The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
26
|
sequence length |
94
|
structure length |
94
|
Chain Sequence |
SNASLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Transcription
|
source organism |
Homo sapiens
|
publication title |
Solution Structure of the mSin3A PAH2-Pf1 SID1 Complex: A Mad1/Mxd1-Like Interaction Disrupted by MRG15 in the Rpd3S/Sin3S Complex.
pubmed doi rcsb |
molecule keywords |
PHD finger protein 12
|
total genus |
26
|
structure length |
94
|
sequence length |
94
|
ec nomenclature | |
pdb deposition date | 2011-02-23 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
B | PF02671 | PAH | Paired amphipathic helix repeat |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | Paired amphipathic helix 2 (pah2 repeat) | Paired amphipathic helix |
#chains in the Genus database with same CATH superfamily 2RMR A; 1PD7 A; 1G1E B; 2LD7 B; 1E91 A; 2CR7 A; 2F05 A; 1S5R B; 2CZY A; 2L9S B; 2RMS A; 1S5Q B; #chains in the Genus database with same CATH topology 2LSR A; 4FQN A; 2CR7 A; 1G1E B; 2RMS A; 4Y5O A; 4YL6 A; 1S5R B; 2CZY A; 4YKD A; 2L9S B; 1S5Q B; 2RMR A; 2KBR A; 4YKC A; 2LD7 B; 1E91 A; 2F05 A; 2KBQ A; 1PD7 A; 5F3X A; 3K1R A; #chains in the Genus database with same CATH homology 2RMR A; 1PD7 A; 1G1E B; 2LD7 B; 1E91 A; 2CR7 A; 2F05 A; 1S5R B; 2CZY A; 2L9S B; 2RMS A; 1S5Q B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...