The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
24
|
sequence length |
77
|
structure length |
77
|
Chain Sequence |
AIDLCGMSQDELNECKPAVSKENPTSPSQPCCTALQHADFACLCGYKNSPWLGSFGVDPELASALPKQCGLANAPTC
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Signaling protein, lipid transport
|
source organism |
Arabidopsis thaliana
|
publication title |
The structure of "defective in induced resistance" protein of Arabidopsis thaliana, DIR1, reveals a new type of lipid transfer protein.
pubmed doi rcsb |
molecule keywords |
DIR1 protein
|
total genus |
24
|
structure length |
77
|
sequence length |
77
|
ec nomenclature | |
pdb deposition date | 2007-10-17 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Hydrophobic Seed Protein | Plant lipid-transfer and hydrophobic proteins |
#chains in the Genus database with same CATH superfamily 1MZL A; 2B5S A; 1RZL A; 1PSY A; 1FK1 A; 4XUW A; 1W2Q A; 2RKN A; 2DS2 B; 1FK6 A; 1BV2 A; 1FK5 A; 1PNB B; 1JTB A; 1FK2 A; 1FK3 A; 1MZM A; 1FK7 A; 1GH1 A; 1FK0 A; 1UVC A; 1TUK A; 3GSH A; 1N89 A; 2ALG A; 2N81 A; 1CZ2 A; 1T12 A; 1BIP A; 1FK4 A; 1BFA A; 1UVB A; 2LVF A; 1HSS A; 1SM7 A; 1AFH A; 1MID A; 5DOM A; 1LIP A; 1L6H A; 2N2Z A; 1B1U A; 1HYP A; 1S6D A; 1BEA A; 1BE2 A; 1SIY A; 1TMQ B; 1BWO A; 2MAL A; 4CVW C; 1UVA A; #chains in the Genus database with same CATH topology 1MZL A; 2B5S A; 1RZL A; 1PSY A; 1FK1 A; 4XUW A; 1W2Q A; 2RKN A; 2DS2 B; 1MIY A; 2VKZ G; 1FK6 A; 2UV8 G; 1MIW A; 1BV2 A; 1FK5 A; 1PNB B; 3H37 A; 1FK2 A; 1FK3 A; 1MZM A; 1JTB A; 1FK7 A; 3HMJ G; 1GH1 A; 1FK0 A; 1UVC A; 1TUK A; 3GSH A; 1N89 A; 2ALG A; 2N81 A; 1CZ2 A; 1T12 A; 1BIP A; 1FK4 A; 1BFA A; 1UVB A; 2LVF A; 1HSS A; 1SM7 A; 1AFH A; 1MID A; 3H3A A; 5DOM A; 1LIP A; 1L6H A; 2N2Z A; 1B1U A; 1HYP A; 1S6D A; 1BEA A; 1BE2 A; 1SIY A; 1TMQ B; 1MIV A; 1BWO A; 2MAL A; 4CVW C; 1UVA A; #chains in the Genus database with same CATH homology 1MZL A; 2B5S A; 1RZL A; 1PSY A; 1FK1 A; 4XUW A; 1W2Q A; 2RKN A; 2DS2 B; 1FK6 A; 1BV2 A; 1FK5 A; 1PNB B; 1JTB A; 1FK2 A; 1FK3 A; 1MZM A; 1FK7 A; 1GH1 A; 1FK0 A; 1UVC A; 1TUK A; 3GSH A; 1N89 A; 2ALG A; 2N81 A; 1CZ2 A; 1T12 A; 1BIP A; 1FK4 A; 1BFA A; 1UVB A; 2LVF A; 1HSS A; 1SM7 A; 1AFH A; 1MID A; 5DOM A; 1LIP A; 1L6H A; 2N2Z A; 1B1U A; 1HYP A; 1S6D A; 1BEA A; 1BE2 A; 1SIY A; 1TMQ B; 1BWO A; 2MAL A; 4CVW C; 1UVA A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...