The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
20
|
sequence length |
71
|
structure length |
71
|
Chain Sequence |
QRLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Conserved Themes in Target Recognition by the PAH1 and PAH2 Domains of the Sin3 Transcriptional Corepressor
pubmed doi rcsb |
| molecule keywords |
Paired amphipathic helix protein Sin3a
|
| molecule tags |
Transcription
|
| source organism |
Mus musculus
|
| total genus |
20
|
| structure length |
71
|
| sequence length |
71
|
| ec nomenclature | |
| pdb deposition date | 2007-11-14 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02671 | PAH | Paired amphipathic helix repeat |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | Paired amphipathic helix 2 (pah2 repeat) | Paired amphipathic helix |
#chains in the Genus database with same CATH superfamily 2CZY A; 1E91 A; 1G1E B; 1S5R B; 2L9S B; 1PD7 A; 2F05 A; 2LD7 B; 2RMR A; 1S5Q B; 2RMS A; 2CR7 A; #chains in the Genus database with same CATH topology 5F3X A; 1G1E B; 1S5R B; 2F05 A; 2LD7 B; 2KBR A; 2L9S B; 2KBQ A; 4YKD A; 4FQN A; 2CR7 A; 2LSR A; 4YL6 A; 3K1R A; 4YKC A; 2RMS A; 4Y5O A; 2CZY A; 1E91 A; 1PD7 A; 2RMR A; 1S5Q B; #chains in the Genus database with same CATH homology 2CZY A; 1E91 A; 1G1E B; 1S5R B; 2L9S B; 1PD7 A; 2F05 A; 2LD7 B; 2RMR A; 1S5Q B; 2RMS A; 2CR7 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...