3H4RA

Crystal structure of e. coli rece exonuclease
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
253
structure length
219
Chain Sequence
PGISKSQLDDIADTPALYLWRKNAPVDTTKTKTLDLGTAFHCRVLELEEFSNRAEEGRKIELMYQSVMALPLGQWLVESAGHAESSIYWEDPETGILCRCRPDKIIPEFHWIMDVKTTADIQRFKTAYYDYRYHVQDAFYSDGYEAQFGVQPTFVFLVASTTIECGRYPVEIFMMGEEAKLAGQQEYHRNLRTLSDCLNTDEWPAIKTLSLPRWAKEYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of E. coli RecE protein reveals a toroidal tetramer for processing double-stranded DNA breaks.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Exodeoxyribonuclease 8
total genus 62
structure length 219
sequence length 253
ec nomenclature ec 3.1.11.-:
pdb deposition date 2009-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12684 DUF3799 PDDEXK-like domain of unknown function (DUF3799)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.320.10 Alpha Beta Alpha-Beta Complex Lambda Exonuclease; Chain A Lambda Exonuclease; Chain A 3h4rA00
1AVQA 1W36B 3L0AA 3K70B 4R5QA 3U44A 4CEHA 3K93A 3H4RA 3SZ4A 3SZ5A 3U4QA 3SYYA 3SLPA 3SM4A 4CEIA 4IC1A 4CEJA 5LD2B 4WUZA
chains in the Genus database with same CATH superfamily
5A8WC 4CEHA 1E6VC 3M30C 1HBOC 1W36B 4IC1A 3M32C 3M2VC 3POTC 3K93A 3SZ4A 3M2UC 3SZ5A 1MROC 1HBNC 3SQGC 3SLPA 5A8RC 1AVQA 3M2RC 3H4RA 5A8KC 3SYYA 4CEJA 5G0RC 5LD2B 4WUZA 3L0AA 3K70B 4R5QA 3U44A 3U4QA 1HBMC 1HBUC 1E6YC 3M1VC 3SM4A 4CEIA 5A0YC
chains in the Genus database with same CATH topology
1AVQA 1W36B 3L0AA 3K70B 4R5QA 3U44A 4CEHA 3K93A 3H4RA 3SZ4A 3SZ5A 3U4QA 3SYYA 3SLPA 3SM4A 4CEIA 4IC1A 4CEJA 5LD2B 4WUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AVQ A;  1W36 B;  3L0A A;  3K70 B;  4R5Q A;  3U44 A;  4CEH A;  3K93 A;  3H4R A;  3SZ4 A;  3SZ5 A;  3U4Q A;  3SYY A;  3SLP A;  3SM4 A;  4CEI A;  4IC1 A;  4CEJ A;  5LD2 B;  4WUZ A; 
#chains in the Genus database with same CATH topology
 5A8W C;  4CEH A;  1E6V C;  3M30 C;  1HBO C;  1W36 B;  4IC1 A;  3M32 C;  3M2V C;  3POT C;  3K93 A;  3SZ4 A;  3M2U C;  3SZ5 A;  1MRO C;  1HBN C;  3SQG C;  3SLP A;  5A8R C;  1AVQ A;  3M2R C;  3H4R A;  5A8K C;  3SYY A;  4CEJ A;  5G0R C;  5LD2 B;  4WUZ A;  3L0A A;  3K70 B;  4R5Q A;  3U44 A;  3U4Q A;  1HBM C;  1HBU C;  1E6Y C;  3M1V C;  3SM4 A;  4CEI A;  5A0Y C; 
#chains in the Genus database with same CATH homology
 1AVQ A;  1W36 B;  3L0A A;  3K70 B;  4R5Q A;  3U44 A;  4CEH A;  3K93 A;  3H4R A;  3SZ4 A;  3SZ5 A;  3U4Q A;  3SYY A;  3SLP A;  3SM4 A;  4CEI A;  4IC1 A;  4CEJ A;  5LD2 B;  4WUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...