3RH9A

The crystal structure of oxidoreductase from marinobacter aquaeolei
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
481
structure length
481
Chain Sequence
MIESPLLENLTGYIGGRWKDSAGGATFDVYNPATGSVIAKVPSMPEEDVVAAVEAGQSALRLTNPWPIETRRKWLEDIRDGLKENREEIGRILCMEHGKPWKEAQGEVDYAAGFFDYCAKHISALDSHTIPEKPKDCTWTVHYRPVGVTGLIVPWNFPIGMIAKKLSAALAAGCPSVIKPASETPLTMIAFFSVMDKLDLPDGMVNLVMGKASVIGKVLCEHKDVPMLSFTGSTEVGRKLIVDTAEQVKKLALELGGNAPFIVFDDADLEAAADNLIANKFRGGGQTCVCANRIFVHEKVADAFGQKLAERVNKMTVGDGMNDGIDIGPLINKQGFDKVKRHLQDALDKGASLVAGKQPAELGDGLFFPPTVVQGVDREMCCYQEETFGPLVPMALFRTEEEVIDAGNDTEFGLASYVFTADAERAQRVAAGLRFGHVGWNTGTGPTPEAPFGGMKASGIGREGGLEGLFEFVEAQTVPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of oxidoreductase from Marinobacter aquaeolei
rcsb
molecule keywords Succinate-semialdehyde dehydrogenase (NAD(P)(+))
molecule tags Oxidoreductase
source organism Marinobacter aquaeolei
total genus 141
structure length 481
sequence length 481
chains with identical sequence B
ec nomenclature ec 1.2.1.16: Succinate-semialdehyde dehydrogenase (NAD(P)(+)).
pdb deposition date 2011-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00171 Aldedh Aldehyde dehydrogenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.309.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 2 Aldehyde Dehydrogenase; Chain A, domain 2 3rh9A02
3.40.605.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 1 Aldehyde Dehydrogenase; Chain A, domain 1 3rh9A01
5AC0A 4I3UA 5AC2A 1NZWA 2WMEC 3RHRA 1O02A 2ONNA 4KWFA 4MPBA 5KLLA 5L13A 4GO0A 4LH0A 1A4SA 2ESDA 3U4JA 4FR8A 4NMKA 3RH9A 4H73A 5KLKA 2QE0A 2WMEA 4X0TA 3JU8A 3V9GA 2ONOA 4NS3A 4FQFA 4I3WA 1ZUMA 3TY7A 4DNGA 2W8RA 3VZ3A 4YWUA 3SZ9A 4OUBA 5AC1A 4I1WA 4ZVWA 5KLOA 2IMPA 4GO2A 3VZ2A 4OHTA 3JZ4A 5J78A 4GNZA 4GO3A 1EUHA 1NZXA 4I2RA 4PXLA 2W8OA 2Y52A 4QETA 4I3VA 4C3SA 4WB9A 2BHQA 1O9JA 1UXTA 4OE4A 1WNBA 3RHMA 1O05A 4WP7A 4F3XA 3EK1A 4OE2A 2ID2A 4Q92A 4ZVYA 2EITA 1AD3A 3QANA 2W8PA 3R31A 5EXFA 5KF0A 4NPIA 5A2DC 2VLEA 1NZZA 3V9KA 4QYJA 3VZ0A 2W8NA 5DBVA 3V9HA 3INLA 4NEAA 5FHZA 4OE6A 2J5NA 1UXRA 3N82A 1O04A 3RHJA 1UXVA 3ETFA 4IHIA 4O5HA 4QJEA 2BJKA 4E4GA 3ROSA 4H80A 2J40A 3MY7A 2EIIA 5EEBA 1QI6A 3VZ1A 4CBBA 1UXPA 3RHLA 4ZZ7A 4LH2A 4IYMA 4X4LA 5KLMA 2EJ6A 3PQAA 2IY6A 4I8PA 3RHQA 2EHUA 4LH1A 4NMJA 4OE5A 4ZWLA 4QTOA 3I44A 4WJ9A 2EJDA 2Y5DA 4IDMA 2D4EA 4V3FC 2W8QA 3N81A 1BPWA 2J6LA 3N80A 3K9DA 1KY8A 4I8QA 4X0UA 1UXNA 4ZXUA 3RHPA 2VROA 3K2WA 3IWJA 1EZ0A 2HG2A 4IDSA 4V3FA 4YWEA 2Y53A 1AG8A 4WPNA 2ONMA 3SZBA 2EHQA 3EFVA 3RHDA 5EYUA 1BI9A 4GHKA 4NU9A 4IT9A 5EKCA 4A0MA 5A2DA 5JRYA 4X2QA 1A4ZA 4LGZA 4I26A 3N83A 4KNAA 4ITBA 2O2RA 4PXLB 4E3XA 4JBEA 4I3XA 4JZ6A 2H5GA 2BJAA 4I9BA 4PZ2A 2EJLA 4OU2A 4YWVA 1UZBA 4JDCA 5KLNA 3V9LA 4LH3A 2ONPA 4O6RA 4PXNA 5DRUA 3R64A 1UXUA 4I25A 4MPYA 4QN2A 2Y51A 4K57A 3RJLA 3IWKA 4GO4A 4QF6A 5KJ5A 5A2DD 2OPXA 3INJA 1CW3A 5F2CA 2BHPA 1BXSA 1O00A 4QJEB 4H7NA 3SZAA 1UXQA 3ZQAA 3B4WA 4L1OA 4KWGA 4QGKA 4ZVXA 3PRLA 4I3TA 5DIBA 4ITAA 1O20A 4ZUKA 3V4CA 2EIWA 1O01A 2EUHA 1WNDA 4U3WA 1QI1A 2ILUA 4L2OA 4V37A 3V9JA 2O2PA 1T90A 2XDRA 3RHHA 4OGDA 5EK6A 3V9IA 5J7IA 4CAZA 5J6BA 4DALA 5L2OA 5EUYA 1EYYA 2O2QA 2JG7A 4LEMA 5ABMA 4LIHA 3RHOA 4ZULA 2WOXA 5L2MA 1VLUA 5EZ4A 5L2NA
chains in the Genus database with same CATH superfamily
5AC0A 4I3UA 5AC2A 1NZWA 2WMEC 3RHRA 1O02A 2ONNA 4KWFA 4MPBA 5KLLA 5L13A 4GO0A 4LH0A 1A4SA 2ESDA 3U4JA 4FR8A 4NMKA 3RH9A 4H73A 5KLKA 2QE0A 2WMEA 4X0TA 3JU8A 3V9GA 2ONOA 4NS3A 4FQFA 4I3WA 1ZUMA 3TY7A 4DNGA 2W8RA 3VZ3A 4YWUA 3SZ9A 4OUBA 5AC1A 4I1WA 4ZVWA 5KLOA 2IMPA 4GO2A 3VZ2A 4OHTA 3JZ4A 5J78A 4GNZA 4GO3A 1EUHA 1NZXA 4I2RA 4PXLA 2W8OA 2Y52A 4QETA 4I3VA 4C3SA 4WB9A 2BHQA 1O9JA 1UXTA 4OE4A 1WNBA 3RHMA 1O05A 4WP7A 4F3XA 3EK1A 4OE2A 2ID2A 4Q92A 4ZVYA 2EITA 1AD3A 3QANA 2W8PA 3R31A 5EXFA 5KF0A 4NPIA 5A2DC 2VLEA 1NZZA 3V9KA 4QYJA 3VZ0A 2W8NA 5DBVA 3V9HA 3INLA 4NEAA 5FHZA 4OE6A 2J5NA 1UXRA 3N82A 1O04A 3RHJA 1UXVA 3ETFA 4IHIA 4O5HA 4QJEA 2BJKA 4E4GA 3ROSA 4H80A 2J40A 3MY7A 2EIIA 5EEBA 1QI6A 3VZ1A 4CBBA 1UXPA 3RHLA 4ZZ7A 4LH2A 4IYMA 4X4LA 5KLMA 2EJ6A 3PQAA 2IY6A 4I8PA 3RHQA 2EHUA 4LH1A 4NMJA 4OE5A 4ZWLA 4QTOA 3I44A 4WJ9A 2EJDA 2Y5DA 4IDMA 2D4EA 4V3FC 2W8QA 3N81A 1BPWA 2J6LA 3N80A 3K9DA 1KY8A 4I8QA 4X0UA 1UXNA 4ZXUA 3RHPA 2VROA 3K2WA 3IWJA 1EZ0A 2HG2A 4IDSA 4V3FA 4YWEA 2Y53A 1AG8A 4WPNA 2ONMA 3SZBA 2EHQA 3EFVA 3RHDA 5EYUA 1BI9A 4GHKA 4NU9A 4IT9A 5EKCA 4A0MA 5A2DA 5JRYA 4X2QA 1A4ZA 4LGZA 4I26A 3N83A 4KNAA 4ITBA 2O2RA 4PXLB 4E3XA 4JBEA 4I3XA 4JZ6A 2H5GA 2BJAA 4I9BA 4PZ2A 2EJLA 4OU2A 4YWVA 1UZBA 4JDCA 5KLNA 3V9LA 4LH3A 2ONPA 4O6RA 4PXNA 5DRUA 3R64A 1UXUA 4I25A 4MPYA 4QN2A 2Y51A 4K57A 3RJLA 3IWKA 4GO4A 4QF6A 5KJ5A 5A2DD 2OPXA 3INJA 1CW3A 5F2CA 2BHPA 1BXSA 1O00A 4QJEB 4H7NA 3SZAA 1UXQA 3ZQAA 3B4WA 4L1OA 4KWGA 4QGKA 4ZVXA 3PRLA 4I3TA 5DIBA 4ITAA 1O20A 4ZUKA 3V4CA 2EIWA 1O01A 2EUHA 1WNDA 4U3WA 1QI1A 2ILUA 4L2OA 4V37A 3V9JA 2O2PA 1T90A 2XDRA 3RHHA 4OGDA 5EK6A 3V9IA 5J7IA 4CAZA 5J6BA 4DALA 5L2OA 5EUYA 1EYYA 2O2QA 2JG7A 4LEMA 5ABMA 4LIHA 3RHOA 4ZULA 2WOXA 5L2MA 1VLUA 5EZ4A 5L2NA
chains in the Genus database with same CATH topology
5AC0A 4I3UA 5AC2A 1NZWA 2WMEC 3RHRA 1O02A 2ONNA 4KWFA 4MPBA 5KLLA 5L13A 4GO0A 4LH0A 1A4SA 2ESDA 3U4JA 4FR8A 4NMKA 3RH9A 4H73A 5KLKA 2QE0A 2WMEA 4X0TA 3JU8A 3V9GA 2ONOA 4NS3A 4FQFA 4I3WA 1ZUMA 3TY7A 4DNGA 2W8RA 3VZ3A 4YWUA 3SZ9A 4OUBA 5AC1A 4I1WA 4ZVWA 5KLOA 2IMPA 4GO2A 3VZ2A 4OHTA 3JZ4A 5J78A 4GNZA 4GO3A 1EUHA 1NZXA 4I2RA 4PXLA 2W8OA 2Y52A 4QETA 4I3VA 4C3SA 4WB9A 2BHQA 1O9JA 1UXTA 4OE4A 1WNBA 3RHMA 1O05A 4WP7A 4F3XA 3EK1A 4OE2A 2ID2A 4Q92A 4ZVYA 2EITA 1AD3A 3QANA 2W8PA 3R31A 5EXFA 5KF0A 4NPIA 5A2DC 2VLEA 1NZZA 3V9KA 4QYJA 3VZ0A 2W8NA 5DBVA 3V9HA 3INLA 4NEAA 5FHZA 4OE6A 2J5NA 1UXRA 3N82A 1O04A 3RHJA 1UXVA 3ETFA 4IHIA 4O5HA 4QJEA 2BJKA 4E4GA 3ROSA 4H80A 2J40A 3MY7A 2EIIA 5EEBA 1QI6A 3VZ1A 4CBBA 1UXPA 3RHLA 4ZZ7A 4LH2A 4IYMA 4X4LA 5KLMA 2EJ6A 3PQAA 2IY6A 4I8PA 3RHQA 2EHUA 4LH1A 4NMJA 4OE5A 4ZWLA 4QTOA 3I44A 4WJ9A 2EJDA 2Y5DA 4IDMA 2D4EA 4V3FC 2W8QA 3N81A 1BPWA 2J6LA 3N80A 3K9DA 1KY8A 4I8QA 4X0UA 1UXNA 4ZXUA 3RHPA 2VROA 3K2WA 3IWJA 1EZ0A 2HG2A 4IDSA 4V3FA 4YWEA 2Y53A 1AG8A 4WPNA 2ONMA 3SZBA 2EHQA 3EFVA 3RHDA 5EYUA 1BI9A 4GHKA 4NU9A 4IT9A 5EKCA 4A0MA 5A2DA 5JRYA 4X2QA 1A4ZA 4LGZA 4I26A 3N83A 4KNAA 4ITBA 2O2RA 4PXLB 4E3XA 4JBEA 4I3XA 4JZ6A 2H5GA 2BJAA 4I9BA 4PZ2A 2EJLA 4OU2A 4YWVA 1UZBA 4JDCA 5KLNA 3V9LA 4LH3A 2ONPA 4O6RA 4PXNA 5DRUA 3R64A 1UXUA 4I25A 4MPYA 4QN2A 2Y51A 4K57A 3RJLA 3IWKA 4GO4A 4QF6A 5KJ5A 5A2DD 2OPXA 3INJA 1CW3A 5F2CA 2BHPA 1BXSA 1O00A 4QJEB 4H7NA 3SZAA 1UXQA 3ZQAA 3B4WA 4L1OA 4KWGA 4QGKA 4ZVXA 3PRLA 4I3TA 5DIBA 4ITAA 1O20A 4ZUKA 3V4CA 2EIWA 1O01A 2EUHA 1WNDA 4U3WA 1QI1A 2ILUA 4L2OA 4V37A 3V9JA 2O2PA 1T90A 2XDRA 3RHHA 4OGDA 5EK6A 3V9IA 5J7IA 4CAZA 5J6BA 4DALA 5L2OA 5EUYA 1EYYA 2O2QA 2JG7A 4LEMA 5ABMA 4LIHA 3RHOA 4ZULA 2WOXA 5L2MA 1VLUA 5EZ4A 5L2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AC0 A;  4I3U A;  5AC2 A;  1NZW A;  2WME C;  3RHR A;  1O02 A;  2ONN A;  4KWF A;  4MPB A;  5KLL A;  5L13 A;  4GO0 A;  4LH0 A;  1A4S A;  2ESD A;  3U4J A;  4FR8 A;  4NMK A;  3RH9 A;  4H73 A;  5KLK A;  2QE0 A;  2WME A;  4X0T A;  3JU8 A;  3V9G A;  2ONO A;  4NS3 A;  4FQF A;  4I3W A;  1ZUM A;  3TY7 A;  4DNG A;  2W8R A;  3VZ3 A;  4YWU A;  3SZ9 A;  4OUB A;  5AC1 A;  4I1W A;  4ZVW A;  5KLO A;  2IMP A;  4GO2 A;  3VZ2 A;  4OHT A;  3JZ4 A;  5J78 A;  4GNZ A;  4GO3 A;  1EUH A;  1NZX A;  4I2R A;  4PXL A;  2W8O A;  2Y52 A;  4QET A;  4I3V A;  4C3S A;  4WB9 A;  2BHQ A;  1O9J A;  1UXT A;  4OE4 A;  1WNB A;  3RHM A;  1O05 A;  4WP7 A;  4F3X A;  3EK1 A;  4OE2 A;  2ID2 A;  4Q92 A;  4ZVY A;  2EIT A;  1AD3 A;  3QAN A;  2W8P A;  3R31 A;  5EXF A;  5KF0 A;  4NPI A;  5A2D C;  2VLE A;  1NZZ A;  3V9K A;  4QYJ A;  3VZ0 A;  2W8N A;  5DBV A;  3V9H A;  3INL A;  4NEA A;  5FHZ A;  4OE6 A;  2J5N A;  1UXR A;  3N82 A;  1O04 A;  3RHJ A;  1UXV A;  3ETF A;  4IHI A;  4O5H A;  4QJE A;  2BJK A;  4E4G A;  3ROS A;  4H80 A;  2J40 A;  3MY7 A;  2EII A;  5EEB A;  1QI6 A;  3VZ1 A;  4CBB A;  1UXP A;  3RHL A;  4ZZ7 A;  4LH2 A;  4IYM A;  4X4L A;  5KLM A;  2EJ6 A;  3PQA A;  2IY6 A;  4I8P A;  3RHQ A;  2EHU A;  4LH1 A;  4NMJ A;  4OE5 A;  4ZWL A;  4QTO A;  3I44 A;  4WJ9 A;  2EJD A;  2Y5D A;  4IDM A;  2D4E A;  4V3F C;  2W8Q A;  3N81 A;  1BPW A;  2J6L A;  3N80 A;  3K9D A;  1KY8 A;  4I8Q A;  4X0U A;  1UXN A;  4ZXU A;  3RHP A;  2VRO A;  3K2W A;  3IWJ A;  1EZ0 A;  2HG2 A;  4IDS A;  4V3F A;  4YWE A;  2Y53 A;  1AG8 A;  4WPN A;  2ONM A;  3SZB A;  2EHQ A;  3EFV A;  3RHD A;  5EYU A;  1BI9 A;  4GHK A;  4NU9 A;  4IT9 A;  5EKC A;  4A0M A;  5A2D A;  5JRY A;  4X2Q A;  1A4Z A;  4LGZ A;  4I26 A;  3N83 A;  4KNA A;  4ITB A;  2O2R A;  4PXL B;  4E3X A;  4JBE A;  4I3X A;  4JZ6 A;  2H5G A;  2BJA A;  4I9B A;  4PZ2 A;  2EJL A;  4OU2 A;  4YWV A;  1UZB A;  4JDC A;  5KLN A;  3V9L A;  4LH3 A;  2ONP A;  4O6R A;  4PXN A;  5DRU A;  3R64 A;  1UXU A;  4I25 A;  4MPY A;  4QN2 A;  2Y51 A;  4K57 A;  3RJL A;  3IWK A;  4GO4 A;  4QF6 A;  5KJ5 A;  5A2D D;  2OPX A;  3INJ A;  1CW3 A;  5F2C A;  2BHP A;  1BXS A;  1O00 A;  4QJE B;  4H7N A;  3SZA A;  1UXQ A;  3ZQA A;  3B4W A;  4L1O A;  4KWG A;  4QGK A;  4ZVX A;  3PRL A;  4I3T A;  5DIB A;  4ITA A;  1O20 A;  4ZUK A;  3V4C A;  2EIW A;  1O01 A;  2EUH A;  1WND A;  4U3W A;  1QI1 A;  2ILU A;  4L2O A;  4V37 A;  3V9J A;  2O2P A;  1T90 A;  2XDR A;  3RHH A;  4OGD A;  5EK6 A;  3V9I A;  5J7I A;  4CAZ A;  5J6B A;  4DAL A;  5L2O A;  5EUY A;  1EYY A;  2O2Q A;  2JG7 A;  4LEM A;  5ABM A;  4LIH A;  3RHO A;  4ZUL A;  2WOX A;  5L2M A;  1VLU A;  5EZ4 A;  5L2N A; 
#chains in the Genus database with same CATH topology
 5AC0 A;  4I3U A;  5AC2 A;  1NZW A;  2WME C;  3RHR A;  1O02 A;  2ONN A;  4KWF A;  4MPB A;  5KLL A;  5L13 A;  4GO0 A;  4LH0 A;  1A4S A;  2ESD A;  3U4J A;  4FR8 A;  4NMK A;  3RH9 A;  4H73 A;  5KLK A;  2QE0 A;  2WME A;  4X0T A;  3JU8 A;  3V9G A;  2ONO A;  4NS3 A;  4FQF A;  4I3W A;  1ZUM A;  3TY7 A;  4DNG A;  2W8R A;  3VZ3 A;  4YWU A;  3SZ9 A;  4OUB A;  5AC1 A;  4I1W A;  4ZVW A;  5KLO A;  2IMP A;  4GO2 A;  3VZ2 A;  4OHT A;  3JZ4 A;  5J78 A;  4GNZ A;  4GO3 A;  1EUH A;  1NZX A;  4I2R A;  4PXL A;  2W8O A;  2Y52 A;  4QET A;  4I3V A;  4C3S A;  4WB9 A;  2BHQ A;  1O9J A;  1UXT A;  4OE4 A;  1WNB A;  3RHM A;  1O05 A;  4WP7 A;  4F3X A;  3EK1 A;  4OE2 A;  2ID2 A;  4Q92 A;  4ZVY A;  2EIT A;  1AD3 A;  3QAN A;  2W8P A;  3R31 A;  5EXF A;  5KF0 A;  4NPI A;  5A2D C;  2VLE A;  1NZZ A;  3V9K A;  4QYJ A;  3VZ0 A;  2W8N A;  5DBV A;  3V9H A;  3INL A;  4NEA A;  5FHZ A;  4OE6 A;  2J5N A;  1UXR A;  3N82 A;  1O04 A;  3RHJ A;  1UXV A;  3ETF A;  4IHI A;  4O5H A;  4QJE A;  2BJK A;  4E4G A;  3ROS A;  4H80 A;  2J40 A;  3MY7 A;  2EII A;  5EEB A;  1QI6 A;  3VZ1 A;  4CBB A;  1UXP A;  3RHL A;  4ZZ7 A;  4LH2 A;  4IYM A;  4X4L A;  5KLM A;  2EJ6 A;  3PQA A;  2IY6 A;  4I8P A;  3RHQ A;  2EHU A;  4LH1 A;  4NMJ A;  4OE5 A;  4ZWL A;  4QTO A;  3I44 A;  4WJ9 A;  2EJD A;  2Y5D A;  4IDM A;  2D4E A;  4V3F C;  2W8Q A;  3N81 A;  1BPW A;  2J6L A;  3N80 A;  3K9D A;  1KY8 A;  4I8Q A;  4X0U A;  1UXN A;  4ZXU A;  3RHP A;  2VRO A;  3K2W A;  3IWJ A;  1EZ0 A;  2HG2 A;  4IDS A;  4V3F A;  4YWE A;  2Y53 A;  1AG8 A;  4WPN A;  2ONM A;  3SZB A;  2EHQ A;  3EFV A;  3RHD A;  5EYU A;  1BI9 A;  4GHK A;  4NU9 A;  4IT9 A;  5EKC A;  4A0M A;  5A2D A;  5JRY A;  4X2Q A;  1A4Z A;  4LGZ A;  4I26 A;  3N83 A;  4KNA A;  4ITB A;  2O2R A;  4PXL B;  4E3X A;  4JBE A;  4I3X A;  4JZ6 A;  2H5G A;  2BJA A;  4I9B A;  4PZ2 A;  2EJL A;  4OU2 A;  4YWV A;  1UZB A;  4JDC A;  5KLN A;  3V9L A;  4LH3 A;  2ONP A;  4O6R A;  4PXN A;  5DRU A;  3R64 A;  1UXU A;  4I25 A;  4MPY A;  4QN2 A;  2Y51 A;  4K57 A;  3RJL A;  3IWK A;  4GO4 A;  4QF6 A;  5KJ5 A;  5A2D D;  2OPX A;  3INJ A;  1CW3 A;  5F2C A;  2BHP A;  1BXS A;  1O00 A;  4QJE B;  4H7N A;  3SZA A;  1UXQ A;  3ZQA A;  3B4W A;  4L1O A;  4KWG A;  4QGK A;  4ZVX A;  3PRL A;  4I3T A;  5DIB A;  4ITA A;  1O20 A;  4ZUK A;  3V4C A;  2EIW A;  1O01 A;  2EUH A;  1WND A;  4U3W A;  1QI1 A;  2ILU A;  4L2O A;  4V37 A;  3V9J A;  2O2P A;  1T90 A;  2XDR A;  3RHH A;  4OGD A;  5EK6 A;  3V9I A;  5J7I A;  4CAZ A;  5J6B A;  4DAL A;  5L2O A;  5EUY A;  1EYY A;  2O2Q A;  2JG7 A;  4LEM A;  5ABM A;  4LIH A;  3RHO A;  4ZUL A;  2WOX A;  5L2M A;  1VLU A;  5EZ4 A;  5L2N A; 
#chains in the Genus database with same CATH homology
 5AC0 A;  4I3U A;  5AC2 A;  1NZW A;  2WME C;  3RHR A;  1O02 A;  2ONN A;  4KWF A;  4MPB A;  5KLL A;  5L13 A;  4GO0 A;  4LH0 A;  1A4S A;  2ESD A;  3U4J A;  4FR8 A;  4NMK A;  3RH9 A;  4H73 A;  5KLK A;  2QE0 A;  2WME A;  4X0T A;  3JU8 A;  3V9G A;  2ONO A;  4NS3 A;  4FQF A;  4I3W A;  1ZUM A;  3TY7 A;  4DNG A;  2W8R A;  3VZ3 A;  4YWU A;  3SZ9 A;  4OUB A;  5AC1 A;  4I1W A;  4ZVW A;  5KLO A;  2IMP A;  4GO2 A;  3VZ2 A;  4OHT A;  3JZ4 A;  5J78 A;  4GNZ A;  4GO3 A;  1EUH A;  1NZX A;  4I2R A;  4PXL A;  2W8O A;  2Y52 A;  4QET A;  4I3V A;  4C3S A;  4WB9 A;  2BHQ A;  1O9J A;  1UXT A;  4OE4 A;  1WNB A;  3RHM A;  1O05 A;  4WP7 A;  4F3X A;  3EK1 A;  4OE2 A;  2ID2 A;  4Q92 A;  4ZVY A;  2EIT A;  1AD3 A;  3QAN A;  2W8P A;  3R31 A;  5EXF A;  5KF0 A;  4NPI A;  5A2D C;  2VLE A;  1NZZ A;  3V9K A;  4QYJ A;  3VZ0 A;  2W8N A;  5DBV A;  3V9H A;  3INL A;  4NEA A;  5FHZ A;  4OE6 A;  2J5N A;  1UXR A;  3N82 A;  1O04 A;  3RHJ A;  1UXV A;  3ETF A;  4IHI A;  4O5H A;  4QJE A;  2BJK A;  4E4G A;  3ROS A;  4H80 A;  2J40 A;  3MY7 A;  2EII A;  5EEB A;  1QI6 A;  3VZ1 A;  4CBB A;  1UXP A;  3RHL A;  4ZZ7 A;  4LH2 A;  4IYM A;  4X4L A;  5KLM A;  2EJ6 A;  3PQA A;  2IY6 A;  4I8P A;  3RHQ A;  2EHU A;  4LH1 A;  4NMJ A;  4OE5 A;  4ZWL A;  4QTO A;  3I44 A;  4WJ9 A;  2EJD A;  2Y5D A;  4IDM A;  2D4E A;  4V3F C;  2W8Q A;  3N81 A;  1BPW A;  2J6L A;  3N80 A;  3K9D A;  1KY8 A;  4I8Q A;  4X0U A;  1UXN A;  4ZXU A;  3RHP A;  2VRO A;  3K2W A;  3IWJ A;  1EZ0 A;  2HG2 A;  4IDS A;  4V3F A;  4YWE A;  2Y53 A;  1AG8 A;  4WPN A;  2ONM A;  3SZB A;  2EHQ A;  3EFV A;  3RHD A;  5EYU A;  1BI9 A;  4GHK A;  4NU9 A;  4IT9 A;  5EKC A;  4A0M A;  5A2D A;  5JRY A;  4X2Q A;  1A4Z A;  4LGZ A;  4I26 A;  3N83 A;  4KNA A;  4ITB A;  2O2R A;  4PXL B;  4E3X A;  4JBE A;  4I3X A;  4JZ6 A;  2H5G A;  2BJA A;  4I9B A;  4PZ2 A;  2EJL A;  4OU2 A;  4YWV A;  1UZB A;  4JDC A;  5KLN A;  3V9L A;  4LH3 A;  2ONP A;  4O6R A;  4PXN A;  5DRU A;  3R64 A;  1UXU A;  4I25 A;  4MPY A;  4QN2 A;  2Y51 A;  4K57 A;  3RJL A;  3IWK A;  4GO4 A;  4QF6 A;  5KJ5 A;  5A2D D;  2OPX A;  3INJ A;  1CW3 A;  5F2C A;  2BHP A;  1BXS A;  1O00 A;  4QJE B;  4H7N A;  3SZA A;  1UXQ A;  3ZQA A;  3B4W A;  4L1O A;  4KWG A;  4QGK A;  4ZVX A;  3PRL A;  4I3T A;  5DIB A;  4ITA A;  1O20 A;  4ZUK A;  3V4C A;  2EIW A;  1O01 A;  2EUH A;  1WND A;  4U3W A;  1QI1 A;  2ILU A;  4L2O A;  4V37 A;  3V9J A;  2O2P A;  1T90 A;  2XDR A;  3RHH A;  4OGD A;  5EK6 A;  3V9I A;  5J7I A;  4CAZ A;  5J6B A;  4DAL A;  5L2O A;  5EUY A;  1EYY A;  2O2Q A;  2JG7 A;  4LEM A;  5ABM A;  4LIH A;  3RHO A;  4ZUL A;  2WOX A;  5L2M A;  1VLU A;  5EZ4 A;  5L2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...