The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
28
|
sequence length |
85
|
structure length |
85
|
Chain Sequence |
ESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLHTKGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQFLPEAKR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Role of Structural and Dynamical Plasticity in Sin3: The Free PAH2 Domain is a Folded Module in mSin3B
pubmed doi rcsb |
| molecule keywords |
Paired amphipathic helix protein Sin3b
|
| molecule tags |
Transcription repressor
|
| source organism |
Mus musculus
|
| total genus |
28
|
| structure length |
85
|
| sequence length |
85
|
| ec nomenclature | |
| pdb deposition date | 2005-11-11 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02671 | PAH | Paired amphipathic helix repeat |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | Paired amphipathic helix 2 (pah2 repeat) | Paired amphipathic helix |
#chains in the Genus database with same CATH superfamily 2CR7 A; 1S5R B; 2L9S B; 1E91 A; 1S5Q B; 2F05 A; 2RMS A; 2RMR A; 2CZY A; 1PD7 A; 1G1E B; 2LD7 B; #chains in the Genus database with same CATH topology 4YL6 A; 2F05 A; 4YKC A; 2RMR A; 2KBQ A; 5F3X A; 1G1E B; 2L9S B; 4YKD A; 1E91 A; 3K1R A; 2LD7 B; 4FQN A; 1S5R B; 1S5Q B; 2RMS A; 2CZY A; 1PD7 A; 4Y5O A; 2CR7 A; 2LSR A; 2KBR A; #chains in the Genus database with same CATH homology 2CR7 A; 1S5R B; 2L9S B; 1E91 A; 1S5Q B; 2F05 A; 2RMS A; 2RMR A; 2CZY A; 1PD7 A; 1G1E B; 2LD7 B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
