The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
58
|
sequence length |
148
|
structure length |
148
|
Chain Sequence |
MKIGIGSDHGGYNLKREIADFLKKRGYEVIDFGTHGNESVDYPDFGLKVAEAVKSGECDRGIVICGTGLGISIAANKVPGIRAAVCTNSYMARMSREHNDANILALGERVVGLDLALDIVDTWLKAEFQGGRHATRVGKIGEIEKKYS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Isomerase
|
| molecule keywords |
Ribose-5-phosphate isomerase
|
| publication title |
Crystal structure of Clostridium thermocellum ribose-5-phosphate isomerase B reveals properties critical for fast enzyme kinetics.
pubmed doi rcsb |
| source organism |
Clostridium thermocellum
|
| total genus |
58
|
| structure length |
148
|
| sequence length |
148
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
5.3.1.6: Ribose-5-phosphate isomerase. |
| pdb deposition date | 2009-05-08 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02502 | LacAB_rpiB | Ribose/Galactose Isomerase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Ribose 5-phosphate Isomerase B; Chain: A, | Sugar-phosphate isomerase, RpiB/LacA/LacB |
#chains in the Genus database with same CATH superfamily 2BES A; 4LFK A; 3K7S A; 3QD5 A; 1O1X A; 3K8C A; 3M1P A; 3K7P A; 4LFL B; 2PPW A; 3ONO A; 3S5P A; 2VVR A; 3PH4 A; 4LFN B; 4LFM A; 2VVO A; 5IFZ A; 3K7O A; 2BET A; 2VVP A; 4LFK B; 3PH3 A; 4U8E A; 2VVQ A; 4U8F A; 3SDW A; 3C5Y A; 4EM8 A; 4LFM B; 3HEE A; 4LFL A; 3HE8 A; 3SGW A; 1USL A; 4LFN A; 1NN4 A; #chains in the Genus database with same CATH topology 2BES A; 4LFK A; 3K7S A; 3QD5 A; 1O1X A; 3K8C A; 3M1P A; 3K7P A; 4LFL B; 2PPW A; 3ONO A; 3S5P A; 2VVR A; 3PH4 A; 4LFN B; 4LFM A; 2VVO A; 5IFZ A; 3K7O A; 2BET A; 2VVP A; 4LFK B; 3PH3 A; 4U8E A; 2VVQ A; 4U8F A; 3SDW A; 3C5Y A; 4EM8 A; 4LFM B; 3HEE A; 4LFL A; 3HE8 A; 3SGW A; 1USL A; 4LFN A; 1NN4 A; #chains in the Genus database with same CATH homology 2BES A; 4LFK A; 3K7S A; 3QD5 A; 1O1X A; 3K8C A; 3M1P A; 3K7P A; 4LFL B; 2PPW A; 3ONO A; 3S5P A; 2VVR A; 3PH4 A; 4LFN B; 4LFM A; 2VVO A; 5IFZ A; 3K7O A; 2BET A; 2VVP A; 4LFK B; 3PH3 A; 4U8E A; 2VVQ A; 4U8F A; 3SDW A; 3C5Y A; 4EM8 A; 4LFM B; 3HEE A; 4LFL A; 3HE8 A; 3SGW A; 1USL A; 4LFN A; 1NN4 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
