1B9MA 3MXBB 2IEKA 4MV3A 1H0MA 5EEGA 4HQMA 1N25A 4M9UA 4JI8H 4CCLA 2IBDA 3DP7A 5BPDA 2M2EA 4ECQA 1ZR2A 4WWCA 2HWVA 1XN7A 2FBKA 4O6JA 2BW3A 4D7MA 2R0QC 3LL7A 4DZPA 2NVQJ 3GTMJ 2ETHA 1WCMA 2R84A 4RZRA 2UVRA 2EZHA 1MZBA 4UN8G 2CQ7A 3SQNA 5DG7A 3FDSA 4LFBH 2CGPA 2P81A 4UVBA 1XGNA 4XKVA 2NU8B 1QHHD 1KU2A 3ZRGA 1XMQH 2LREA 2IA1A 1ZGAA 1Z7LA 2VS7A 3JRHA 3NARA 3A01B 3OYGA 1XGOA 1UM2A 4DBRA 3ORQA 3UNGC 1D1BA 2YX4A 1N78A 1FIAA 4XZ3B 2KZVA 1UHSA 3N42B 2CU7A 4PDKA 2Y31A 4YP3A 4BXFA 5J1YA 2M4KA 3MR3A 1K1SA 4DR6H 5BQTA 3TBIA 4DYRA 4U0YA 2WWYA 4MTEA 2I8CA 1FVIA 1B1BA 2EZIA 5CVUA 1R36A 5KFTA 3V42A 4J9KA 3M8EA 3GQCA 2B63G 3GIQA 3ONQA 4CZZA 3KETA 1R5GA 2K4JA 4HF0A 3HXLA 5ED4A 1IV6A 1TT5B 2HU9A 2CKZB 4LH7A 2HKXA 5LGNA 2LR8A 2ZFWA 1S8NA 3V6KA 1OR7C 4JK1X 5IYBG 2ME6A 2VB6A 1SYXB 5BNGA 1SD6A 3HOYJ 1MW7A 1LEBA 3RB6A 1LKXA 2DA1A 3V8KA 4UUSB 4NB5A 2FBIA 3MCZA 3DBRB 4A0YA 4YAJB 3IAM2 4BBSG 3KP4A 4A3KG 2QA4I 4UXNA 2DAOA 4GO1A 4RB2C 4NUBA 3P9IA 3R4KA 3CESA 3Q0WA 2DQLA 4XKCA 3FBNB 3QODA 2I3QA 3FXRA 5E1WA 4Y7NJ 4HX7A 3DF7A 3OL4A 3SHFA 2W24A 5DG9A 5LEJA 4I7HA 4Q45A 2XPVA 1B59A 4ABZA 3S32A 1AKHB 3M07A 1OFCX 3BTLA 3FXMA 3O2PE 2VQCA 1P4AA 3QQYA 1KA8A 2VASA 3BQ0A 2Y0SA 1PX2A 1JUMA 3PJRA 1X1BA 4EBEA 3DEEA 3CC2I 2YCHA 4HSTA 3VPRA 4A5MA 5GAGJ 2ACJA 1K4TA 1HNXH 1EKEA 1OCTC 2QWWA 1ZD7A 2L9RA 4WCGA 4O1RA 3FXJA 1ETKA 5DQGA 2W9BA 4RDUA 1ZETA 4YFKF 3FK6A 1IRGA 5KFRA 2LBFA 3HZJA 4II3A 1K78B 5CB4F 1SFOJ 1ZG5A 4RU9A 2K40A 2WB1N 5LMUH 3M9MB 1X2NA 3S2HJ 5KFKA 2YS7A 4WXDA 5EG0B 1K83A 2R82A 1YJWI 2M8EA 1KJ8A 1AU7A 4GGGA 3N40P 5ERIA 1MNMC 1YITI 5C4XJ 2FKLA 3RCOA 5EGOA 2X85A 2DODA 2KDZA 2E19A 1AF5A 3OUZA 2LRDA 4JV2A 4E2UA 1ZKGA 1E4EB 2R87A 4F52A 2HPMA 4A2BA 1VQLI 5KFQA 1UJ8A 1W36D 2LVSA 5JQWA 1OWTA 1B6AA 3BDDA 4YJ3F 2W4SA 1BR1A 4A3LJ 4M3GA 3BG7A 2KPMA 4FX4A 2AQFA 1MNEA 2FK3A 4FS2A 4XONA 1UG2A 5A0MA 1GT0C 3GZNB 4XNFA 3QZ8A 2JVGA 2QCOA 2YW2A 3HSRA 1JKOC 5LGTA 3H9QA 5AIQA 2PMZA 5D5VB 1YFHA 2XC9A 4A3JG 3ELKA 4RBOA 2L5QA 3FXQA 3HHGA 4XIDA 2OWOA 5F27A 5DS9A 1BI3A 1CE8A 2GAUA 2D1HA 4J9MA 5C8YF 4XBFA 2O9LA 3PSIA 1VFCA 2GOXB 2LTPA 2MSYA 3HM5A 2EV6A 3W6KB 3FMRA 3MX9A 2Q2EB 3QZ7A 3K4LA 4IAJA 1P8KZ 5HDNA 3ABTA 1BOBA 2QQ9A 2FPPB 2R7KA 1MJAA 2I87A 2NOGA 1ODDA 3DBHB 3P9CA 3AG4H 2L0KA 1ZN2A 2DA6A 3GUDA 3S8PA 3CUQC 4UUTA 5KFUA 2KIFA 4A3MG 4LG0A 2ELJA 4ECWA 1A31A 2AS5F 3S3NA 3UQ8A 2V1DA 2BBYA 1A36A 1TWGA 4BY7J 1GO3E 2QYZA 1HNWH 3NWTA 5FPRA 5DUIA 3HRUA 1R6RA 4LK0F 4YAKB 3HOSA 4MV9A 5EF6A 4Q0YA 3MFIA 2KHMA 3ZQGA 1MNDA 1JTYA 3A1YA 4A0XA 2R7DA 1B33N 4F50A 1EV7A 4C2MJ 4C5BA 4CC6A 2NOJB 4RAFA 3C1DA 1VQ6I 1KJJA 4XM3A 4ED8A 4PWQA 3TL4X 2XRLA 4ZDOA 4KA4A 3JCUC 1O3RA 3SDBA 1VQ7I 1BW6A 1YRNA 3OTOH 4LIUA 4M3BA 4UVAA 4C2UA 2P0WA 4EFJA 5LMNH 3QRFF 3L2RA 3LSGA 4Y3OA 4CCOA 4CYCA 2FE3A 1R49A 3PW5A 2NUAB 1S0NA 1S03G 5KFFA 1OCCH 5IT9K 5LHGA 2JK3A 4AIDA 2XASA 2FNPA 1WKMA 3HJEA 4BE0A 3B02A 5TJJA 2V58A 3TKYA 2YRWA 1QGPA 1IUYA 4YY3H 3IFJA 3H3ZA 2XAJA 2PG4A 1RJPA 2XAQA 1IN7A 2HVRA 4ZJZA 5EWGA 2FOWA 4B3RH 3CP2A 2YZNA 4Z1ZA 1T95A 3S1MJ 3F72A 2DJIA 4BXXJ 3M9OB 1B72A 4DV0H 3G6VA 2QSHX 2V4QA 4I76A 2E1MB 4LIVA 3PNVA 2UVUA 3JRFA 1MD0A 2F5EA 2DLLA 2V26A 4HNUA 4F92B 1QA6A 5J2UF 4WF2A 1IO2A 1GUUA 1HW5A 2MGQA 3G1MA 2GIVA 2K86A 1WGXA 3OSGA 3NQOA 4YEJA 4BACA 1IOWA 2V9VA 2GIZA 1S29A 3CLOA 4A2AA 1UAAA 2NU9B 4EYIB 1VI0A 2DTZA 1G9ZA 2M7AA 3CCEI 4OOIA 5BR8H 4OZ6A 1JXSA 5IY5H 1ETWA 4R8HA 2EA4A 3HGGA 5IYDG 3KEOA 4RNNA 1K6YA 1Y6IA 3MR2A 4YHXA 2YZGA 2NS7A 1WRJA 2VQLA 1K1QA 1FBSA 1ULZA 1MBGA 3CCLI 2IW5A 2XB5A 4IKFA 2WY8Q 4U7CA 2R7NA 3RYRA 2QQ8A 2MD5A 2COMA 3VSLA 1RYRA 1I3QA 2UXDH 4ED6A 4KICA 2R8GA 1FY7A 1O7FA 4Z1XA 4UB8C 4JI7H 2W9BB 3MKLA 4IEJA 5CA0F 4I99C 1WJBA 3R0AA 3IH3A 2LBFB 2VUMG 4MV4A 2JA7A 3GXOA 2J5PA 2LH9A 2P5LC 2UUAH 3PW2A 4NC8A 1S72I 2LD5A 2L7KA 5IT3A 5KFEA 2F5FA 3REOA 3PO2G 2ECBA 2JA5A 4IJAA 3FXKA 4E7LA 4OU0A 4WK8F 2P4WA 1QQIA 1YJ9I 5EGOB 2VN2A 5F0CA 1IAWA 4V2GA 4G94A 4X65H 2CO5A 3HOUG 2B63A 2ZCWA 4FE7A 2AU0A 3JAMK 1W5CC 3R5FA 4HLXA 2KMUA 3H5NA 1K4SA 4CC5A 1WJEA 2HOAA 5LHIA 2IXSA 3JSPA 5JVGF 1KQ8A 4Z20A 4UN7A 1YX3A 1Y1VA 3VDXA 4UV9A 5A0MB 2WDTA 1P8LA 5J4YA 2A3SA 3J7AO 2HDWA 1IBMH 3EYIA 1V4RA 1Z6RA 4EMSA 2VL8A 4LOCA 1X19A 2OZUA 2XRNA 3BJOA 5DD4A 1EF4A 1ON1A 4RGSA 1N75A 3J81K 1O4XA 4O4LF 5FROA 1DV1A 1BIAA 2GM4A 4E4HA 4NBQA 2J6SA 2ASDA 3MVPA 3HKZE 4DOZA 5FFZA 5KFHA 2VBOA 2W6PA 2VQHA 4OINF 2GA2A 4RGXA 5E1ZB 4FCYA 4DR1H 4GC6A 1WPKA 1R9TA 1TT0A 2PLYA 1IN8A 2H1LA 1GVDA 1XCVA 2HI3A 3KLNA 4XLCA 1GSHA 4F4YA 1XTAA 3K4NA 5BPIA 1OCRH 4L0YB 1T08B 1GPPA 3MXAA 2WC2A 1Z6TA 2X1DA 1A0IA 2EFWA 1RC9A 3KP3A 1ULYA 1FMWA 4DYQA 3LSRA 1W0UA 3RF2A 4LG0B 3EH8A 3GIJA 1SMYF 2VJ4A 3RQIA 1N48A 1W5TA 1L0OC 3H9JA 4A6DA 3LQRA 3ESWB 1LNWA 4RAYA 3JR9A 1TBXA 5F1RA 4O5VA 2CS3A 4YBZB 3WU2C 3K4JA 4E7HA 4DBQA 2HXIA 1QHGA 5M5YJ 2R4GA 3IUOA 3I4NJ 2ISYA 2YU3A 4CCJA 2H6CA 4ETSA 1JUSA 2XAGA 4F55A 4U7DA 2CQXA 3EPZA 3KP5A 3WE2A 1G59A 3EETA 4QIWE 1QO0D 4NDLA 5E5SA 2CW0F 3TMOA 3H4DA 2DN0A 2OZ6A 3LWBA 1ZYRF 4ZTJA 4B3SH 3I59A 3OYAA 2KIQA 4IHXA 4LLLA 3MZHA 1YRNB 2RVCA 4XYLB 2AO9A 3TP3A 1Z3XA 4A12A 5D1OA 4CYCB 1Q1VA 4HOBA 3L1PA 1P7JA 5C3EJ 1MMDA 4I4TF 4BEHA 2OV7A 2QQAA 1HBXG 3HOVJ 1MMSA 1WH5A 3A02A 4A3EJ 3LSTA 2OTLI 1UMQA 2VS8A 1YG2A 2F6CA 2K02A 4PDBA 5H20A 2VA2A 3F6OA 2FX0A 1PVEA 3IKVA 3W6VA 3QYBA 2Y48A 1Z2PX 4AQUA 5J3LA 3KZYA 4KYWA 3P5JA 3W6JB 3PFIA 5FLVA 1R4MB 3M3YJ 3N8DA 1GLNA 2BEOA 2VR1A 1B72B 1LPQA 2BQ3A 1YE9A 3GIKA 2LCJA 3KLOA 4HRIA 4Q44A 4Q8FA 3RJPA 1VNDA 1FTTA 2V6EA 2ADUA 1MGTA 5GAHJ 1J59A 4RLFA 5CA1F 4YIIA 5E17F 1GLVA 1I6UA 5AONA 3LSJA 1XMOH 3JW4A 3MR5A 1R1TA 3SE7A 3G4SI 2R7OA 2MC3A 4M71A 3MAJA 5E20A 1KZHA 4YB8B 5J8FA 2VOPA 2LQMA 2JEGA 4OX9H 4G6DA 2QLZA 4MHGA 1JT0A 1HLVA 2V79A 1UHMA 1WJCA 2XAFA 5CVVA 3WTZA 3FMSA 2XHKA 1FZPB 2EV0A 1LFBA 4HA8A 3OSFA 3VEPA 2PN6A 4RGRA 2PFBA 4IRCA 2IA6A 4BGDA 5E3NA 2RV8A 3EDPA 4A3GG 4I09A 5TGTA 3S14J 4DIQA 3MISA 3RB0A 4ZOLF 2DLNA 3E6DA 2DPJA 4OMZA 2JA8J 1C30A 5DEQA 3FKJA 1USSA 4AYBN 1DIKA 1JTXA 1T6SA 5K7ZA 1TC3C 5KFXA 2E1MC 3N41B 2HDCA 3EUHC 4BY1J 2DOAA 4XLAA 1Q1HA 2KL4A 1E3OC 4XLNF 5BPFA 1UHWA 3FISA 1O57A 4U0VA 1EH8A 4PFOA 2LY1A 4P55A 3K9TA 2EBIA 1R1UA 1HSTA 1I5ZA 1ZGJA 3OYBA 2VBLA 2GLTA 2LF7A 4UFZA 3IWFA 2VXDA 1VQPI 2ISZA 1Z7UA 1FTZA 5LXTF 3HUGA 2X48A 4KJZA 4B3XA 5HLTA 5AKFA 1PK8A 3FF5A 3V7RA 4BJ6C 2KRFA 4J19A 2P7VB 1VQKI 1GXPA 4ECXA 1FOYA 5KFBA 3ZMSA 5K7HA 1AA7A 5DTDA 1D1CA 2TCTA 1T36A 1PYVA 4O3MA 3QOEA 1R71A 4ZQIA 2Y0SE 2HQNA 1AUVA 2LNBA 4U87A 1CQIB 1SCUB 4FS1A 5E8GA 4PK4A 3C2BA 4KMFA 2AXTC 2ZXJA 4AC0A 3R0JA 4XR6A 3TQNA 3SYTA 4AIJA 4GC7A 3P7NA 2OF7A 3M7GA 1A6IA 4CICA 3I4MJ 3I4PA 1PJRA 2DPIA 1SVOA 5ICCA 3K1MA 4OIOF 3CMEI 3F8MA 2MBFA 2E2IA 2OUMA 3FWEA 1IDZA 2VBOB 3BQ2A 2OTJI 1WQ2A 3E54A 4FT8A 2ESNA 3FMQA 1C0WA 3GVAA 3TW6A 5KG5A 1DUXC 3GZ5A 4HQEA 2LY9A 2E35A 1XB4A 1JVAA 3R23A 3RFCA 4DL4A 4QJFA 3M4IA 3W3CA 5KX5F 3MR6A 1P4XA 4B48A 1FKAH 3EPIA 1S6LA 3H35A 4BHPA 3Q8PB 2BY2A 3I55I 3F22A 1AT0A 3BJ6A 1JLLB 5KFWA 3OYEA 2QVOA 1DQUA 4KIBA 4HZFA 4YISA 2I5UA 2XV4S 2ATLA 2O7OA 2VUMA 4MGRA 1G3SA 2DDAA 3HYIA 5DV5A 1BIBA 1ZAOA 3L2UA 1R9TJ 2PMZE 3QWLA 5KFDA 1MSFC 3RYPA 4EJWA 1VS0A 2FLLA 3WNZA 5KAFC 3BA9A 3H0GG 3FXUA 3F21A 2DPDA 3LOCA 4EEQA 1RETA 3MJFA 1JDBB 4GKKH 3NZMA 1MDMA 4PGGA 5D5XB 2JRTA 5FPOA 4CCNA 1ZG3A 2E34A 1TWFJ 3ISPA 2VBZA 2W9CA 4WXCA 1LVAA 3I59B 3BR2A 4KL6A 5IP6A 1OJLA 1QU3A 5IP7J 3PL8A 3OR1C 4M6VA 5D1OB 4YIRX 3GFMA 4D7NA 3PUFA 1VQ5I 2PI0A 4UNOA 3KHGA 4BEHB 2Z99A 4R8UB 5CVJA 2R8JA 3NRVA 4X66H 1V5EA 3DPTA 4RZQA 4AQYH 4DYCA 1A6QA 4KNYA 2Z16A 3GCMA 4TUYF 5EWEA 5E67A 3TW7A 1HDDC 2UXXA 4G7OF 3KXYT 5C44J 4AM3A 4M3DA 5L1KA 4CUGA 1Z21A 2FK2A 2RNJA 3T5JA 2UXNA 3CO6C 1X1PA 1I94H 1XDNA 3MZYA 3RPUD 3GIIA 2W7PA 1N56A 1VQ4I 4ZYGA 4UT0A 2DZDA 2C22A 2HNHA 2R5YA 4A93G 1GDTA 4IOCF 1T9IA 4FBTA 3IH4A 4BJTA 3RGXA 5A72A 2KISA 2RGRA 3BTIA 3RJ0A 1BBYA 2O5RA 4XN0A 4JX4A 1VQ8I 3RTRA 2JA6A 1S9HA 4ECSA 3OIQA 3IRRA 4LK1F 4M3FA 3PN1A 3NAUA 1S7OA 2M0MA 1HW2A 3MZ8A 2R92J 3W2AA 5KG7A 3V8JA 1O7LA 2ME0A 3JTHA 2PJRA 3OUUA 2JMWA 2ZXIA 3HYJA 3VPCA 1R58A 1QVUA 2UV1A 2L4AA 1J9IA 2J6TA 5KFOA 1Y0NA 2E36A 3VFZA 1S7EA 1KQ9A 3BZ6A 2DT7B 1R1VA 4AIKA 3ZN1A 3MIPA 2IN0A 2D1VA 1PP7U 4UCVA 4AUXA 1WSUA 3K4BA 3GX4X 2ZO4A 1UC9A 2DYSH 1V9PA 2PBIA 3I71A 3NWSA 4KZSA 2OPTA 4BL0B 4CCMA 3OYMA 3KP7A 2YS6A 2PBZA 3RSNA 2VT3A 3BCAA 3BAAA 1MKMA 3OOUA 2M7BA 2R7QA 3F8CA 4BHCA 3CCUI 1DGWY 1Y8QB 3EUAA 5ILUA 3L2WA 3Q8RB 2W8LA 4AVZA 2OU2A 4MAMA 3HBLA 2XGDA 4OIRF 1QZYA 5ILVA 2ZNZA 4UUVA 2O8KA 1CS0A 3K5IA 3VB2A 5J47A 3ULQB 2M5WA 4DV2H 3N43B 1HNZH 2CUJA 2VBLB 3JRGA 5D5WB 2DA7A 2DMPA 2WV1A 3KYLA 5EZYF 4B3TH 4IL6C 5E18F 4C9YA 3GFJA 3HUGB 2IP4A 5JI6A 3BQYA 1BP7A 2LY2A 3RTXA 2YRXA 1LEAA 3LSKA 1FSHA 2ID6A 3M1CA 3DKWA 5FD6A 1IF1A 5IP9G 3J80K 1EH7A 4XRMA 1BOAA 4ZYHA 5LFAA 3OIOA 4ZYAA 2CW8A 1U9OA 3QPHA 3K4KA 3D1NI 2IGKA 3CCJI 3IRQA 1OLTA 2LP0A 3S2DJ 2P0AA 2DK8A 4B43A 4AYBA 2V1XA 4AWXB 1D5YA 4A69C 2M8GX 5E3MA 1T94A 3GTPJ 3U9GA 4KDPA 2COBA 5DUKA 1PUFA 1QZZA 2C6YA 2ZMEA 3SEQA 3T0YA 1L2ZA 3PO3J 1WJFA 3JRDA 2E7XA 4RGUA 4J9LA 4E7ZA 3HOWG 2W9AA 1YW8A 5KCMA 2K9QA 1KGSA 4JI1H 5L1JA
chains in the Genus database with same CATH topology
3OTOH 4LIUA 4C2UA 4EFJA 1E4FT 2P0WA 4ZDLA 5LMNH 5A2QW 3L2RA 3D5SC 3LSGA 4Y3OA 4CCOA 3DTIA 3A2KA 2FE3A 4NC7A 2RGVA 1HA8A 1S68A 2RNGA 1S03G 1T9JA 4XOTA 4UCUA 1YX5A 1XNRH 3K4MA 2VBNB 2WY7Q 2Q2UA 2JA2A 5HNFA 2QOJZ 3OMYA 4BE0A 3OYLA 4AADA 3K6GA 1MOWA 1IRXA 1WFXA 2L2OA 2KLOA 3CZ6A 2VLAA 1N36H 4BQNA 4YY3H 3IFJA 4JOMA 2DCHX 2HVRA 4ZJZA 4B3RH 2W57A 3CP2A 2UXBH 3PNYA 2XC7A 4Z1ZA 1T95A 2DJIA 5CPRB 5AKNA 4DUZH 1HR0H 2R7TA 4DV0H 3UR3C 2AB5A 2RREA 3ZQQA 3OYIA 2E1MB 5E63A 1Z3YA 4LIVA 3PNVA 4E7KA 2OC6A 2V26A 4HPQA 4HNUA 4F92B 4LSAA 4J01A 3FHNA 4EATA 4LFCH 2GOMA 4NXMH 2Z2SB 2XF5A 3PFYA 1FMVA 1UG0A 2Z1DA 3CMMA 2E5NA 2X6WA 4LF5H 4BQQA 4JYAH 2KP6A 4YEJA 4BACA 4ITVA 4RM3A 4XN3A 4D9JA 4A2AA 1UAAA 4JI6H 2FUG2 1G9ZA 1O75A 3EYYA 2BVMA 2M7AA 3S3OA 5BR8H 4OZ6A 3OWTA 2M4GA 3SZGA 5KHDA 2MC4A 4YITA 3HKZA 4HG2A 3FD2A 1K6YA 1Y6IA 1MMNA 5AKMA 4YHXA 3K4CA 1EF0A 1R7MA 2LWYA 2VQLA 3C0XA 4MV7A 2UXCH 1WJAA 3PUBA 4IKFA 2VJJA 2WY8Q 2F5VA 4UNBA 3J7AK 4PJLA 3S93A 3KALA 4LH6A 2X1CA 3VSLA 3H20A 2EX5A 5IT9W 4KITB 2UXDH 5HNHA 4BE2A 2WYOA 2KQRA 3U21A 2R7SA 4UN9G 4DR5H 4DR7H 1SAUA 4Z1XA 1G9YA 2CMPA 4DV7H 4JI7H 4K0KH 3LSIA 2IS1A 2HQAA 4KL5A 2K3PA 1EA3A 1WJBA 4OAZA 3ZR8X 4IX7A 2LBFB 4DGWB 2WAEA 5E5OA 1SEIA 4LF7H 3MKWB 1BGWA 2LH9A 2UUAH 4NC8A 3ZCOA 3OORA 3RIZA 3QYEA 4BQOA 1MMGA 2L7KA 4DUYH 1W36C 2ZSHB 4BDZA 4ZTFA 2VBJB 4E7LA 4UCSA 5CQGA 4F91B 1MI8A 2VKDA 1B04A 5CQEA 2IS6A 4RM2A 3BLYA 4X65H 3MXBA 4UCOA 4CC5A 4DJAA 2IS4A 2KMUA 3H5NA 1WJEA 3OYCA 2IXSA 4KISA 4UN7A 4Z20A 2PJRB 3DTEA 1YX3A 4RMNA 2DXIA 1N34H 3VDXA 2V4JC 4XMYA 2UWMA 5A0MB 2WDTA 3OOLA 1P8LA 3RGZA 3C2HA 1IBMH 2HDWA 4OWRB 4XLHA 4KHPH 1N33H 2VL8A 1X19A 2MABA 4II2A 2XAUA 1N75A 3OYFA 3CF2A 2XE0B 1AN7A 3H0DA 3FDYA 5FROA 3R7PA 2IN9A 2CUZA 3SEZA 3DWLE 4E4HA 2ZJTA 3W2VA 3VSKA 2WADA 3RQ4A 4E6KG 4UCTA 4DOZA 2HGSA 1Y56A 2VBOA 4B3MH 2IGMA 1DGRM 2VQHA 1DFAA 4X62H 1X1CA 4DR1H 4JI2H 3H5RA 2VPSA 4BJ5C 1TT0A 2UU9H 1U0JA 3PNTA 4XLCA 4E7JA 3K4NA 1GYFA 3IAS2 3I9V2 4DV1H 1IBKH 1GPPA 3F9KA 3MXAA 2W82A 1X9NA 2X1DA 3MMYB 4BU2A 4RAZA 3K70D 1A0IA 4LF4H 4J00A 2VKHA 1FMWA 2MYSA 1M0WA 3RF2A 3LMLA 4GKJH 2Q1ZB 4ANJA 3EH8A 2IGNA 2VJ4A 3KX2A 2I3PA 3H9JA 1D0XA 1MMAA 4XL9A 3DKYA 4NQWB 1VDEA 4RAYA 3E0JB 1D1AA 4JQFA 2A5WA 4OAYA 4D1QA 5I0AA 2VPLA 4U7BA 2CS3A 2MD0A 5A78A 4RB3C 2V7FA 3K4JA 4E7HA 4DBQA 1QHGA 2R4GA 3IUOA 3VYRB 2BVLA 1IBLH 4AAGA 4XORA 4CCJA 1ZDEA 1E4GT 4ETSA 4F55A 1KONA 1WJ5A 2A6TA 3E1SA 4E7IA 2K9MA 1WH2A 3EPZA 3GBGA 4RB1A 1G59A 2CW7A 5A74A 4JV5H 3C2GA 2ZXHA 4C30A 5E5SA 4JI0H 4DV6H 3BG6A 3OYHA 3TMOA 1M0TA 3DTKA 4ZTJA 4B3SH 3OL3A 3HPHA 3OYAA 4HNTA 2XIGA 3AKZA 3J81W 4DV3H 1Z3XA 1DP3A 1AM2A 4UN7G 5D1OA 2IGOA 2WBMA 3OR2C 4IZZA 4QPQA 2KSWA 4D6NA 5HOOA 1MMDA 4HSRA 4BEHA 2K9LA 4FM9A 2OV7A 4RLQA 3J80W 4UCRA 4XKWA 2VS8A 3L4JA 1B24A 4QPOA 1D0YA 4CZCA 2F6CA 4PDBA 3ZGKA 3BC8A 2IN8A 1ZHQA 3MKYB 2KEQA 3DQVC 5LL6b 3QYBA 1Z2PX 4AQUA 2MCTA 2KRHA 4P5OA 3W2WA 4UNCA 3D5LA 3VYTB 4XLEA 4LQ0A 5FLXW 4H4KC 1GLNA 1SFKA 3L2VA 3VWBA 1ERDA 3KAKA 3FMAA 2KDOA 2KRCA 5EOYA 3N44B 2VQFH 4C2TA 1XNQH 1YE9A 4ZC3A 2LCJA 4HRIA 4PJJA 2DT6A 4YELA 4YRVA 4LF6H 2V6EA 3IG0A 2ZSIB 4RLFA 3BA8A 3KAJA 2JNQA 4UN8A 1I6UA 1Z2OX 1XMOH 4E2TA 1LDKB 1M5XA 1N32H 4M7EA 3DPUA 3DU5A 4P1WA 3K10A 2R7OA 2IS2A 2HHHH 2MFZA 3OS0A 2JVHA 3DKXA 5FRMA 2VQGA 3LMMA 4E7SA 2LQMA 1N3FA 2R7XA 1N77A 2IMZA 4EFBA 2RQQA 4OX9H 4HEA2 3AFHA 1WJCA 5A77A 2L8LA 2ZFUA 1BJTA 2VXZA 2E5LH 4JI5H 4N4NB 4YHHH 2W1OA 4BGDA 4N4OB 5TGTA 4DIQA 3MISA 1LWSA 2R7RA 3KO2A 3K3VA 4MLOA 3OYNA 2LG4A 3FKJA 4LG3A 2WA0A 1NG7A 3HG9A 3OYKA 2E1MC 3N41B 4EFEA 3MWMA 1UELB 3EUHC 2DOAA 2UUCH 4XLAA 2KL4A 1J5EH 4LSXA 1LWTA 5FD5A 3T1YH 1TAEA 4Y33A 4PFOA 2LY1A 2WAFA 3OIPA 1DGSA 3CP8A 3I3LA 3OYBA 2VBLA 4UFZA 4LOXA 4JI3H 4AAEA 2VXDA 4XQFA 3J7AY 3L4KA 4KJZA 4B3XA 1LVKA 2VIXA 1X4PA 5HLTA 2R7WA 4IQ4A 5AKFA 2LC2A 1X1AA 4BJ6C 2LOOA 4LFAH 2QKMB 4RB0A 1FJGH 3ZXSA 2HVQA 3LSMA 3VYUB 2XF6A 3VYSB 4IQJA 3MXBB 2VQEH 1AA7A 1D1CA 4JI8H 3DU6A 4CCLA 1PYVA 2L9SA 2JUGA 1X1DA 2F4VH 4Y4RA 2BW3A 3QOEA 3LL7A 4R7RA 1D0ZA 4U87A 1TZLA 4PK4A 2W00A 1MZBA 4BDYA 4JI1H 4UN8G 4XR6A 3SYTA 2UUZA 4LFBH 4AAFA 3BCBA 4XKVA 2X6XA 1TA8A 1QHHD 4PFPA 3ZRGA 1XMQH 2LREA 3IP4B 2VS7A 1PJRA 1Z7LA 2HPIA 3OYGA 2CV1A 1UM2A 4DBRA 1BR4A 2CH0A 3UNGC 1LFPA 1D1BA 2OUMA 2WAQA 4G6TB 4CA0A 1N78A 2VBOB 1DQ3A 2KZVA 2VBNA 3N42B 4PJMA 3E54A 3K70C 4J0MA 2BW3B 4BXFA 3JAMW 2M4KA 4DR6H 3TBIA 1JVAA 5A0WA 2R7UA 4B47A 4MTDA 4PJNA 4XLFA 4MTEA 3M4IA 3W3CA 1FVIA 1FKAH 1G8XA 3DLAA 4B48A 2XF7A 3CJQB 4FASD 3PSFA 3H35A 2V1NA 3V42A 4UN9A 3OYJA 2Q2TA 1AT0A 4LITA 3ONQA 3OYEA 4BWSC 3HXLA 1DQUA 1V5FA 2HU9A 3LSHA 1ZHSA 4YISA 4LH7A 3HYIA 1OR7C 1X4OA 3L2UA 1SYXB 2VB6A 4B44A 3DPLC 1MW7A 3HOTA 1LKXA 1VS0A 5JHFA 4UNAA 4GRIA 4AQXA 3BA9A 3IAM2 3HL2A 4EEQA 4CSWA 3CVZA 4GKKH 3NZMA 4BS9A 4NUBA 4RB2C 3KEYA 3F8NA 5FPOA 4CCNA 3CESA 4XKCA 2E60A 3FBNB 1ZELA 3QODA 1T9IA 5K08A 2I3QA 1T0FC 4LF8H 2VUGA 4GLXA 3H5AA 3DF7A 3AL0B 3OL4A 2ZM6H 4KL6A 1QU3A 1V5GA 4DR3H 2XSJC 4I7HA 3PL8A 3OR1C 4KT6A 5D1PA 2CV2A 3S32A 1BR2A 4FETA 4R79A 5D1OB 4GIGA 2VQCA 4BUPA 4NXNH 3QQYA 2VASA 2K5CA 4BEHB 1P9QC 2Y0SA 3S3MA 3N6XA 4CH7A 3PJRA 4X66H 1V5EA 1X1BA 3DPTA 3DEEA 1Z2NX 2YCHA 4RZQA 4AU7A 2JSPA 4HSTA 3OS1A 4AQYH 3M8JA 1HNXH 2Z16A 1N3EA 1ZD7A 4O1RA 5E67A 3KXYT 4LMYA 1NG6A 4CUGA 1Z21A 2LBFA 3MD2A 4II3A 4NNJA 3MKZA 1I94H 3HC7A 2JMZA 4O1SA 2LYCA 4F3QA 1XDNA 5LMUH 2F4IA 3RPUD 2X1EA 3A4CA 1J09A 2UUBH 4UT0A 2W7NA 4AABA 2HNHA 2CV0A 2VBJA 4X0GA 3N40P 4BJTA 3RGXA 3RCOA 5A72A 3H9GA 4DR4H 2X85A 2VJIA 1AF5A 4PUSA 2RGRA 3RJ0A 2O5RA 2VJ5A 4XN0A 3RTRA 1S9HA 2LRDA 3OY9A 4E2UA 2FLDA 3OIQA 4F52A 2HPMA 3PN1A 4A2BA 1W36D 4F93B 2M0MA 3EUKL 2W4SA 1BR1A 2X6YA 3W2AA 3BG7A 2KPMA 2PJRA 2AQFA 1MNEA 4XONA 2ZXIA 5KNLA 5A0MA 3HYJA 2XDVA 2UV1A 4XNFA 2X51A 5CKTA 2JVGA 3L2QA 3H9QA 2PMZA 2DT7B 3C0WA 2XE0A 2M3AA 2IN0A 3MIPA 2L5QA 2QKLB 4UCVA 3K4BA 2O7MA 2E5ZA 1V9PA 2OWOA 3NWSA 2HZDA 4BL0B 4CCMA 3OS2A 3OYMA 3AL0C 4PSWA 3RSNA 3BCAA 5HVQC 1E0EA 3PSIA 3OOUA 2GOXB 3N05A 2M7BA 4XOPA 2R7QA 2HVSA 3LFUA 3BAAA 1DGWY 3EUAA 3L2WA 2Q2EB 2DCEA 5AK9A 4AVZA 3K4LA 3HPGA 4D6OA 3MX9A 1P8KZ 4IAJA 3OYDA 1BOBA 2CFOA 2O03A 5LD2C 4DV2H 3N43B 4DV4H 1HNZH 2CUJA 3FBIB 3G2BA 2VBLB 1JI8A 4B3TH 1U0CA 2WB1A 3KYLA 5IWAH 3S8PA 4C9YA 2V9KA 3HUGB 1BP7A 3IGDA 2LY2A 3RTXA 5FRNA 2I8DA 3LSKA 2ELJA 4PSXA 3JSLA 3JSNA 3S3NA 3UQ8A 4DR2H 2VOBA 3QYFA 3M1CA 5FD6A 1HNWH 2BOLA 3NWTA 5FPRA 2R7VA 3C0FB 1R6RA 3HOSA 4MV9A 5LFAA 4JI4H 4ZYAA 4DV5H 2CW8A 4Q0YA 2KHMA 3K4KA 1MNDA 2IGKA 3T1HH 1OLTA 3A1YA 1WJDA 4B43A 4AYBA 2L9NA 3CJRB 4XKBA 3UVFA 3BABA 1U0DA 4BE1A 2WE6A 4CC6A 2NOJB 4APMA 3SEQA 1L2ZA 4XM3A 4ZDPA 1WJFA 3D5RC 1VZ0A 3TL4X 4E7ZA 4ZDOA 3L2PA 5KCMA 4X64H 2AQEA 3SDBA 4CCKA 4LF9H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R7P A;  2IN9 A;  4EFJ A;  4GIG A;  3MIS A;  1LWS A;  3QQY A;  3KO2 A;  2VBO A;  1T9J A;  2VBN B;  1DFA A;  2QOJ Z;  4AAD A;  1MOW A;  1N3E A;  1ZD7 A;  4O1R A;  5E67 A;  1LWT A;  3IFJ A;  2DCH X;  2JMZ A;  1GPP A;  4O1S A;  3MXA A;  2VBL A;  4LOX A;  4Z1Z A;  4AAE A;  5AKN A;  4UT0 A;  2AB5 A;  4AAB A;  5AKF A;  3EH8 A;  5E63 A;  2VBJ A;  2I3P A;  5A72 A;  1VDE A;  1AF5 A;  5I0A A;  5A78 A;  3MXB B;  4E2U A;  2FLD A;  4AAG A;  1ZDE A;  1G9Z A;  5A0M A;  3HYJ A;  2CW7 A;  5A74 A;  4OZ6 A;  5E5S A;  4UN8 G;  4YIT A;  3FD2 A;  4AAF A;  3C0W A;  2XE0 A;  5AKM A;  3MIP A;  2IN0 A;  4YHX A;  1EF0 A;  2VS7 A;  2LWY A;  1R7M A;  1AM2 A;  4UN7 G;  3C0X A;  2O7M A;  1UM2 A;  4UNB A;  4D6N A;  2VBO B;  1DQ3 A;  2EX5 A;  2VBN A;  2VS8 A;  3E54 A;  1B24 A;  4UN9 G;  3MX9 A;  5AK9 A;  1G9Y A;  4Z1X A;  4D6O A;  1P8K Z;  2IN8 A;  4KL5 A;  2KEQ A;  1JVA A;  5A0W A;  4AQU A;  5E5O A;  4UNC A;  2VBL B;  4LQ0 A;  1U0C A;  4UN9 A;  3OOR A;  1AT0 A;  1BP7 A;  3IGD A;  2LCJ A;  2VBJ B;  4YIS A;  1MI8 A;  3HYI A;  2JNQ A;  4UN8 A;  4E2T A;  1M5X A;  3MXB A;  2CW8 A;  4UNA A;  4AQX A;  3UVF A;  4UN7 A;  2LQM A;  4Z20 A;  1N3F A;  2IMZ A;  1U0D A;  3NZM A;  5A0M B;  3OOL A;  5A77 A;  2L8L A;  1T9I A;  2I3Q A;  5K08 A;  4KL6 A;  2XE0 B; 
#chains in the Genus database with same CATH topology
 2L4M A;  2HS5 A;  5A2Q W;  2R93 A;  1XMA A;  2DW4 A;  4Y13 A;  3EUH A;  2LSO A;  4NC7 A;  2RGV A;  1J75 A;  5J8C A;  2EH3 A;  2EIN H;  1YX5 A;  3IHU A;  1XNR H;  4IF4 A;  4JV0 A;  2WY7 Q;  1UCR A;  2JA2 A;  5DM7 F;  2JZY A;  4Q43 A;  2QOJ Z;  3PR4 A;  1YW7 A;  4EVI A;  4E4T A;  1WFX A;  3MEX A;  3CZ6 A;  1R00 A;  1OKR A;  2QSF X;  4BQN A;  4DL3 A;  4O2B F;  2DCH X;  1ZRC A;  3O8H A;  3CQZ A;  3H4B A;  2W57 A;  4N0B A;  3PNY A;  2RN7 A;  4A2U A;  3I54 A;  5LLQ A;  3RB3 A;  4G12 A;  3K1N A;  1SEU A;  1HR0 H;  2H6B A;  4M9Z A;  3UR3 C;  5IYC J;  2AB5 A;  3DEW A;  4L5I A;  2DOF A;  1RUO A;  4UVC A;  4E7K A;  4A6E A;  1FYM A;  3GTJ J;  4AVP A;  1OMI A;  2WB1 E;  5D8K B;  3HOX J;  4J01 A;  1BJA A;  4LFC H;  3GV8 B;  4I55 F;  2AXL A;  1RES A;  2FA5 A;  3G8C A;  1TNT A;  5KG1 A;  2XF5 A;  4TQS A;  3BWG A;  1FMV A;  2Z1D A;  1RJQ A;  2AQ4 A;  4JYA H;  4LF5 H;  2A6E F;  4BQQ A;  4JYK A;  2KP6 A;  2NVY J;  2HKO A;  3TOB A;  4JI6 H;  3EYY A;  1MDM B;  1ZQ3 P;  2Y0M A;  3K2Z A;  3GTL A;  3GLX A;  1NK3 P;  1V51 A;  2W9C B;  2M4G A;  5KHD A;  2HEO A;  1Z05 A;  2CG4 A;  1BXR A;  4XSX F;  2E1O A;  4F7Z A;  4A5N A;  1MMN A;  3K4C A;  1EF0 A;  2M05 A;  1E3H A;  5A2Q Z;  5T14 A;  4BBR J;  2UXC H;  1WJA A;  5KT3 A;  3MFH A;  3PUB A;  5F9N A;  4UNB A;  1XC5 A;  4PJL A;  4Q5S F;  3GIL A;  3H20 A;  1FC3 A;  1SFU A;  1REP C;  4KIT B;  2P7C B;  5IT9 W;  3BP8 A;  2L02 A;  4UN9 G;  2WYO A;  2R7Z G;  4NC6 A;  2E2H A;  5LP6 F;  2HQA A;  4S04 A;  4A3C J;  3B73 A;  1EA3 A;  5HOD A;  4A3F G;  3ZMZ A;  5E8I A;  6PAX A;  2YX7 A;  4QFQ A;  5E5O A;  5FB2 A;  4LF7 H;  4R1H A;  1FJL A;  3MKW B;  2X9D A;  3CD6 I;  2FK1 A;  5LOV F;  4HF1 A;  5M5W J;  1IGN A;  3WTY C;  3OOR A;  3RIZ A;  1E2X A;  3QYE A;  1KJQ A;  1QBJ A;  3AG3 H;  1HQC A;  2R5Y B;  2KFD A;  4XSZ F;  2ASL A;  4ZTF A;  2EFN A;  4BAY A;  2DJN A;  4F91 B;  2WAQ N;  4EBD A;  3I64 A;  5CQE A;  2DFI A;  1XX5 A;  3GZ6 A;  3SI8 A;  1P2F A;  4RM2 A;  4IRD A;  2EA2 A;  2QF7 A;  1IOV A;  2LLK A;  5C44 G;  1CQJ B;  1GVJ A;  1RRJ A;  4O3N A;  5FKL A;  4B09 A;  2DK5 A;  4DJA A;  4LX3 A;  3OYC A;  4CO8 A;  2KJB A;  2PJR B;  1Y1W J;  3SZP A;  1KU3 A;  4MEX F;  3BPX A;  2F4O B;  3SXY A;  3GTQ J;  1YI2 I;  3RGZ A;  4HV6 A;  4XX0 B;  1A9X A;  1R4N B;  1LDJ A;  3K1P A;  2EIJ H;  4OWR B;  4XK4 A;  4XLH A;  2NU7 B;  2R8I A;  4ECZ A;  3GTK A;  3Q3S A;  4EG0 A;  1M1E B;  3H0G A;  3OYF A;  3GTO J;  3H0D A;  3FDY A;  3H3U A;  2ICW G;  2DA3 A;  2IN9 A;  3FKI A;  5IPA A;  2CUZ A;  1B6S A;  4PJ0 C;  3MWD A;  3DWL E;  2ZJT A;  5DLG A;  3S15 J;  5GON F;  3WOD F;  3RQ4 A;  3AYH B;  1JGG A;  2NU6 B;  4UCT A;  1JJ8 C;  4OMY A;  2HGS A;  3QP5 A;  4EEY A;  5IT9 Z;  4CGZ A;  4A0Z A;  2BY1 A;  4O3P A;  2IGM A;  1IV8 A;  5KT7 A;  1PUE E;  4X62 H;  1X1C A;  1ZQ7 A;  4MNU A;  4BJ5 C;  4GYG A;  2HJW A;  5KAI C;  4PZJ A;  3HSE A;  3PNT A;  2DQR A;  3H36 A;  3GTG J;  3VOD A;  1A04 A;  1Z91 A;  3TO9 A;  3CO7 C;  5KKN B;  2IN8 A;  4RAZ A;  2CZG A;  4LF4 H;  5M3F J;  3WG9 A;  5BMZ A;  2F4L A;  2VKH A;  5EZG A;  2OCE A;  2YR2 A;  1RPW A;  3LML A;  4GKJ H;  4ANJ A;  1EH6 A;  1LQ1 A;  2I3P A;  2QZ8 A;  1D0X A;  1MMA A;  1SAN A;  3DCF A;  4XL9 A;  1XMK A;  4WXH A;  1ETO A;  4HDU A;  3E0J B;  4JQF A;  1VDE A;  2A5W A;  5JVL A;  2F48 A;  2VKE A;  2NAZ A;  2ESH A;  3FK7 A;  2MD0 A;  3HRT A;  4U7B A;  4D1Q A;  4YJ2 F;  1OQY A;  2FLN A;  4ZZD A;  1WCM J;  1MJ9 A;  3VYR B;  2BVL A;  4B8X A;  3GW2 A;  3ASN H;  2XCP A;  5KG3 A;  1KON A;  2JTV A;  3ROU A;  1PUF B;  1WH2 A;  1D3Y A;  3GBG A;  2ZME B;  4RB1 A;  2CW7 A;  4JV5 H;  3OYH A;  5B1A H;  2FP4 B;  3DTK A;  3T5X A;  4GYI A;  3OL3 A;  4HNT A;  3AKZ A;  3J81 W;  1WZ2 A;  3Q5F A;  2GPS A;  2DA5 A;  4IVN A;  3TIG A;  2IGO A;  1G6N A;  2KT0 A;  4IZZ A;  1K79 A;  4RUA A;  4P9U A;  5JLW A;  2CQK A;  2ID3 A;  5HOO A;  2FMY A;  4RLQ A;  1P7I A;  5KFM A;  3HDD A;  1FX7 A;  4EJV A;  1B24 A;  2M9H A;  5KFY A;  4I02 A;  3ZGK A;  3BC8 A;  3R61 A;  5EJC A;  1T98 A;  2LKS A;  1W1W E;  1FT9 A;  1WI9 A;  2VOD A;  3DQV C;  4ZYE A;  2XGC A;  3IL2 A;  1D5V A;  4G7H F;  1JGS A;  2EPF A;  1I50 A;  2LDU A;  3BG5 A;  3JZI A;  3D5L A;  1I1G A;  4XLE A;  3C3W A;  3I0T A;  3L2V A;  2DMQ A;  2Y9Y A;  3DEU A;  3ERE D;  2R6F A;  3FMA A;  2KDO A;  3KAK A;  3U9T A;  2VQF H;  4LLG F;  4O3R A;  1XNQ H;  4ED0 A;  3HOY G;  1YLF A;  4B4C A;  5M5X J;  4YRV A;  4LF6 H;  2PMU A;  4M9X A;  5F04 A;  3IG0 A;  1FEX A;  3T5L A;  1O3T A;  1F5T A;  3KAJ A;  3U1D A;  2BXZ A;  1RUN A;  4L9T A;  4UN8 A;  1S97 A;  1M5X A;  1N32 H;  2HOE A;  3DPU A;  3DU5 A;  2HGC A;  2JJ7 A;  2HHH H;  2E71 A;  4MFE A;  3OS0 A;  3DKX A;  5KFZ A;  4IHW A;  2VQG A;  4DL7 A;  3LMM A;  2GA1 A;  4ECT A;  2IMZ A;  3OOP A;  5DQI A;  2RQQ A;  4DL5 A;  5JR3 A;  3TO7 A;  1HSJ A;  4HEA 2;  3AFH A;  5A77 A;  3MQ0 A;  2YU9 A;  1WVR A;  4N9H A;  2M30 A;  1BJT A;  4C3I J;  5LHH A;  3GLK A;  2I10 A;  3J81 Z;  1B6R A;  5B66 C;  4QWE A;  1OCP A;  5B5E C;  3BTJ A;  4N4N B;  2E5L H;  4JI5 H;  5K5Q A;  3ZMD A;  1F36 A;  2IVM A;  4N4O B;  1T2K A;  5D8L B;  3WU0 A;  3G1O A;  2IT0 A;  5KK1 A;  1LWS A;  1TLH B;  2SCU B;  1MBH A;  2FQ3 A;  3FZV A;  3ZQ7 A;  4LFU A;  5J1U A;  2R7R A;  3BPV A;  3K3V A;  4ECU A;  3OYN A;  3E5U A;  1W7P A;  1V54 H;  3FIW A;  4AD9 A;  4LG3 A;  1T38 A;  2WA0 A;  1MH3 A;  1NG7 A;  3HG9 A;  3OYK A;  3LQQ A;  4GCV A;  4EFE A;  2J9G A;  1XDS A;  2DMT A;  3MWM A;  1GSO A;  1RNL A;  2R7F A;  2YUS A;  2LKP A;  1LWT A;  5FD5 A;  4M9S A;  3H40 A;  3BR1 A;  2ZB9 A;  3QPL A;  3TO6 A;  2XD4 A;  2EJR A;  3BTC A;  3H92 A;  1DGS A;  1K83 J;  2V1U A;  2K27 A;  3SDG A;  4AAE A;  2PN1 A;  2HTS A;  2V5A A;  4F4Z A;  1HKS A;  4KMU X;  5AIP A;  3QFF A;  2J6U A;  5C4X G;  1LVK A;  2RDI A;  5ICG A;  2C2E A;  2LC2 A;  3OHB A;  2DA2 A;  2YZM A;  5KFL A;  2QKM B;  1RJR A;  2E1N A;  3ZXS A;  2HVQ A;  3CCV I;  3LSM A;  4A3L G;  3TDU C;  4O4H F;  2OAZ A;  4G7Z F;  3S1Q J;  4C5C A;  3DU6 A;  3HOZ J;  4M73 A;  2JUG A;  1X1D A;  2XSD C;  4Y4R A;  5DG8 A;  1U2W A;  1D0Z A;  1R5H A;  4A3B J;  1TZL A;  5DDG A;  3BZK A;  1SD4 A;  4HV5 A;  4BDY A;  4N9I A;  3CLQ A;  1FYL A;  1TA8 A;  4PFP A;  5CVI A;  5J1R A;  3IP4 B;  2MG4 A;  4V2F A;  2CV1 A;  4U0W A;  3C7J A;  2XGP A;  2ZKZ A;  1BR4 A;  2CH0 A;  5FO5 A;  2WAQ A;  4CA0 A;  1HOM A;  1DQ3 A;  1YYV A;  3KHR A;  2AGP A;  3JTG A;  5IYZ F;  1ZLJ A;  4J0M A;  2H94 A;  4XRS G;  4MV6 A;  2ZJR F;  2HOS A;  1SVL A;  3ZMV A;  4JX6 A;  3DF8 A;  4Y52 J;  2G7H A;  1JHH A;  1H9T A;  1G3T A;  1GV5 A;  3DLA A;  3FKI J;  2XF7 A;  3TQ1 A;  3WHB A;  4FAS D;  3PSF A;  5EEA A;  3GIM A;  2V1N A;  4UN9 A;  3Q2O A;  2X0L A;  1VQM I;  2R7Z A;  1TWG J;  4BY7 G;  4LIT A;  3NEU A;  4KFC A;  3DXJ F;  4BWS C;  5HV6 A;  3LSH A;  1V5F A;  1TWC A;  3RKY A;  3ORR A;  1YIJ I;  2M45 A;  1TQI A;  1X4O A;  1KQ0 A;  1MBJ A;  5LGU A;  1ZRD A;  4R8U A;  1H89 C;  2GBY A;  2F2E A;  3F8B A;  4GRI A;  4AQX A;  1FSE A;  1ZLK A;  1HC8 A;  1EUD B;  2EIM H;  3KP2 A;  4CSW A;  4BH9 A;  4BS9 A;  2XGX A;  2JWT A;  2EFQ A;  2QM3 A;  1JJ6 C;  5C1P A;  2CJJ A;  2L3D A;  3LA2 A;  3A03 A;  3SFI A;  4ENM A;  3B6C A;  4KIF A;  3E6M A;  1LE8 A;  5K08 A;  4D5C A;  1T0F C;  4S05 A;  5FLM J;  4GLX A;  2N8G A;  4J9N A;  4I6Z A;  1HXD A;  2JN6 A;  3WE3 A;  2VKV A;  3HIF A;  4KT6 A;  1GGO A;  4Z2Y A;  1FYK A;  5KT6 A;  3E7L A;  4BUP A;  4NXN H;  2K5C A;  2P6T A;  3LNQ A;  1P9Q C;  3OHA A;  4EGQ A;  1S0M A;  1XG1 A;  4FBU A;  1Z2N X;  2P8T A;  4AU7 A;  3IN5 A;  2OA4 A;  5L1L A;  3LAP A;  2VQD A;  3MWE A;  5K1Y A;  4LMY A;  5GPA A;  1NG6 A;  2PX9 A;  1OYY A;  5TIS C;  3SJM A;  1B8I A;  2BQU A;  3TED A;  4BXX G;  5KT4 A;  3MD2 A;  3MKZ A;  3HC7 A;  2Q8K A;  2VBY A;  2JMZ A;  2PQ8 A;  1S7A A;  4F3Q A;  2F4I A;  4AYB E;  1FIP A;  3CMY A;  2AGO A;  2LMD A;  4IOA F;  2UUB H;  5EZH A;  2XB0 X;  4P96 A;  3R5X A;  3BQ1 A;  4LGW A;  4M6Y A;  1DDN A;  2ZME C;  1MH4 A;  4JP0 A;  5J40 A;  2BV6 A;  3H9G A;  2VJI A;  4PUS A;  3D0S A;  2JPC A;  1A35 A;  3AG1 H;  2VJ5 A;  4D5F A;  5J4V A;  2B7E A;  3CDI A;  3WTX C;  3OY9 A;  2FLD A;  3V4S A;  2XUB A;  4U6P A;  1S9F A;  4F93 B;  2IMW P;  2Y30 A;  5DCF A;  2X6Y A;  3WG7 H;  5DQH A;  3JRE A;  4O3O A;  2W6Q A;  5KNL A;  1G2H A;  4HAM A;  3ZQF A;  1W96 A;  3ETH A;  2W6Z A;  5HLI A;  3ABU A;  2FJ1 A;  1F1Z A;  1GXQ A;  5CKT A;  2C00 A;  3GTM A;  1Z0X A;  5DM6 F;  3L00 A;  4EGY A;  5JHU A;  4FU0 A;  1XMX A;  3KCC A;  3C0W A;  2VT2 A;  5D8D A;  3HEF A;  4YR0 A;  3PM1 A;  2QKL B;  5KG4 A;  3ZPL A;  1VQN I;  1XSV A;  2O7M A;  2E5Z A;  1I3Q J;  2D45 A;  3RZO J;  2DIK A;  3BR0 A;  3BR6 A;  2HZD A;  3QQA A;  3AL0 C;  3Q0V A;  1I7N A;  4PSW A;  1W7P B;  2IA0 A;  2LKX A;  3N05 A;  2HVS A;  1ZHF A;  4Y15 A;  1TWH A;  2ALZ A;  1WHU A;  2J5O A;  2YU9 J;  4ECV A;  2JA7 J;  5K5O A;  1EYZ A;  1ETV A;  3OYD A;  4I0A A;  4RAG A;  2ZC2 A;  4DL2 A;  2W48 A;  5LD2 C;  4IZO A;  3FBI B;  3G2B A;  2CYY A;  3PR5 B;  2W85 A;  3CJT B;  2JA5 J;  3S1R J;  3GID A;  2FBH A;  1Z77 A;  4DQ2 A;  3TQT A;  2A68 F;  4HNV A;  3N97 A;  5HS8 A;  3JSL A;  2OJE D;  1KEE A;  3JSN A;  1TQP A;  3FX3 A;  2H8R A;  2VOB A;  2B63 J;  4I98 B;  2BOL A;  1VF9 A;  2UVW A;  3GO5 A;  4JI4 H;  2NNY A;  1Y1V J;  4IHJ F;  2P6S A;  2EIL H;  3HRM A;  1IRZ A;  5IYB J;  3F8F A;  2B9S A;  4ED2 A;  3T1H H;  2NS0 A;  1KJI A;  3OV8 A;  1U0D A;  3BAB A;  4BE1 A;  4J9Q A;  3VPD A;  1FWZ A;  4BBS J;  1ZR4 A;  4X1E A;  4A3K J;  4ZDP A;  3D5R C;  3R60 A;  4ESB A;  1SFX A;  3H3V K;  1VZ0 A;  4TV9 F;  3BJY A;  3QP6 A;  4MIM A;  3ZMU A;  4X64 H;  4I0B A;  2TDX A;  1HA8 A;  4MA0 A;  2JT1 A;  4EJO A;  4F4W A;  4LF9 H;  1E4F T;  4ZDL A;  2GXG A;  4MEY F;  3AAF A;  3D5S C;  3A2K A;  2A6H F;  3E3V A;  2R3S A;  2RNG A;  5HLH A;  1T9J A;  4UCU A;  2IBK A;  1I6X A;  5HDK A;  2M87 A;  4EV0 A;  2O61 A;  1XCB A;  1IN4 A;  3OMY A;  3QAH A;  2ZNY A;  3OYL A;  2PJP A;  3HRS A;  4AAD A;  4ED1 A;  3ECH A;  2EFP A;  2L2O A;  2FD5 A;  3RV4 A;  2VLA A;  1IG7 A;  3GYH X;  4JOM A;  1U5T A;  5BMV F;  2XCA A;  2VA3 A;  2CQQ A;  4JX5 A;  4J9R A;  2XC7 A;  3HSF A;  3L7W A;  2Y75 A;  3QU3 A;  4V19 K;  1RR7 A;  2R7T A;  1SFO A;  1HKT A;  3ZQQ A;  1R22 A;  2XPW A;  3OYI A;  2W70 A;  1VBG A;  1ZRF A;  1BNC A;  3GF2 A;  5DYM A;  1CF7 A;  4QW8 A;  2OC6 A;  1ZG1 A;  4HQ6 A;  3I4N G;  4HPQ A;  4LSA A;  4RUC A;  3FHN A;  2STT A;  2CSO A;  1UC8 A;  2GOM A;  2EB7 A;  4NXM H;  1T39 A;  3T8R A;  1U8B A;  5L3G A;  2Z2S B;  1AUX A;  2X6O A;  3PFY A;  4I01 A;  3P9K A;  1HKQ A;  1UG0 A;  3CMM A;  4WX9 A;  3MFK A;  2HR3 A;  5CVR A;  3K0L A;  4ASN A;  1MBE A;  3HB9 A;  4YG2 F;  2F5C A;  4XN3 A;  1IN5 A;  1VBH A;  4Q47 A;  2FUG 2;  2NVT J;  1O75 A;  2BVM A;  3ETJ A;  3Q8Q B;  3G6Y A;  2DDB A;  1AOY A;  3S3O A;  1LE8 B;  2CRG A;  2FRH A;  3OWT A;  2ECC A;  3SZG A;  4ZYD A;  1TWC J;  2MC4 A;  4YIT A;  3HKZ A;  2VC0 A;  4HG2 A;  5BS6 A;  3PW7 A;  3IV5 A;  2R5Z A;  4EYH B;  1IXC A;  1WSC A;  1DPR A;  2PMH A;  5C3E G;  3BZC A;  2OQG A;  3PQK A;  1SVM A;  5CJ9 A;  2LWY A;  3C0X A;  4MV7 A;  3HOV G;  4BKX A;  5EWF A;  4A3E G;  2DOE A;  3ZQL A;  4A3J J;  2CQN A;  4YFX F;  2VJJ A;  3O6B B;  2F5V A;  3J7A K;  2YS9 A;  3KAL A;  1TQM A;  1EHI A;  1SD5 A;  2DI3 A;  5KFP A;  4GFB A;  4DR5 H;  2KQR A;  3U21 A;  2R7S A;  2MH9 A;  4K0K H;  1SAU A;  2MW8 A;  4ZH4 F;  2CMP A;  4DV7 H;  3R5H A;  4XYM B;  3LSI A;  2V9W A;  2GPW A;  3RIR A;  3F23 A;  1RKW A;  1B8I B;  1GV2 A;  3ZR8 X;  2D5V A;  2H8W A;  4M74 A;  2QEN A;  2WAE A;  2Z9O A;  1SEI A;  3RV3 A;  1BJZ A;  1Y0U A;  5ICF A;  3E5X A;  1Z9C A;  1BGW A;  2EK5 A;  1F43 A;  2OH2 A;  4ENK A;  2NVX A;  3PW0 A;  1XPX A;  4XRS A;  1MMG A;  4DUY H;  2ZSH B;  4HX8 A;  1CQT A;  4UCS A;  3V4Z A;  1WH7 A;  2K85 A;  5FKN A;  2H1K A;  5CQG A;  1MI8 A;  2FSW A;  1B04 A;  3G6E I;  1I27 A;  2L01 A;  4A3M J;  4ECR A;  1PDN C;  1OCO H;  4QIW A;  5CYV A;  2QSG X;  5B3S H;  1T0F A;  4A3D J;  1Z67 A;  2GQQ A;  3CCM I;  4BQA A;  4KIS A;  2LFB A;  3DTE A;  2DXI A;  5DLF A;  5FKM A;  2HYG D;  1YO5 C;  2DYR H;  3C2H A;  4BHB A;  1WR2 A;  4DLK A;  4C2M A;  5L1I A;  2YPR A;  2OBP A;  3ZMT A;  4KHP H;  3WGG A;  5C4J J;  1JXL A;  1X3W B;  4II2 A;  2GWR A;  3EQL F;  4UY8 I;  2DBB A;  3CF2 A;  4X6A J;  2JA8 G;  1ETQ A;  1K6O A;  3GV5 B;  1XD7 A;  4LLN A;  4E6K G;  3R6S A;  3GFL A;  3M9N B;  1R5I D;  2FB9 A;  4L5E A;  2NXN B;  3BY6 A;  4L9J A;  4BY1 G;  1DFA A;  2RDJ A;  4KN7 X;  3VOE A;  2DU9 A;  3JRC A;  3PW4 A;  1TTY A;  2VPS A;  1RI7 A;  3HGY A;  1JDE A;  3BRO A;  3T8T A;  1ZTR A;  2UU9 H;  1U0J A;  4WD3 A;  4IRK A;  4E7J A;  3PIP F;  1GYF A;  3IAS 2;  3I9V 2;  1Y39 A;  4DV1 H;  4IRH A;  5FLX K;  1U3E M;  2FJZ A;  2W82 A;  1DP7 P;  5E3O A;  1X3Z B;  2GZW A;  2IAI A;  3MMY B;  4BU2 A;  1ETY A;  3WGI A;  2EQR A;  3ERM A;  3CC7 I;  2Q1Z B;  2XVC A;  3RZD J;  1D8K A;  2IGN A;  2E2J J;  3I53 A;  1TWH J;  2NVU B;  3DKY A;  2EIK H;  1QZE A;  3CCY A;  4TV7 A;  1D1A A;  4OAY A;  2JA7 G;  2VPL A;  4RB3 C;  5A78 A;  2QBY A;  3Q8S B;  2O3F A;  2V7F A;  2TRT A;  1M6V A;  1NH3 A;  4J9P A;  5EYR A;  2C28 A;  1PP8 F;  1LUJ B;  4AAG A;  1ZDE A;  3Q9S A;  4RA2 A;  5F0H A;  5JVT A;  2JA5 G;  4E7I A;  2RC4 A;  2RKH A;  2A5Y B;  2K9M A;  3BQZ A;  1YOV B;  5A74 A;  1ORK A;  3C2G A;  4JI0 H;  5GPC A;  1KJ9 A;  1G4D A;  3I4M G;  1ONV A;  1IXS B;  1IXR C;  3KYD B;  3HPH A;  3Q0U A;  3RBE A;  1T3N A;  3LA3 A;  4LD5 A;  2H09 A;  2E2I J;  4Q4Z F;  4DV3 H;  1DP3 A;  1AM2 A;  4G6Q A;  4UN7 G;  2O6G E;  2E7W A;  2HYF A;  2WBM A;  5L3E A;  3E6C C;  4CHU A;  5IYD J;  1U6G A;  1Y1V G;  3G1L A;  3RB4 A;  4QPQ A;  4D6N A;  4AIH A;  2R86 A;  2K9N A;  1GSA A;  4BYY A;  3L4J A;  4QPO A;  1D0Y A;  1H8A C;  1BA5 A;  3CJN A;  1E17 A;  4MO7 A;  5EDW A;  1BW5 A;  2A61 A;  2BHY A;  2KEQ A;  3GV7 B;  1SMT A;  1U5T B;  2EV5 A;  4MQV A;  2KRH A;  4P5O A;  5GTH C;  2P5V A;  5HLG A;  1O3S A;  4L5J A;  3EPG A;  3G6X A;  5JLX A;  3ZP5 A;  2ZXW H;  3VYT B;  5TRD A;  4LQ0 A;  1JX4 A;  4H4K C;  2Q2T A;  5EOY A;  3BG9 A;  4YR2 A;  2VUM J;  3N44 B;  4C2T A;  4HYK A;  1MIJ A;  2WTE A;  4QWD A;  3UFX B;  2M0C A;  1DU6 A;  1YS6 A;  1CF7 B;  4YEL A;  2W8K A;  4I2O A;  2ZSI B;  2JNQ A;  4Y17 A;  3PO2 J;  3I12 A;  2BR0 A;  1Z2O X;  1LDK B;  5KT5 A;  3RBD A;  1P92 A;  4M7E A;  2IS2 A;  4H0E A;  2JVH A;  5E3L A;  1Y14 B;  4DNC A;  1RZ4 A;  2QYO A;  3HOU J;  1YW9 A;  1N3F A;  2WAQ E;  4EFB A;  1N77 A;  2Q0O A;  3JSO A;  3NGD A;  4IR1 A;  1IZ1 A;  3K69 A;  5GP9 A;  1HW1 A;  1ETX A;  2L8L A;  5IP7 G;  1E3P A;  4ME6 A;  2VXZ A;  2QUF A;  2R5Z B;  4M3E A;  2R8H A;  2VPR A;  3RKW A;  1P4W A;  2DT5 A;  1BI2 A;  3L09 A;  5F08 A;  4YIF A;  2CWE A;  2VI6 A;  4QWA A;  2BE5 F;  2BGC A;  3KO2 A;  3BOQ A;  1P6R A;  4MLO A;  2UVV A;  2R7L A;  5KFJ A;  4FIS A;  3GME A;  2XCL A;  1EJ9 A;  5FKK A;  5L9X A;  4IHT A;  1KBL A;  4ED3 A;  1J5E H;  3H3V H;  2B0L A;  2G9W A;  1TAE A;  1DV2 A;  1TWA A;  5IOY A;  2Z33 A;  3OIP A;  5H6R A;  1R23 A;  1UST A;  3I3L A;  3FXL A;  4G8X A;  4LOX A;  4JI3 H;  4G3I A;  1RYS A;  4M72 A;  4XRF A;  2AHQ A;  4XQF A;  3J7A Y;  1RK6 A;  1JE8 A;  3L4K A;  4J9O A;  2VIX A;  3BT9 A;  2VE9 A;  4A3I J;  1Y8R B;  4IQ4 A;  2BHZ A;  2JRM A;  5A2Q K;  2JA6 J;  1BI1 A;  2ZJ2 A;  4KT5 C;  3F6V A;  2V4R A;  4CYD A;  4EM1 A;  2CQY A;  4OIP F;  3KE2 A;  2R92 G;  5D6E A;  2XF6 A;  3VYU B;  3VYS B;  4ESJ A;  2VQE H;  3E6B A;  1L3L A;  2W6N A;  3Q1K A;  3BR3 A;  2IRF G;  1ZGW A;  2L9S A;  4L9N A;  3KHH A;  2F4V H;  3U2R A;  5JH7 F;  4R7R A;  1JT6 A;  2NVX J;  3V6H A;  1TNS A;  4EBC A;  1POG A;  1C3O A;  2W00 A;  4DZJ A;  4EGJ A;  4HBL A;  2A69 F;  1JHF A;  2UUZ A;  4XLP F;  5C1O A;  4AAF A;  2KZG A;  1X3U A;  3BCB A;  5HS9 A;  2X6X A;  1KC7 A;  2BXY A;  3K2A A;  3J7Y J;  5ICE A;  1KYW A;  2XKP A;  2PVP A;  2FOK A;  1YIO A;  2HPI A;  5GAE J;  4MFD A;  4A3D G;  1B4A A;  4Q48 A;  1ZH5 A;  4IHY A;  1LFP A;  2MH2 A;  4G6T B;  1AHD P;  2VBN A;  5FGM A;  4PJM A;  5H2F C;  3DLL F;  2BY3 A;  1K61 A;  4E70 A;  3K70 C;  2BW3 B;  3JAM W;  4IWX A;  1V55 H;  4JV1 A;  3TOA A;  1YS7 A;  1IC8 A;  1TW2 A;  4HW0 A;  4MTD A;  2HQR A;  4B47 A;  4LB6 B;  2R7U A;  5A0W A;  3KYC B;  4PJN A;  2OCC H;  3ECO A;  4XLF A;  1BI0 A;  1G8X A;  5JFR A;  2M1B A;  1VKZ A;  4L1K A;  3CJQ B;  3T1B A;  3E5N A;  1XS9 A;  3OYJ A;  1STZ A;  1FBU A;  1QPI A;  1TL8 A;  1V4Y A;  1ZHS A;  4IXA A;  3M1E A;  1M7J A;  1EUC B;  3CUO A;  5LBQ A;  1JUP A;  1R7J A;  4B44 A;  2QBY B;  3DPL C;  3HOT A;  4MV1 A;  5JHF A;  5JUM A;  4UNA A;  3X2Q H;  4ENN A;  4ED7 A;  4IHV A;  3HL2 A;  2A05 A;  3WHC A;  3PO3 G;  3CVZ A;  4FE4 A;  1BC7 C;  4ZI7 F;  3KEY A;  2XPU A;  3F8N A;  1JKR C;  2VC1 A;  4P9F A;  2E60 A;  2ZJQ F;  1ZEL A;  2BZT A;  4TV8 F;  4LF8 H;  1MBK A;  2VUG A;  3H5A A;  1T8I A;  3AL0 B;  1S10 A;  2ZM6 H;  2R93 J;  3BJA A;  1V5G A;  4NLG A;  4DR3 H;  2XSJ C;  5D1P A;  2R7M A;  2CV2 A;  1BR2 A;  1FOW A;  4FET A;  4R79 A;  2JEF A;  3JRA A;  3COA C;  4GIG A;  2BY0 A;  2LK2 A;  1SAX A;  1OYI A;  1W4M A;  1EZ1 A;  3N6X A;  5I47 A;  3S3M A;  4F4X A;  2NYX A;  4CH7 A;  4A3G J;  2DMU A;  1RK5 A;  2HXO A;  1MBF A;  3CCS I;  2JSP A;  3OS1 A;  3JAM Z;  3M8J A;  2QQB A;  3WTU C;  1N3E A;  3CQZ J;  1NHA A;  3GIP A;  5HBR B;  4GDF A;  3IWZ A;  1F4K A;  2ZDH A;  3K7A J;  4NNJ A;  5IYC G;  3BG3 A;  2A07 F;  4O1S A;  2LYC A;  2W7O A;  2X1E A;  3LSP A;  4BXU A;  1XSX A;  1J09 A;  2OQR A;  3A4C A;  2V59 A;  5DGA A;  5K7F A;  2W7N A;  4AAB A;  2XGQ A;  2CV0 A;  2C35 B;  3A0H C;  2FPG B;  3HOX G;  2VBJ A;  4X0G A;  3ZQH A;  5E79 C;  2HYJ A;  3WTT C;  4DR4 H;  5KFN A;  3GWZ A;  3ASO H;  1OPC A;  3CTA A;  4L9V A;  4Y8V B;  3O8G A;  3ABL H;  4EEF G;  2JPB A;  3DV8 A;  4QWQ A;  3WU1 B;  2WTF A;  3EUK L;  2H27 A;  1UFM A;  1V3F A;  3O3K A;  3GTL J;  5HS7 A;  5LRS A;  5K5R A;  2DFF A;  1XSD A;  4D0P A;  1YTY A;  3S16 J;  2OLS A;  2XDV A;  5KG2 A;  2X51 A;  3SFZ A;  1T56 A;  2FPI B;  4ECY A;  1OR7 A;  5KG6 A;  3TGN A;  3L2Q A;  4BNC A;  4BBR G;  4IHS A;  9ANT A;  2VBX A;  2JEI A;  1F9N A;  1VQ9 I;  2XE0 A;  2M3A A;  1U5T C;  1LDD A;  3OSP A;  4HR7 A;  1HDP A;  3OS2 A;  2NS8 A;  1K7A A;  2E2H J;  5HVQ C;  4TQR A;  1OYW A;  4IR9 A;  1E0E A;  4XOP A;  4A3C G;  2NRA C;  1I6H J;  2YYA A;  3LFU A;  1ACI A;  5KFV A;  1IDY A;  5F1J A;  5AK9 A;  2DCE A;  3HPG A;  4D6O A;  3CF5 F;  2X0S A;  2CFO A;  1FOK A;  2O03 A;  4IRI A;  2X4H A;  2NNN A;  1U9N A;  4DV4 H;  2DA4 A;  3WTW C;  3G71 I;  1JI8 A;  4K2E A;  3RKX A;  2WB1 A;  3ZQC A;  2DPU A;  1U0C A;  1HF0 A;  5IWA H;  2V9K A;  5L3F A;  5FJ8 J;  2JSC A;  2Y69 H;  1A5J A;  3IGD A;  3TDZ C;  3RKQ A;  3FHZ A;  5FRN A;  2I8D A;  4PSX A;  3M9A A;  3QPS A;  4DR2 H;  2HFH A;  4QW9 A;  3T5H A;  2HTJ A;  1RKT A;  3QYF A;  5FFX A;  4WBN F;  4NQW A;  3KZI C;  2JQ7 A;  2R7V A;  3C0F B;  3V4G A;  1UZC A;  1YJN I;  5L3C A;  1Y1W G;  4DV5 H;  3TP0 A;  3LFK A;  1VAJ A;  1TWA J;  1WJD A;  2EFO A;  2W25 A;  4C3H J;  2L9N A;  3CJR B;  4XKB A;  3GLL A;  3UVF A;  4FQG A;  1J5Y A;  4O2A F;  3ZN0 A;  3GTK J;  2O8X A;  2WE6 A;  4OIQ F;  4APM A;  3H0G J;  4A3I G;  5D4R A;  2W6M A;  4RNO A;  3HKZ N;  2JA6 G;  2Y2Z A;  3S2W A;  3L2P A;  1QPM A;  2AQE A;  4CCK A;  4S0H B;  5L3B A;  1J2X A;  1TWF A;  1XGS A;  2AGQ A;  5H80 A;  3KTM A;  5CLS A;  3IKT A;  1J7K A;  3KP6 A;  3I56 I;  3DTI A;  4O3Q A;  1W7P D;  2K4B A;  2UZK A;  5BOX A;  1S68 A;  1FBQ A;  4XOT A;  3WTV C;  1ITY A;  3K4M A;  1U78 A;  2VBN B;  3HTU A;  2Q2U A;  2XGE A;  5HNF A;  1TP4 A;  4IWY A;  2F5D A;  1U8R A;  3K6G A;  1I39 A;  1IRX A;  1X58 A;  1MOW A;  4XIC A;  3CDH A;  4JUZ A;  2KLO A;  1N36 H;  1O3Q A;  2KJC A;  1JKQ C;  1IUF A;  2YL2 A;  5KFG A;  4RNM A;  5BPH A;  1KU9 A;  1LJ9 A;  3DBL B;  3RDI A;  1VQO I;  2L7M P;  5CPR B;  5D4S A;  5AKN A;  4DUZ H;  3V8L A;  5LYJ F;  2RRE A;  3FM5 A;  3KZZ A;  2L9V A;  5E63 A;  1Z3Y A;  4QWB A;  4DL6 A;  3LA7 A;  3AG2 H;  3E97 A;  1WCM G;  1QNT A;  3JRX A;  5F9L A;  3TII A;  4A93 J;  4QIW N;  4EAT A;  4JBA A;  3QU6 A;  2O0Y A;  3S1N J;  4HYE A;  2FLP A;  3ML6 A;  4FHT A;  1JKP C;  2E5N A;  2X6W A;  3CUQ A;  3F3X A;  3G3Z A;  4ITV A;  4RM3 A;  5DCM A;  4D9J A;  2RDP A;  2KKO A;  1WWX A;  1ZRE A;  3RUP A;  2ZBK A;  3IC7 A;  1IN6 A;  3PVX A;  2R92 A;  5L3D A;  2WV0 A;  1LFU P;  3I5U A;  3PIO F;  5CAE B;  5M3M J;  5GTI C;  5DGB A;  3FD2 A;  4YQW A;  4ZHQ F;  2IJL A;  1SD7 A;  3CCQ I;  5AKM A;  3BR5 A;  1WI3 A;  2K7L A;  3F0C A;  4DW6 A;  1R7M A;  2VON A;  3IH2 A;  2W71 A;  5KFI A;  4EQQ A;  3ABK H;  5F64 A;  2JEJ A;  3DFG A;  3S93 A;  3J7Z I;  2EZL A;  4LH6 A;  2X1C A;  3HTS B;  2EX5 A;  1G3W A;  4W1U A;  4EM0 B;  2C2R A;  5HNH A;  4BE2 A;  5EDN A;  4DR7 H;  1I50 J;  3HHH A;  1G9Y A;  1YQA A;  2STW A;  1SFE A;  3E5Q A;  2IP2 A;  2IS1 A;  4KL5 A;  2ELH A;  2K3P A;  2QEX I;  3T5K A;  2PEX A;  2R93 G;  4OAZ A;  1H9G A;  4Z6Y A;  4IX7 A;  4DGW B;  2IPQ X;  3KIO A;  2FF4 A;  3V7C A;  5KFC A;  1BN5 A;  5LEK A;  3ZCO A;  4MQ9 F;  4ON0 A;  3ZQI A;  5GAD J;  2Y9Z A;  3M8F A;  4BQO A;  2XRO A;  5E1X A;  1W36 C;  1QRY A;  3I58 A;  4BDZ A;  4Q8E A;  2D2W A;  2VBJ B;  2FEZ A;  4O4I F;  5LRR A;  3KEQ A;  3JRB A;  3TIN A;  2VKD A;  5D6F A;  2XAH A;  2IS6 A;  2DO7 A;  2FU4 A;  3BLY A;  5DD8 A;  3QPT A;  1W0T A;  3LP8 A;  2E1C A;  4UV8 A;  3MXB A;  5KFA A;  2FNA A;  4UCO A;  3PQJ A;  5IP9 J;  2IS4 A;  1UB9 A;  3VPB A;  1NK2 P;  2QK4 A;  1OIS A;  1UNN C;  2UXB H;  4RMN A;  1N34 H;  2UWM A;  2V4J C;  4XMY A;  3CC4 I;  3OOL A;  1HCR A;  5IOZ A;  1JIH A;  3QOP A;  4MA5 A;  3GTP A;  1N33 H;  4EJT A;  2EWN A;  2MAB A;  2Z3Y A;  4KUM A;  3K5H A;  2XAU A;  2XE0 B;  4QLC U;  4HF2 A;  1AN7 A;  5C5J A;  1RR8 C;  4RS8 A;  3R7P A;  3JRW A;  1IRF A;  2JUC A;  2L7F P;  1D8J A;  3SEZ A;  3VMM A;  2VBW A;  3L9F A;  3W2V A;  3A01 A;  3VSK A;  4L0Z B;  3HOW J;  2WAD A;  3K3P A;  4G9Y A;  1S0O A;  3CMA I;  2IA2 A;  3SZT A;  2DFH A;  1Y56 A;  2MLG A;  4B3M H;  3N4M A;  3RAQ A;  2W84 A;  1DGR M;  1ZAR A;  5B1B H;  4ESF A;  2FMA A;  1X2M A;  4JI2 H;  3H5R A;  4EM2 A;  4LJZ F;  5JVD F;  3A0B C;  2KIU A;  3G73 A;  4PCQ A;  4QWC A;  4I50 F;  2K3F A;  1LB2 A;  1BL0 A;  2RAE A;  4KIG A;  1FP2 A;  1XGM A;  3KPH A;  2ZJP F;  2YSR A;  1AWC A;  2BQR A;  3GEZ A;  3ZOB A;  2HOT A;  2DTR A;  1IBK H;  3LAJ A;  3F9K A;  1FNN A;  1I3A A;  2P5K A;  2Z5U A;  4C3J J;  1X9N A;  3K70 D;  4J00 A;  2MYS A;  1M0W A;  3RPU A;  4HDV A;  5KT2 A;  5H6Q A;  4LB5 A;  3KX2 A;  2V9P A;  2Y0S N;  4NQW B;  1KYZ A;  3HOZ G;  5I0A A;  4C5A A;  5FKO A;  3RAX A;  1MSE C;  4QSH A;  5J2T F;  4O3S A;  4ZZL A;  2GXA A;  3GTJ A;  2G0E A;  4UUS A;  2DWC A;  5HDG A;  1I7L A;  1IBL H;  4A3B G;  4XOR A;  4HLY A;  5EEH A;  1E4G T;  2HZT A;  4ENJ A;  1WJ5 A;  2A6T A;  3E1S A;  5KVR A;  3V6J A;  3PZP A;  4M6X A;  5FJ8 G;  4B3A A;  5D5U B;  4IPA A;  1KU7 A;  2ZXH A;  4C30 A;  2MA3 A;  2BYV E;  4IO9 F;  3BG6 A;  2NVY A;  2DMN A;  4DV6 H;  1M0T A;  2ZDQ A;  5F0F A;  2XIG A;  4CXF A;  3LWF A;  1AKH A;  3WGH A;  2HDD A;  2XKO A;  3FM3 A;  4MV8 A;  3OR2 C;  2F4M B;  2L54 A;  2M34 A;  3JRI A;  1YHQ I;  2KSW A;  4FX0 A;  4NHJ A;  1FLI A;  2V6C A;  4HSR A;  4FM9 A;  2K9L A;  4PGH A;  1RIO H;  4UCR A;  1B9N A;  4UHT A;  4XKW A;  5F6F A;  3GFI A;  2R85 A;  3WO0 A;  1ON2 A;  4CZC A;  2VOO A;  1ZHQ A;  2MLK A;  3M4O J;  3MKY B;  3FKI G;  3H1C A;  2VE8 A;  5LL6 b;  3ABM H;  1ZK8 A;  1I1S A;  1JKJ B;  3U9S A;  2R7Z J;  2MCT A;  1S3J A;  1OCZ H;  3W2W A;  1VTN C;  1CGP A;  1K78 A;  3RI4 A;  4UNC A;  2CUE A;  2ELK A;  2PMZ N;  5ILS A;  5FLX W;  3J80 W;  1ERD A;  1NTC A;  1SFK A;  3KFW X;  4A3F J;  3VWB A;  1GHC A;  1J0R A;  2KRC A;  3MN2 A;  4FTH A;  1Z1D A;  4L18 B;  1W93 A;  5EG0 A;  2LF8 A;  3C18 A;  4ZC3 A;  2GLO A;  4PJJ A;  1XDU A;  2DT6 A;  2OD5 A;  2L7Z A;  3UKG A;  2ZDG A;  4YR3 A;  1QVT A;  5J6X A;  3BA8 A;  4CDG A;  2W6O A;  2I80 A;  3CCR I;  4E2T A;  1FPQ A;  3CDL A;  2ASJ A;  4IRG A;  4P1W A;  1E4E A;  3K10 A;  1T33 A;  2MFZ A;  1MJB A;  3CUQ B;  5FRM A;  5K2M A;  4E7S A;  5DCM B;  3WTS C;  4EGZ A;  2R7X A;  5FLM G;  3RPQ A;  4J9S A;  4U88 A;  2VPQ A;  1Y1W A;  2ZFU A;  2CFX A;  4UB6 C;  1H88 C;  2FML A;  3GTQ A;  2HQ5 A;  4W97 A;  1W5S A;  4YHH H;  4HX4 A;  2W1O A;  2EZK A;  1DU0 A;  2FQ4 A;  1APL C;  2RF4 A;  1IW7 F;  1ENH A;  3Q9V A;  3GTO A;  3KHL A;  1FP1 D;  2QGU A;  3U1K A;  3J80 Z;  2K9S A;  1IJW C;  2LG4 A;  2C2D A;  4EJU A;  1BC8 C;  2G7U A;  2R8K A;  1SC7 A;  2FXA A;  2Q2E A;  2KIM A;  3L2C A;  1UEL B;  2GXB A;  3OSN A;  1S5L C;  2UUC H;  4YFN F;  4LSX A;  3T1Y H;  4QTR A;  2RQP A;  4Y33 A;  5KG0 A;  5FLX Z;  4GXO A;  2WAF A;  3CP8 A;  4KN4 X;  1FOX A;  3V7S A;  3GTG A;  3WO1 A;  1TW3 A;  1G3Y A;  3B6A A;  2R7W A;  1X4P A;  4B1R A;  3S17 J;  1X1A A;  1BM9 A;  2CUF A;  5LA6 F;  2LOO A;  4LFA H;  3FXO A;  2DFE A;  4RB0 A;  1DPU A;  5KFS A;  1FJG H;  4IQJ A;  1B9M A;  3MXB B;  2IEK A;  4MV3 A;  1H0M A;  5EEG A;  4HQM A;  1N25 A;  4M9U A;  4JI8 H;  4CCL A;  2IBD A;  3DP7 A;  5BPD A;  2M2E A;  4ECQ A;  1ZR2 A;  4WWC A;  2HWV A;  1XN7 A;  2FBK A;  4O6J A;  2BW3 A;  4D7M A;  2R0Q C;  3LL7 A;  4DZP A;  2NVQ J;  3GTM J;  2ETH A;  1WCM A;  2R84 A;  4RZR A;  2UVR A;  2EZH A;  1MZB A;  4UN8 G;  2CQ7 A;  3SQN A;  5DG7 A;  3FDS A;  4LFB H;  2CGP A;  2P81 A;  4UVB A;  1XGN A;  4XKV A;  2NU8 B;  1QHH D;  1KU2 A;  3ZRG A;  1XMQ H;  2LRE A;  2IA1 A;  1ZGA A;  1Z7L A;  2VS7 A;  3JRH A;  3NAR A;  3A01 B;  3OYG A;  1XGO A;  1UM2 A;  4DBR A;  3ORQ A;  3UNG C;  1D1B A;  2YX4 A;  1N78 A;  1FIA A;  4XZ3 B;  2KZV A;  1UHS A;  3N42 B;  2CU7 A;  4PDK A;  2Y31 A;  4YP3 A;  4BXF A;  5J1Y A;  2M4K A;  3MR3 A;  1K1S A;  4DR6 H;  5BQT A;  3TBI A;  4DYR A;  4U0Y A;  2WWY A;  4MTE A;  2I8C A;  1FVI A;  1B1B A;  2EZI A;  5CVU A;  1R36 A;  5KFT A;  3V42 A;  4J9K A;  3M8E A;  3GQC A;  2B63 G;  3GIQ A;  3ONQ A;  4CZZ A;  3KET A;  1R5G A;  2K4J A;  4HF0 A;  3HXL A;  5ED4 A;  1IV6 A;  1TT5 B;  2HU9 A;  2CKZ B;  4LH7 A;  2HKX A;  5LGN A;  2LR8 A;  2ZFW A;  1S8N A;  3V6K A;  1OR7 C;  4JK1 X;  5IYB G;  2ME6 A;  2VB6 A;  1SYX B;  5BNG A;  1SD6 A;  3HOY J;  1MW7 A;  1LEB A;  3RB6 A;  1LKX A;  2DA1 A;  3V8K A;  4UUS B;  4NB5 A;  2FBI A;  3MCZ A;  3DBR B;  4A0Y A;  4YAJ B;  3IAM 2;  4BBS G;  3KP4 A;  4A3K G;  2QA4 I;  4UXN A;  2DAO A;  4GO1 A;  4RB2 C;  4NUB A;  3P9I A;  3R4K A;  3CES A;  3Q0W A;  2DQL A;  4XKC A;  3FBN B;  3QOD A;  2I3Q A;  3FXR A;  5E1W A;  4Y7N J;  4HX7 A;  3DF7 A;  3OL4 A;  3SHF A;  2W24 A;  5DG9 A;  5LEJ A;  4I7H A;  4Q45 A;  2XPV A;  1B59 A;  4ABZ A;  3S32 A;  1AKH B;  3M07 A;  1OFC X;  3BTL A;  3FXM A;  3O2P E;  2VQC A;  1P4A A;  3QQY A;  1KA8 A;  2VAS A;  3BQ0 A;  2Y0S A;  1PX2 A;  1JUM A;  3PJR A;  1X1B A;  4EBE A;  3DEE A;  3CC2 I;  2YCH A;  4HST A;  3VPR A;  4A5M A;  5GAG J;  2ACJ A;  1K4T A;  1HNX H;  1EKE A;  1OCT C;  2QWW A;  1ZD7 A;  2L9R A;  4WCG A;  4O1R A;  3FXJ A;  1ETK A;  5DQG A;  2W9B A;  4RDU A;  1ZET A;  4YFK F;  3FK6 A;  1IRG A;  5KFR A;  2LBF A;  3HZJ A;  4II3 A;  1K78 B;  5CB4 F;  1SFO J;  1ZG5 A;  4RU9 A;  2K40 A;  2WB1 N;  5LMU H;  3M9M B;  1X2N A;  3S2H J;  5KFK A;  2YS7 A;  4WXD A;  5EG0 B;  1K83 A;  2R82 A;  1YJW I;  2M8E A;  1KJ8 A;  1AU7 A;  4GGG A;  3N40 P;  5ERI A;  1MNM C;  1YIT I;  5C4X J;  2FKL A;  3RCO A;  5EGO A;  2X85 A;  2DOD A;  2KDZ A;  2E19 A;  1AF5 A;  3OUZ A;  2LRD A;  4JV2 A;  4E2U A;  1ZKG A;  1E4E B;  2R87 A;  4F52 A;  2HPM A;  4A2B A;  1VQL I;  5KFQ A;  1UJ8 A;  1W36 D;  2LVS A;  5JQW A;  1OWT A;  1B6A A;  3BDD A;  4YJ3 F;  2W4S A;  1BR1 A;  4A3L J;  4M3G A;  3BG7 A;  2KPM A;  4FX4 A;  2AQF A;  1MNE A;  2FK3 A;  4FS2 A;  4XON A;  1UG2 A;  5A0M A;  1GT0 C;  3GZN B;  4XNF A;  3QZ8 A;  2JVG A;  2QCO A;  2YW2 A;  3HSR A;  1JKO C;  5LGT A;  3H9Q A;  5AIQ A;  2PMZ A;  5D5V B;  1YFH A;  2XC9 A;  4A3J G;  3ELK A;  4RBO A;  2L5Q A;  3FXQ A;  3HHG A;  4XID A;  2OWO A;  5F27 A;  5DS9 A;  1BI3 A;  1CE8 A;  2GAU A;  2D1H A;  4J9M A;  5C8Y F;  4XBF A;  2O9L A;  3PSI A;  1VFC A;  2GOX B;  2LTP A;  2MSY A;  3HM5 A;  2EV6 A;  3W6K B;  3FMR A;  3MX9 A;  2Q2E B;  3QZ7 A;  3K4L A;  4IAJ A;  1P8K Z;  5HDN A;  3ABT A;  1BOB A;  2QQ9 A;  2FPP B;  2R7K A;  1MJA A;  2I87 A;  2NOG A;  1ODD A;  3DBH B;  3P9C A;  3AG4 H;  2L0K A;  1ZN2 A;  2DA6 A;  3GUD A;  3S8P A;  3CUQ C;  4UUT A;  5KFU A;  2KIF A;  4A3M G;  4LG0 A;  2ELJ A;  4ECW A;  1A31 A;  2AS5 F;  3S3N A;  3UQ8 A;  2V1D A;  2BBY A;  1A36 A;  1TWG A;  4BY7 J;  1GO3 E;  2QYZ A;  1HNW H;  3NWT A;  5FPR A;  5DUI A;  3HRU A;  1R6R A;  4LK0 F;  4YAK B;  3HOS A;  4MV9 A;  5EF6 A;  4Q0Y A;  3MFI A;  2KHM A;  3ZQG A;  1MND A;  1JTY A;  3A1Y A;  4A0X A;  2R7D A;  1B33 N;  4F50 A;  1EV7 A;  4C2M J;  4C5B A;  4CC6 A;  2NOJ B;  4RAF A;  3C1D A;  1VQ6 I;  1KJJ A;  4XM3 A;  4ED8 A;  4PWQ A;  3TL4 X;  2XRL A;  4ZDO A;  4KA4 A;  3JCU C;  1O3R A;  3SDB A;  1VQ7 I;  1BW6 A;  1YRN A;  3OTO H;  4LIU A;  4M3B A;  4UVA A;  4C2U A;  2P0W A;  4EFJ A;  5LMN H;  3QRF F;  3L2R A;  3LSG A;  4Y3O A;  4CCO A;  4CYC A;  2FE3 A;  1R49 A;  3PW5 A;  2NUA B;  1S0N A;  1S03 G;  5KFF A;  1OCC H;  5IT9 K;  5LHG A;  2JK3 A;  4AID A;  2XAS A;  2FNP A;  1WKM A;  3HJE A;  4BE0 A;  3B02 A;  5TJJ A;  2V58 A;  3TKY A;  2YRW A;  1QGP A;  1IUY A;  4YY3 H;  3IFJ A;  3H3Z A;  2XAJ A;  2PG4 A;  1RJP A;  2XAQ A;  1IN7 A;  2HVR A;  4ZJZ A;  5EWG A;  2FOW A;  4B3R H;  3CP2 A;  2YZN A;  4Z1Z A;  1T95 A;  3S1M J;  3F72 A;  2DJI A;  4BXX J;  3M9O B;  1B72 A;  4DV0 H;  3G6V A;  2QSH X;  2V4Q A;  4I76 A;  2E1M B;  4LIV A;  3PNV A;  2UVU A;  3JRF A;  1MD0 A;  2F5E A;  2DLL A;  2V26 A;  4HNU A;  4F92 B;  1QA6 A;  5J2U F;  4WF2 A;  1IO2 A;  1GUU A;  1HW5 A;  2MGQ A;  3G1M A;  2GIV A;  2K86 A;  1WGX A;  3OSG A;  3NQO A;  4YEJ A;  4BAC A;  1IOW A;  2V9V A;  2GIZ A;  1S29 A;  3CLO A;  4A2A A;  1UAA A;  2NU9 B;  4EYI B;  1VI0 A;  2DTZ A;  1G9Z A;  2M7A A;  3CCE I;  4OOI A;  5BR8 H;  4OZ6 A;  1JXS A;  5IY5 H;  1ETW A;  4R8H A;  2EA4 A;  3HGG A;  5IYD G;  3KEO A;  4RNN A;  1K6Y A;  1Y6I A;  3MR2 A;  4YHX A;  2YZG A;  2NS7 A;  1WRJ A;  2VQL A;  1K1Q A;  1FBS A;  1ULZ A;  1MBG A;  3CCL I;  2IW5 A;  2XB5 A;  4IKF A;  2WY8 Q;  4U7C A;  2R7N A;  3RYR A;  2QQ8 A;  2MD5 A;  2COM A;  3VSL A;  1RYR A;  1I3Q A;  2UXD H;  4ED6 A;  4KIC A;  2R8G A;  1FY7 A;  1O7F A;  4Z1X A;  4UB8 C;  4JI7 H;  2W9B B;  3MKL A;  4IEJ A;  5CA0 F;  4I99 C;  1WJB A;  3R0A A;  3IH3 A;  2LBF B;  2VUM G;  4MV4 A;  2JA7 A;  3GXO A;  2J5P A;  2LH9 A;  2P5L C;  2UUA H;  3PW2 A;  4NC8 A;  1S72 I;  2LD5 A;  2L7K A;  5IT3 A;  5KFE A;  2F5F A;  3REO A;  3PO2 G;  2ECB A;  2JA5 A;  4IJA A;  3FXK A;  4E7L A;  4OU0 A;  4WK8 F;  2P4W A;  1QQI A;  1YJ9 I;  5EGO B;  2VN2 A;  5F0C A;  1IAW A;  4V2G A;  4G94 A;  4X65 H;  2CO5 A;  3HOU G;  2B63 A;  2ZCW A;  4FE7 A;  2AU0 A;  3JAM K;  1W5C C;  3R5F A;  4HLX A;  2KMU A;  3H5N A;  1K4S A;  4CC5 A;  1WJE A;  2HOA A;  5LHI A;  2IXS A;  3JSP A;  5JVG F;  1KQ8 A;  4Z20 A;  4UN7 A;  1YX3 A;  1Y1V A;  3VDX A;  4UV9 A;  5A0M B;  2WDT A;  1P8L A;  5J4Y A;  2A3S A;  3J7A O;  2HDW A;  1IBM H;  3EYI A;  1V4R A;  1Z6R A;  4EMS A;  2VL8 A;  4LOC A;  1X19 A;  2OZU A;  2XRN A;  3BJO A;  5DD4 A;  1EF4 A;  1ON1 A;  4RGS A;  1N75 A;  3J81 K;  1O4X A;  4O4L F;  5FRO A;  1DV1 A;  1BIA A;  2GM4 A;  4E4H A;  4NBQ A;  2J6S A;  2ASD A;  3MVP A;  3HKZ E;  4DOZ A;  5FFZ A;  5KFH A;  2VBO A;  2W6P A;  2VQH A;  4OIN F;  2GA2 A;  4RGX A;  5E1Z B;  4FCY A;  4DR1 H;  4GC6 A;  1WPK A;  1R9T A;  1TT0 A;  2PLY A;  1IN8 A;  2H1L A;  1GVD A;  1XCV A;  2HI3 A;  3KLN A;  4XLC A;  1GSH A;  4F4Y A;  1XTA A;  3K4N A;  5BPI A;  1OCR H;  4L0Y B;  1T08 B;  1GPP A;  3MXA A;  2WC2 A;  1Z6T A;  2X1D A;  1A0I A;  2EFW A;  1RC9 A;  3KP3 A;  1ULY A;  1FMW A;  4DYQ A;  3LSR A;  1W0U A;  3RF2 A;  4LG0 B;  3EH8 A;  3GIJ A;  1SMY F;  2VJ4 A;  3RQI A;  1N48 A;  1W5T A;  1L0O C;  3H9J A;  4A6D A;  3LQR A;  3ESW B;  1LNW A;  4RAY A;  3JR9 A;  1TBX A;  5F1R A;  4O5V A;  2CS3 A;  4YBZ B;  3WU2 C;  3K4J A;  4E7H A;  4DBQ A;  2HXI A;  1QHG A;  5M5Y J;  2R4G A;  3IUO A;  3I4N J;  2ISY A;  2YU3 A;  4CCJ A;  2H6C A;  4ETS A;  1JUS A;  2XAG A;  4F55 A;  4U7D A;  2CQX A;  3EPZ A;  3KP5 A;  3WE2 A;  1G59 A;  3EET A;  4QIW E;  1QO0 D;  4NDL A;  5E5S A;  2CW0 F;  3TMO A;  3H4D A;  2DN0 A;  2OZ6 A;  3LWB A;  1ZYR F;  4ZTJ A;  4B3S H;  3I59 A;  3OYA A;  2KIQ A;  4IHX A;  4LLL A;  3MZH A;  1YRN B;  2RVC A;  4XYL B;  2AO9 A;  3TP3 A;  1Z3X A;  4A12 A;  5D1O A;  4CYC B;  1Q1V A;  4HOB A;  3L1P A;  1P7J A;  5C3E J;  1MMD A;  4I4T F;  4BEH A;  2OV7 A;  2QQA A;  1HBX G;  3HOV J;  1MMS A;  1WH5 A;  3A02 A;  4A3E J;  3LST A;  2OTL I;  1UMQ A;  2VS8 A;  1YG2 A;  2F6C A;  2K02 A;  4PDB A;  5H20 A;  2VA2 A;  3F6O A;  2FX0 A;  1PVE A;  3IKV A;  3W6V A;  3QYB A;  2Y48 A;  1Z2P X;  4AQU A;  5J3L A;  3KZY A;  4KYW A;  3P5J A;  3W6J B;  3PFI A;  5FLV A;  1R4M B;  3M3Y J;  3N8D A;  1GLN A;  2BEO A;  2VR1 A;  1B72 B;  1LPQ A;  2BQ3 A;  1YE9 A;  3GIK A;  2LCJ A;  3KLO A;  4HRI A;  4Q44 A;  4Q8F A;  3RJP A;  1VND A;  1FTT A;  2V6E A;  2ADU A;  1MGT A;  5GAH J;  1J59 A;  4RLF A;  5CA1 F;  4YII A;  5E17 F;  1GLV A;  1I6U A;  5AON A;  3LSJ A;  1XMO H;  3JW4 A;  3MR5 A;  1R1T A;  3SE7 A;  3G4S I;  2R7O A;  2MC3 A;  4M71 A;  3MAJ A;  5E20 A;  1KZH A;  4YB8 B;  5J8F A;  2VOP A;  2LQM A;  2JEG A;  4OX9 H;  4G6D A;  2QLZ A;  4MHG A;  1JT0 A;  1HLV A;  2V79 A;  1UHM A;  1WJC A;  2XAF A;  5CVV A;  3WTZ A;  3FMS A;  2XHK A;  1FZP B;  2EV0 A;  1LFB A;  4HA8 A;  3OSF A;  3VEP A;  2PN6 A;  4RGR A;  2PFB A;  4IRC A;  2IA6 A;  4BGD A;  5E3N A;  2RV8 A;  3EDP A;  4A3G G;  4I09 A;  5TGT A;  3S14 J;  4DIQ A;  3MIS A;  3RB0 A;  4ZOL F;  2DLN A;  3E6D A;  2DPJ A;  4OMZ A;  2JA8 J;  1C30 A;  5DEQ A;  3FKJ A;  1USS A;  4AYB N;  1DIK A;  1JTX A;  1T6S A;  5K7Z A;  1TC3 C;  5KFX A;  2E1M C;  3N41 B;  2HDC A;  3EUH C;  4BY1 J;  2DOA A;  4XLA A;  1Q1H A;  2KL4 A;  1E3O C;  4XLN F;  5BPF A;  1UHW A;  3FIS A;  1O57 A;  4U0V A;  1EH8 A;  4PFO A;  2LY1 A;  4P55 A;  3K9T A;  2EBI A;  1R1U A;  1HST A;  1I5Z A;  1ZGJ A;  3OYB A;  2VBL A;  2GLT A;  2LF7 A;  4UFZ A;  3IWF A;  2VXD A;  1VQP I;  2ISZ A;  1Z7U A;  1FTZ A;  5LXT F;  3HUG A;  2X48 A;  4KJZ A;  4B3X A;  5HLT A;  5AKF A;  1PK8 A;  3FF5 A;  3V7R A;  4BJ6 C;  2KRF A;  4J19 A;  2P7V B;  1VQK I;  1GXP A;  4ECX A;  1FOY A;  5KFB A;  3ZMS A;  5K7H A;  1AA7 A;  5DTD A;  1D1C A;  2TCT A;  1T36 A;  1PYV A;  4O3M A;  3QOE A;  1R71 A;  4ZQI A;  2Y0S E;  2HQN A;  1AUV A;  2LNB A;  4U87 A;  1CQI B;  1SCU B;  4FS1 A;  5E8G A;  4PK4 A;  3C2B A;  4KMF A;  2AXT C;  2ZXJ A;  4AC0 A;  3R0J A;  4XR6 A;  3TQN A;  3SYT A;  4AIJ A;  4GC7 A;  3P7N A;  2OF7 A;  3M7G A;  1A6I A;  4CIC A;  3I4M J;  3I4P A;  1PJR A;  2DPI A;  1SVO A;  5ICC A;  3K1M A;  4OIO F;  3CME I;  3F8M A;  2MBF A;  2E2I A;  2OUM A;  3FWE A;  1IDZ A;  2VBO B;  3BQ2 A;  2OTJ I;  1WQ2 A;  3E54 A;  4FT8 A;  2ESN A;  3FMQ A;  1C0W A;  3GVA A;  3TW6 A;  5KG5 A;  1DUX C;  3GZ5 A;  4HQE A;  2LY9 A;  2E35 A;  1XB4 A;  1JVA A;  3R23 A;  3RFC A;  4DL4 A;  4QJF A;  3M4I A;  3W3C A;  5KX5 F;  3MR6 A;  1P4X A;  4B48 A;  1FKA H;  3EPI A;  1S6L A;  3H35 A;  4BHP A;  3Q8P B;  2BY2 A;  3I55 I;  3F22 A;  1AT0 A;  3BJ6 A;  1JLL B;  5KFW A;  3OYE A;  2QVO A;  1DQU A;  4KIB A;  4HZF A;  4YIS A;  2I5U A;  2XV4 S;  2ATL A;  2O7O A;  2VUM A;  4MGR A;  1G3S A;  2DDA A;  3HYI A;  5DV5 A;  1BIB A;  1ZAO A;  3L2U A;  1R9T J;  2PMZ E;  3QWL A;  5KFD A;  1MSF C;  3RYP A;  4EJW A;  1VS0 A;  2FLL A;  3WNZ A;  5KAF C;  3BA9 A;  3H0G G;  3FXU A;  3F21 A;  2DPD A;  3LOC A;  4EEQ A;  1RET A;  3MJF A;  1JDB B;  4GKK H;  3NZM A;  1MDM A;  4PGG A;  5D5X B;  2JRT A;  5FPO A;  4CCN A;  1ZG3 A;  2E34 A;  1TWF J;  3ISP A;  2VBZ A;  2W9C A;  4WXC A;  1LVA A;  3I59 B;  3BR2 A;  4KL6 A;  5IP6 A;  1OJL A;  1QU3 A;  5IP7 J;  3PL8 A;  3OR1 C;  4M6V A;  5D1O B;  4YIR X;  3GFM A;  4D7N A;  3PUF A;  1VQ5 I;  2PI0 A;  4UNO A;  3KHG A;  4BEH B;  2Z99 A;  4R8U B;  5CVJ A;  2R8J A;  3NRV A;  4X66 H;  1V5E A;  3DPT A;  4RZQ A;  4AQY H;  4DYC A;  1A6Q A;  4KNY A;  2Z16 A;  3GCM A;  4TUY F;  5EWE A;  5E67 A;  3TW7 A;  1HDD C;  2UXX A;  4G7O F;  3KXY T;  5C44 J;  4AM3 A;  4M3D A;  5L1K A;  4CUG A;  1Z21 A;  2FK2 A;  2RNJ A;  3T5J A;  2UXN A;  3CO6 C;  1X1P A;  1I94 H;  1XDN A;  3MZY A;  3RPU D;  3GII A;  2W7P A;  1N56 A;  1VQ4 I;  4ZYG A;  4UT0 A;  2DZD A;  2C22 A;  2HNH A;  2R5Y A;  4A93 G;  1GDT A;  4IOC F;  1T9I A;  4FBT A;  3IH4 A;  4BJT A;  3RGX A;  5A72 A;  2KIS A;  2RGR A;  3BTI A;  3RJ0 A;  1BBY A;  2O5R A;  4XN0 A;  4JX4 A;  1VQ8 I;  3RTR A;  2JA6 A;  1S9H A;  4ECS A;  3OIQ A;  3IRR A;  4LK1 F;  4M3F A;  3PN1 A;  3NAU A;  1S7O A;  2M0M A;  1HW2 A;  3MZ8 A;  2R92 J;  3W2A A;  5KG7 A;  3V8J A;  1O7L A;  2ME0 A;  3JTH A;  2PJR A;  3OUU A;  2JMW A;  2ZXI A;  3HYJ A;  3VPC A;  1R58 A;  1QVU A;  2UV1 A;  2L4A A;  1J9I A;  2J6T A;  5KFO A;  1Y0N A;  2E36 A;  3VFZ A;  1S7E A;  1KQ9 A;  3BZ6 A;  2DT7 B;  1R1V A;  4AIK A;  3ZN1 A;  3MIP A;  2IN0 A;  2D1V A;  1PP7 U;  4UCV A;  4AUX A;  1WSU A;  3K4B A;  3GX4 X;  2ZO4 A;  1UC9 A;  2DYS H;  1V9P A;  2PBI A;  3I71 A;  3NWS A;  4KZS A;  2OPT A;  4BL0 B;  4CCM A;  3OYM A;  3KP7 A;  2YS6 A;  2PBZ A;  3RSN A;  2VT3 A;  3BCA A;  3BAA A;  1MKM A;  3OOU A;  2M7B A;  2R7Q A;  3F8C A;  4BHC A;  3CCU I;  1DGW Y;  1Y8Q B;  3EUA A;  5ILU A;  3L2W A;  3Q8R B;  2W8L A;  4AVZ A;  2OU2 A;  4MAM A;  3HBL A;  2XGD A;  4OIR F;  1QZY A;  5ILV A;  2ZNZ A;  4UUV A;  2O8K A;  1CS0 A;  3K5I A;  3VB2 A;  5J47 A;  3ULQ B;  2M5W A;  4DV2 H;  3N43 B;  1HNZ H;  2CUJ A;  2VBL B;  3JRG A;  5D5W B;  2DA7 A;  2DMP A;  2WV1 A;  3KYL A;  5EZY F;  4B3T H;  4IL6 C;  5E18 F;  4C9Y A;  3GFJ A;  3HUG B;  2IP4 A;  5JI6 A;  3BQY A;  1BP7 A;  2LY2 A;  3RTX A;  2YRX A;  1LEA A;  3LSK A;  1FSH A;  2ID6 A;  3M1C A;  3DKW A;  5FD6 A;  1IF1 A;  5IP9 G;  3J80 K;  1EH7 A;  4XRM A;  1BOA A;  4ZYH A;  5LFA A;  3OIO A;  4ZYA A;  2CW8 A;  1U9O A;  3QPH A;  3K4K A;  3D1N I;  2IGK A;  3CCJ I;  3IRQ A;  1OLT A;  2LP0 A;  3S2D J;  2P0A A;  2DK8 A;  4B43 A;  4AYB A;  2V1X A;  4AWX B;  1D5Y A;  4A69 C;  2M8G X;  5E3M A;  1T94 A;  3GTP J;  3U9G A;  4KDP A;  2COB A;  5DUK A;  1PUF A;  1QZZ A;  2C6Y A;  2ZME A;  3SEQ A;  3T0Y A;  1L2Z A;  3PO3 J;  1WJF A;  3JRD A;  2E7X A;  4RGU A;  4J9L A;  4E7Z A;  3HOW G;  2W9A A;  1YW8 A;  5KCM A;  2K9Q A;  1KGS A;  4JI1 H;  5L1J A; 
#chains in the Genus database with same CATH homology
 3OTO H;  4LIU A;  4C2U A;  4EFJ A;  1E4F T;  2P0W A;  4ZDL A;  5LMN H;  5A2Q W;  3L2R A;  3D5S C;  3LSG A;  4Y3O A;  4CCO A;  3DTI A;  3A2K A;  2FE3 A;  4NC7 A;  2RGV A;  1HA8 A;  1S68 A;  2RNG A;  1S03 G;  1T9J A;  4XOT A;  4UCU A;  1YX5 A;  1XNR H;  3K4M A;  2VBN B;  2WY7 Q;  2Q2U A;  2JA2 A;  5HNF A;  2QOJ Z;  3OMY A;  4BE0 A;  3OYL A;  4AAD A;  3K6G A;  1MOW A;  1IRX A;  1WFX A;  2L2O A;  2KLO A;  3CZ6 A;  2VLA A;  1N36 H;  4BQN A;  4YY3 H;  3IFJ A;  4JOM A;  2DCH X;  2HVR A;  4ZJZ A;  4B3R H;  2W57 A;  3CP2 A;  2UXB H;  3PNY A;  2XC7 A;  4Z1Z A;  1T95 A;  2DJI A;  5CPR B;  5AKN A;  4DUZ H;  1HR0 H;  2R7T A;  4DV0 H;  3UR3 C;  2AB5 A;  2RRE A;  3ZQQ A;  3OYI A;  2E1M B;  5E63 A;  1Z3Y A;  4LIV A;  3PNV A;  4E7K A;  2OC6 A;  2V26 A;  4HPQ A;  4HNU A;  4F92 B;  4LSA A;  4J01 A;  3FHN A;  4EAT A;  4LFC H;  2GOM A;  4NXM H;  2Z2S B;  2XF5 A;  3PFY A;  1FMV A;  1UG0 A;  2Z1D A;  3CMM A;  2E5N A;  2X6W A;  4LF5 H;  4BQQ A;  4JYA H;  2KP6 A;  4YEJ A;  4BAC A;  4ITV A;  4RM3 A;  4XN3 A;  4D9J A;  4A2A A;  1UAA A;  4JI6 H;  2FUG 2;  1G9Z A;  1O75 A;  3EYY A;  2BVM A;  2M7A A;  3S3O A;  5BR8 H;  4OZ6 A;  3OWT A;  2M4G A;  3SZG A;  5KHD A;  2MC4 A;  4YIT A;  3HKZ A;  4HG2 A;  3FD2 A;  1K6Y A;  1Y6I A;  1MMN A;  5AKM A;  4YHX A;  3K4C A;  1EF0 A;  1R7M A;  2LWY A;  2VQL A;  3C0X A;  4MV7 A;  2UXC H;  1WJA A;  3PUB A;  4IKF A;  2VJJ A;  2WY8 Q;  2F5V A;  4UNB A;  3J7A K;  4PJL A;  3S93 A;  3KAL A;  4LH6 A;  2X1C A;  3VSL A;  3H20 A;  2EX5 A;  5IT9 W;  4KIT B;  2UXD H;  5HNH A;  4BE2 A;  2WYO A;  2KQR A;  3U21 A;  2R7S A;  4UN9 G;  4DR5 H;  4DR7 H;  1SAU A;  4Z1X A;  1G9Y A;  2CMP A;  4DV7 H;  4JI7 H;  4K0K H;  3LSI A;  2IS1 A;  2HQA A;  4KL5 A;  2K3P A;  1EA3 A;  1WJB A;  4OAZ A;  3ZR8 X;  4IX7 A;  2LBF B;  4DGW B;  2WAE A;  5E5O A;  1SEI A;  4LF7 H;  3MKW B;  1BGW A;  2LH9 A;  2UUA H;  4NC8 A;  3ZCO A;  3OOR A;  3RIZ A;  3QYE A;  4BQO A;  1MMG A;  2L7K A;  4DUY H;  1W36 C;  2ZSH B;  4BDZ A;  4ZTF A;  2VBJ B;  4E7L A;  4UCS A;  5CQG A;  4F91 B;  1MI8 A;  2VKD A;  1B04 A;  5CQE A;  2IS6 A;  4RM2 A;  3BLY A;  4X65 H;  3MXB A;  4UCO A;  4CC5 A;  4DJA A;  2IS4 A;  2KMU A;  3H5N A;  1WJE A;  3OYC A;  2IXS A;  4KIS A;  4UN7 A;  4Z20 A;  2PJR B;  3DTE A;  1YX3 A;  4RMN A;  2DXI A;  1N34 H;  3VDX A;  2V4J C;  4XMY A;  2UWM A;  5A0M B;  2WDT A;  3OOL A;  1P8L A;  3RGZ A;  3C2H A;  1IBM H;  2HDW A;  4OWR B;  4XLH A;  4KHP H;  1N33 H;  2VL8 A;  1X19 A;  2MAB A;  4II2 A;  2XAU A;  1N75 A;  3OYF A;  3CF2 A;  2XE0 B;  1AN7 A;  3H0D A;  3FDY A;  5FRO A;  3R7P A;  2IN9 A;  2CUZ A;  3SEZ A;  3DWL E;  4E4H A;  2ZJT A;  3W2V A;  3VSK A;  2WAD A;  3RQ4 A;  4E6K G;  4UCT A;  4DOZ A;  2HGS A;  1Y56 A;  2VBO A;  4B3M H;  2IGM A;  1DGR M;  2VQH A;  1DFA A;  4X62 H;  1X1C A;  4DR1 H;  4JI2 H;  3H5R A;  2VPS A;  4BJ5 C;  1TT0 A;  2UU9 H;  1U0J A;  3PNT A;  4XLC A;  4E7J A;  3K4N A;  1GYF A;  3IAS 2;  3I9V 2;  4DV1 H;  1IBK H;  1GPP A;  3F9K A;  3MXA A;  2W82 A;  1X9N A;  2X1D A;  3MMY B;  4BU2 A;  4RAZ A;  3K70 D;  1A0I A;  4LF4 H;  4J00 A;  2VKH A;  1FMW A;  2MYS A;  1M0W A;  3RF2 A;  3LML A;  4GKJ H;  2Q1Z B;  4ANJ A;  3EH8 A;  2IGN A;  2VJ4 A;  3KX2 A;  2I3P A;  3H9J A;  1D0X A;  1MMA A;  4XL9 A;  3DKY A;  4NQW B;  1VDE A;  4RAY A;  3E0J B;  1D1A A;  4JQF A;  2A5W A;  4OAY A;  4D1Q A;  5I0A A;  2VPL A;  4U7B A;  2CS3 A;  2MD0 A;  5A78 A;  4RB3 C;  2V7F A;  3K4J A;  4E7H A;  4DBQ A;  1QHG A;  2R4G A;  3IUO A;  3VYR B;  2BVL A;  1IBL H;  4AAG A;  4XOR A;  4CCJ A;  1ZDE A;  1E4G T;  4ETS A;  4F55 A;  1KON A;  1WJ5 A;  2A6T A;  3E1S A;  4E7I A;  2K9M A;  1WH2 A;  3EPZ A;  3GBG A;  4RB1 A;  1G59 A;  2CW7 A;  5A74 A;  4JV5 H;  3C2G A;  2ZXH A;  4C30 A;  5E5S A;  4JI0 H;  4DV6 H;  3BG6 A;  3OYH A;  3TMO A;  1M0T A;  3DTK A;  4ZTJ A;  4B3S H;  3OL3 A;  3HPH A;  3OYA A;  4HNT A;  2XIG A;  3AKZ A;  3J81 W;  4DV3 H;  1Z3X A;  1DP3 A;  1AM2 A;  4UN7 G;  5D1O A;  2IGO A;  2WBM A;  3OR2 C;  4IZZ A;  4QPQ A;  2KSW A;  4D6N A;  5HOO A;  1MMD A;  4HSR A;  4BEH A;  2K9L A;  4FM9 A;  2OV7 A;  4RLQ A;  3J80 W;  4UCR A;  4XKW A;  2VS8 A;  3L4J A;  1B24 A;  4QPO A;  1D0Y A;  4CZC A;  2F6C A;  4PDB A;  3ZGK A;  3BC8 A;  2IN8 A;  1ZHQ A;  3MKY B;  2KEQ A;  3DQV C;  5LL6 b;  3QYB A;  1Z2P X;  4AQU A;  2MCT A;  2KRH A;  4P5O A;  3W2W A;  4UNC A;  3D5L A;  3VYT B;  4XLE A;  4LQ0 A;  5FLX W;  4H4K C;  1GLN A;  1SFK A;  3L2V A;  3VWB A;  1ERD A;  3KAK A;  3FMA A;  2KDO A;  2KRC A;  5EOY A;  3N44 B;  2VQF H;  4C2T A;  1XNQ H;  1YE9 A;  4ZC3 A;  2LCJ A;  4HRI A;  4PJJ A;  2DT6 A;  4YEL A;  4YRV A;  4LF6 H;  2V6E A;  3IG0 A;  2ZSI B;  4RLF A;  3BA8 A;  3KAJ A;  2JNQ A;  4UN8 A;  1I6U A;  1Z2O X;  1XMO H;  4E2T A;  1LDK B;  1M5X A;  1N32 H;  4M7E A;  3DPU A;  3DU5 A;  4P1W A;  3K10 A;  2R7O A;  2IS2 A;  2HHH H;  2MFZ A;  3OS0 A;  2JVH A;  3DKX A;  5FRM A;  2VQG A;  3LMM A;  4E7S A;  2LQM A;  1N3F A;  2R7X A;  1N77 A;  2IMZ A;  4EFB A;  2RQQ A;  4OX9 H;  4HEA 2;  3AFH A;  1WJC A;  5A77 A;  2L8L A;  2ZFU A;  1BJT A;  2VXZ A;  2E5L H;  4JI5 H;  4N4N B;  4YHH H;  2W1O A;  4BGD A;  4N4O B;  5TGT A;  4DIQ A;  3MIS A;  1LWS A;  2R7R A;  3KO2 A;  3K3V A;  4MLO A;  3OYN A;  2LG4 A;  3FKJ A;  4LG3 A;  2WA0 A;  1NG7 A;  3HG9 A;  3OYK A;  2E1M C;  3N41 B;  4EFE A;  3MWM A;  1UEL B;  3EUH C;  2DOA A;  2UUC H;  4XLA A;  2KL4 A;  1J5E H;  4LSX A;  1LWT A;  5FD5 A;  3T1Y H;  1TAE A;  4Y33 A;  4PFO A;  2LY1 A;  2WAF A;  3OIP A;  1DGS A;  3CP8 A;  3I3L A;  3OYB A;  2VBL A;  4UFZ A;  4LOX A;  4JI3 H;  4AAE A;  2VXD A;  4XQF A;  3J7A Y;  3L4K A;  4KJZ A;  4B3X A;  1LVK A;  2VIX A;  1X4P A;  5HLT A;  2R7W A;  4IQ4 A;  5AKF A;  2LC2 A;  1X1A A;  4BJ6 C;  2LOO A;  4LFA H;  2QKM B;  4RB0 A;  1FJG H;  3ZXS A;  2HVQ A;  3LSM A;  3VYU B;  2XF6 A;  3VYS B;  4IQJ A;  3MXB B;  2VQE H;  1AA7 A;  1D1C A;  4JI8 H;  3DU6 A;  4CCL A;  1PYV A;  2L9S A;  2JUG A;  1X1D A;  2F4V H;  4Y4R A;  2BW3 A;  3QOE A;  3LL7 A;  4R7R A;  1D0Z A;  4U87 A;  1TZL A;  4PK4 A;  2W00 A;  1MZB A;  4BDY A;  4JI1 H;  4UN8 G;  4XR6 A;  3SYT A;  2UUZ A;  4LFB H;  4AAF A;  3BCB A;  4XKV A;  2X6X A;  1TA8 A;  1QHH D;  4PFP A;  3ZRG A;  1XMQ H;  2LRE A;  3IP4 B;  2VS7 A;  1PJR A;  1Z7L A;  2HPI A;  3OYG A;  2CV1 A;  1UM2 A;  4DBR A;  1BR4 A;  2CH0 A;  3UNG C;  1LFP A;  1D1B A;  2OUM A;  2WAQ A;  4G6T B;  4CA0 A;  1N78 A;  2VBO B;  1DQ3 A;  2KZV A;  2VBN A;  3N42 B;  4PJM A;  3E54 A;  3K70 C;  4J0M A;  2BW3 B;  4BXF A;  3JAM W;  2M4K A;  4DR6 H;  3TBI A;  1JVA A;  5A0W A;  2R7U A;  4B47 A;  4MTD A;  4PJN A;  4XLF A;  4MTE A;  3M4I A;  3W3C A;  1FVI A;  1FKA H;  1G8X A;  3DLA A;  4B48 A;  2XF7 A;  3CJQ B;  4FAS D;  3PSF A;  3H35 A;  2V1N A;  3V42 A;  4UN9 A;  3OYJ A;  2Q2T A;  1AT0 A;  4LIT A;  3ONQ A;  3OYE A;  4BWS C;  3HXL A;  1DQU A;  1V5F A;  2HU9 A;  3LSH A;  1ZHS A;  4YIS A;  4LH7 A;  3HYI A;  1OR7 C;  1X4O A;  3L2U A;  1SYX B;  2VB6 A;  4B44 A;  3DPL C;  1MW7 A;  3HOT A;  1LKX A;  1VS0 A;  5JHF A;  4UNA A;  4GRI A;  4AQX A;  3BA9 A;  3IAM 2;  3HL2 A;  4EEQ A;  4CSW A;  3CVZ A;  4GKK H;  3NZM A;  4BS9 A;  4NUB A;  4RB2 C;  3KEY A;  3F8N A;  5FPO A;  4CCN A;  3CES A;  4XKC A;  2E60 A;  3FBN B;  1ZEL A;  3QOD A;  1T9I A;  5K08 A;  2I3Q A;  1T0F C;  4LF8 H;  2VUG A;  4GLX A;  3H5A A;  3DF7 A;  3AL0 B;  3OL4 A;  2ZM6 H;  4KL6 A;  1QU3 A;  1V5G A;  4DR3 H;  2XSJ C;  4I7H A;  3PL8 A;  3OR1 C;  4KT6 A;  5D1P A;  2CV2 A;  3S32 A;  1BR2 A;  4FET A;  4R79 A;  5D1O B;  4GIG A;  2VQC A;  4BUP A;  4NXN H;  3QQY A;  2VAS A;  2K5C A;  4BEH B;  1P9Q C;  2Y0S A;  3S3M A;  3N6X A;  4CH7 A;  3PJR A;  4X66 H;  1V5E A;  1X1B A;  3DPT A;  3DEE A;  1Z2N X;  2YCH A;  4RZQ A;  4AU7 A;  2JSP A;  4HST A;  3OS1 A;  4AQY H;  3M8J A;  1HNX H;  2Z16 A;  1N3E A;  1ZD7 A;  4O1R A;  5E67 A;  3KXY T;  4LMY A;  1NG6 A;  4CUG A;  1Z21 A;  2LBF A;  3MD2 A;  4II3 A;  4NNJ A;  3MKZ A;  1I94 H;  3HC7 A;  2JMZ A;  4O1S A;  2LYC A;  4F3Q A;  1XDN A;  5LMU H;  2F4I A;  3RPU D;  2X1E A;  3A4C A;  1J09 A;  2UUB H;  4UT0 A;  2W7N A;  4AAB A;  2HNH A;  2CV0 A;  2VBJ A;  4X0G A;  3N40 P;  4BJT A;  3RGX A;  3RCO A;  5A72 A;  3H9G A;  4DR4 H;  2X85 A;  2VJI A;  1AF5 A;  4PUS A;  2RGR A;  3RJ0 A;  2O5R A;  2VJ5 A;  4XN0 A;  3RTR A;  1S9H A;  2LRD A;  3OY9 A;  4E2U A;  2FLD A;  3OIQ A;  4F52 A;  2HPM A;  3PN1 A;  4A2B A;  1W36 D;  4F93 B;  2M0M A;  3EUK L;  2W4S A;  1BR1 A;  2X6Y A;  3W2A A;  3BG7 A;  2KPM A;  2PJR A;  2AQF A;  1MNE A;  4XON A;  2ZXI A;  5KNL A;  5A0M A;  3HYJ A;  2XDV A;  2UV1 A;  4XNF A;  2X51 A;  5CKT A;  2JVG A;  3L2Q A;  3H9Q A;  2PMZ A;  2DT7 B;  3C0W A;  2XE0 A;  2M3A A;  2IN0 A;  3MIP A;  2L5Q A;  2QKL B;  4UCV A;  3K4B A;  2O7M A;  2E5Z A;  1V9P A;  2OWO A;  3NWS A;  2HZD A;  4BL0 B;  4CCM A;  3OS2 A;  3OYM A;  3AL0 C;  4PSW A;  3RSN A;  3BCA A;  5HVQ C;  1E0E A;  3PSI A;  3OOU A;  2GOX B;  3N05 A;  2M7B A;  4XOP A;  2R7Q A;  2HVS A;  3LFU A;  3BAA A;  1DGW Y;  3EUA A;  3L2W A;  2Q2E B;  2DCE A;  5AK9 A;  4AVZ A;  3K4L A;  3HPG A;  4D6O A;  3MX9 A;  1P8K Z;  4IAJ A;  3OYD A;  1BOB A;  2CFO A;  2O03 A;  5LD2 C;  4DV2 H;  3N43 B;  4DV4 H;  1HNZ H;  2CUJ A;  3FBI B;  3G2B A;  2VBL B;  1JI8 A;  4B3T H;  1U0C A;  2WB1 A;  3KYL A;  5IWA H;  3S8P A;  4C9Y A;  2V9K A;  3HUG B;  1BP7 A;  3IGD A;  2LY2 A;  3RTX A;  5FRN A;  2I8D A;  3LSK A;  2ELJ A;  4PSX A;  3JSL A;  3JSN A;  3S3N A;  3UQ8 A;  4DR2 H;  2VOB A;  3QYF A;  3M1C A;  5FD6 A;  1HNW H;  2BOL A;  3NWT A;  5FPR A;  2R7V A;  3C0F B;  1R6R A;  3HOS A;  4MV9 A;  5LFA A;  4JI4 H;  4ZYA A;  4DV5 H;  2CW8 A;  4Q0Y A;  2KHM A;  3K4K A;  1MND A;  2IGK A;  3T1H H;  1OLT A;  3A1Y A;  1WJD A;  4B43 A;  4AYB A;  2L9N A;  3CJR B;  4XKB A;  3UVF A;  3BAB A;  1U0D A;  4BE1 A;  2WE6 A;  4CC6 A;  2NOJ B;  4APM A;  3SEQ A;  1L2Z A;  4XM3 A;  4ZDP A;  1WJF A;  3D5R C;  1VZ0 A;  3TL4 X;  4E7Z A;  4ZDO A;  3L2P A;  5KCM A;  4X64 H;  2AQE A;  3SDB A;  4CCK A;  4LF9 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...