The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
60
|
sequence length |
152
|
structure length |
152
|
Chain Sequence |
MTRRVAIGTDHPAFAIHENLILYVKEAGDEFVPVYCGPKTAESVDYPDFASRVAEMVARKEVEFGVLACGSGIGMSIAANKVPGVRAALCHDHYTAAMSRIHNDANIVCVGERTTGVEVIREIIITFLQTPFSGEERHVRRIEKIRAIEASH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Isomerase
|
| molecule keywords |
Ribose 5-phosphate isomerase
|
| publication title |
Structures of type B ribose 5-phosphate isomerase from Trypanosoma cruzi shed light on the determinants of sugar specificity in the structural family.
pubmed doi rcsb |
| source organism |
Trypanosoma cruzi
|
| total genus |
60
|
| structure length |
152
|
| sequence length |
152
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature |
ec
5.3.1.6: Ribose-5-phosphate isomerase. |
| pdb deposition date | 2009-10-13 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02502 | LacAB_rpiB | Ribose/Galactose Isomerase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Ribose 5-phosphate Isomerase B; Chain: A, | Sugar-phosphate isomerase, RpiB/LacA/LacB |
#chains in the Genus database with same CATH superfamily 4LFK B; 4U8F A; 3K7O A; 4LFN B; 2BET A; 2VVQ A; 3ONO A; 3C5Y A; 4LFL A; 2VVR A; 4EM8 A; 2BES A; 3K7S A; 1USL A; 3K7P A; 4LFM B; 3PH4 A; 3HEE A; 2VVO A; 4LFL B; 1O1X A; 4LFK A; 3S5P A; 3HE8 A; 4LFN A; 3M1P A; 3SDW A; 5IFZ A; 3K8C A; 1NN4 A; 2VVP A; 3QD5 A; 3PH3 A; 3SGW A; 2PPW A; 4U8E A; 4LFM A; #chains in the Genus database with same CATH topology 4LFK B; 4U8F A; 3K7O A; 4LFN B; 2BET A; 2VVQ A; 3ONO A; 3C5Y A; 4LFL A; 2VVR A; 4EM8 A; 2BES A; 3K7S A; 1USL A; 3K7P A; 4LFM B; 3PH4 A; 3HEE A; 2VVO A; 4LFL B; 1O1X A; 4LFK A; 3S5P A; 3HE8 A; 4LFN A; 3M1P A; 3SDW A; 5IFZ A; 3K8C A; 1NN4 A; 2VVP A; 3QD5 A; 3PH3 A; 3SGW A; 2PPW A; 4U8E A; 4LFM A; #chains in the Genus database with same CATH homology 4LFK B; 4U8F A; 3K7O A; 4LFN B; 2BET A; 2VVQ A; 3ONO A; 3C5Y A; 4LFL A; 2VVR A; 4EM8 A; 2BES A; 3K7S A; 1USL A; 3K7P A; 4LFM B; 3PH4 A; 3HEE A; 2VVO A; 4LFL B; 1O1X A; 4LFK A; 3S5P A; 3HE8 A; 4LFN A; 3M1P A; 3SDW A; 5IFZ A; 3K8C A; 1NN4 A; 2VVP A; 3QD5 A; 3PH3 A; 3SGW A; 2PPW A; 4U8E A; 4LFM A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
