4IDSA

Crystal structure of the delta-pyrroline-5-carboxylate dehydrogenase from mycobacterium tuberculosis
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
543
structure length
540
Chain Sequence
b'HMDAITQVPVPANEPVHDYAPKSPERTRLRTELASLADHPIDLPHVIGGRHRMGDGERIDVVQPHRHAARLGTLTNATHADAAAAVEAAMSAKSDWAALPFDERAAVFLRAADLLAGPWREKIAAATMLGQSKSVYQAEIDAVCELIDFWRFNVAFARQILEQQPISGPGEWNRIDYRPLDGFVYAITPFNFTSIAGNLPTAPALMGNTVIWKPSITQTLAAYLTMQLLEAAGLPPGVINLVTGDGFAVSDVALADPRLAGIHFTGSTATFGWQWVGTNIGRYHSYPRLVGETGGKDFVVAHASARPDVLRTALIRGAFDYQGQKSAVSRAFIAHSVWQRMGDELLAKAAELRYGDITDLSNYGGALIDQRAFVKNVDAIERAKGAAAVTVAVGGEYDDSEGYFVRPTVLLSDDPTDESFVIEYFGPLLSVHVYPDERYEQILDVIDTGSRYALTGAVIADDRQAVLTALDRLRFAAGNFYVNDKPTGAVVGRQPFGGARGSDTNDKAGSPLNLLRWTSARSIKETFVAATDHIYPHMAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Delta-1-pyrroline-5-carboxylate dehydrogenase
publication title Characterization of the proline-utilization pathway in Mycobacterium tuberculosis through structural and functional studies.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 187
structure length 540
sequence length 543
ec nomenclature ec 1.5.1.12: Transferred entry: 1.2.1.88.
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00171 Aldedh Aldehyde dehydrogenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.309.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 2 Aldehyde Dehydrogenase; Chain A, domain 2 4idsA02
3.40.605.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 1 Aldehyde Dehydrogenase; Chain A, domain 1 4idsA01
4ZWLA 3EK1A 5KLKA 4MPBA 4ZZ7A 2BHPA 3U4JA 3VZ2A 4IYMA 2EJDA 4LIHA 2J40A 5EK6A 2EIIA 4U3WA 5KLNA 4H80A 4H7NA 4WB9A 4QJEB 4IT9A 2O2QA 4OE6A 1T90A 5AC1A 2W8NA 3K2WA 2W8QA 4LH0A 4FQFA 4IDSA 2VROA 1O00A 5J6BA 1UXUA 2W8OA 4H73A 4WP7A 4LH3A 5KLMA 1VLUA 2ONNA 1O20A 5A2DA 3B4WA 2O2PA 1QI1A 3V9IA 1O01A 1WNBA 2W8RA 4Q92A 5DRUA 4I9BA 4L1OA 3VZ0A 4X0UA 3ZQAA 5EKCA 2EITA 1EUHA 4LH2A 2Y51A 4GHKA 2BJKA 4JBEA 1UXNA 4GO0A 4QGKA 4X4LA 4I1WA 3RHQA 3V9GA 3V9KA 5EXFA 1A4ZA 1NZZA 4QF6A 2ONPA 2ONOA 2O2RA 1BPWA 1UXQA 2VLEA 5F2CA 3INLA 4ZVXA 4LGZA 4V3FA 4OU2A 4QYJA 1AD3A 3SZBA 4NMJA 4PXLB 5AC0A 3N80A 3SZ9A 3RHDA 4C3SA 1EYYA 2H5GA 3RHMA 3PQAA 2QE0A 4V37A 5AC2A 5L2OA 4IHIA 2XDRA 4ZVYA 5A2DC 2WOXA 3ETFA 3JZ4A 3RHOA 1UXPA 3K9DA 5ABMA 4X0TA 4OE4A 2JG7A 5EUYA 1UXRA 4I3UA 1EZ0A 4LH1A 4OUBA 2WMEA 3IWJA 5J7IA 5L13A 4I26A 3N83A 3N82A 1O05A 4I8PA 5KJ5A 2ILUA 2EHUA 4OE2A 4I25A 1O02A 3PRLA 4A0MA 1BI9A 3VZ1A 5J78A 4I3XA 4ZULA 5L2NA 5EYUA 2Y52A 4WJ9A 4KNAA 1AG8A 2EIWA 3RH9A 1NZWA 4CBBA 2W8PA 5EEBA 4ITAA 4NU9A 4V3FC 2Y53A 5EZ4A 3EFVA 1O9JA 5DBVA 4WPNA 4JDCA 2BHQA 4OGDA 3VZ3A 3V9LA 4NPIA 2Y5DA 4YWVA 4O6RA 3RHRA 4I3VA 4I2RA 4QTOA 3RHLA 5DIBA 4YWUA 3RHJA 2ONMA 5KLOA 3IWKA 3R31A 3ROSA 2BJAA 5A2DD 3INJA 5JRYA 2EHQA 4E3XA 2IY6A 2OPXA 2EJLA 4PXNA 3RJLA 4CAZA 4KWGA 2ESDA 4I3TA 2EUHA 4DALA 4GO2A 3TY7A 4E4GA 4LEMA 4ITBA 4NMKA 2J5NA 3R64A 4K57A 1CW3A 4I8QA 4ZXUA 4I3WA 4OHTA 4MPYA 4F3XA 1WNDA 3V4CA 3I44A 5FHZA 4ZVWA 2D4EA 3QANA 1A4SA 5KF0A 3JU8A 4X2QA 3N81A 4NEAA 1O04A 1QI6A 4YWEA 2IMPA 4IDMA 3RHPA 1UXTA 3SZAA 3V9JA 4DNGA 4GO4A 4ZUKA 1UXVA 4QN2A 1NZXA 2HG2A 5KLLA 3V9HA 4L2OA 4O5HA 2ID2A 4GNZA 2EJ6A 4QETA 4NS3A 2J6LA 1ZUMA 5L2MA 4KWFA 4OE5A 1UZBA 1BXSA 4QJEA 1KY8A 3MY7A 2WMEC 4JZ6A 3RHHA 4FR8A 4GO3A 4PZ2A 4PXLA
chains in the Genus database with same CATH superfamily
4ZWLA 3EK1A 5KLKA 4MPBA 4ZZ7A 2BHPA 3U4JA 3VZ2A 4IYMA 2EJDA 4LIHA 2J40A 5EK6A 2EIIA 4U3WA 5KLNA 4H80A 4H7NA 4WB9A 4QJEB 4IT9A 2O2QA 4OE6A 1T90A 5AC1A 2W8NA 3K2WA 2W8QA 4LH0A 4FQFA 4IDSA 2VROA 1O00A 5J6BA 1UXUA 2W8OA 4H73A 4WP7A 4LH3A 5KLMA 1VLUA 2ONNA 1O20A 5A2DA 3B4WA 2O2PA 1QI1A 3V9IA 1O01A 1WNBA 2W8RA 4Q92A 5DRUA 4I9BA 4L1OA 3VZ0A 4X0UA 3ZQAA 5EKCA 2EITA 1EUHA 4LH2A 2Y51A 4GHKA 2BJKA 4JBEA 1UXNA 4GO0A 4QGKA 4X4LA 4I1WA 3RHQA 3V9GA 3V9KA 5EXFA 1A4ZA 1NZZA 4QF6A 2ONPA 2ONOA 2O2RA 1BPWA 1UXQA 2VLEA 5F2CA 3INLA 4ZVXA 4LGZA 4V3FA 4OU2A 4QYJA 1AD3A 3SZBA 4NMJA 4PXLB 5AC0A 3N80A 3SZ9A 3RHDA 4C3SA 1EYYA 2H5GA 3RHMA 3PQAA 2QE0A 4V37A 5AC2A 5L2OA 4IHIA 2XDRA 4ZVYA 5A2DC 2WOXA 3ETFA 3JZ4A 3RHOA 1UXPA 3K9DA 5ABMA 4X0TA 4OE4A 2JG7A 5EUYA 1UXRA 4I3UA 1EZ0A 4LH1A 4OUBA 2WMEA 3IWJA 5J7IA 5L13A 4I26A 3N83A 3N82A 1O05A 4I8PA 5KJ5A 2ILUA 2EHUA 4OE2A 4I25A 1O02A 3PRLA 4A0MA 1BI9A 3VZ1A 5J78A 4I3XA 4ZULA 5L2NA 5EYUA 2Y52A 4WJ9A 4KNAA 1AG8A 2EIWA 3RH9A 1NZWA 4CBBA 2W8PA 5EEBA 4ITAA 4NU9A 4V3FC 2Y53A 5EZ4A 3EFVA 1O9JA 5DBVA 4WPNA 4JDCA 2BHQA 4OGDA 3VZ3A 3V9LA 4NPIA 2Y5DA 4YWVA 4O6RA 3RHRA 4I3VA 4I2RA 4QTOA 3RHLA 5DIBA 4YWUA 3RHJA 2ONMA 5KLOA 3IWKA 3R31A 3ROSA 2BJAA 5A2DD 3INJA 5JRYA 2EHQA 4E3XA 2IY6A 2OPXA 2EJLA 4PXNA 3RJLA 4CAZA 4KWGA 2ESDA 4I3TA 2EUHA 4DALA 4GO2A 3TY7A 4E4GA 4LEMA 4ITBA 4NMKA 2J5NA 3R64A 4K57A 1CW3A 4I8QA 4ZXUA 4I3WA 4OHTA 4MPYA 4F3XA 1WNDA 3V4CA 3I44A 5FHZA 4ZVWA 2D4EA 3QANA 1A4SA 5KF0A 3JU8A 4X2QA 3N81A 4NEAA 1O04A 1QI6A 4YWEA 2IMPA 4IDMA 3RHPA 1UXTA 3SZAA 3V9JA 4DNGA 4GO4A 4ZUKA 1UXVA 4QN2A 1NZXA 2HG2A 5KLLA 3V9HA 4L2OA 4O5HA 2ID2A 4GNZA 2EJ6A 4QETA 4NS3A 2J6LA 1ZUMA 5L2MA 4KWFA 4OE5A 1UZBA 1BXSA 4QJEA 1KY8A 3MY7A 2WMEC 4JZ6A 3RHHA 4FR8A 4GO3A 4PZ2A 4PXLA
chains in the Genus database with same CATH topology
4ZWLA 3EK1A 5KLKA 4MPBA 4ZZ7A 2BHPA 3U4JA 3VZ2A 4IYMA 2EJDA 4LIHA 2J40A 5EK6A 2EIIA 4U3WA 5KLNA 4H80A 4H7NA 4WB9A 4QJEB 4IT9A 2O2QA 4OE6A 1T90A 5AC1A 2W8NA 3K2WA 2W8QA 4LH0A 4FQFA 4IDSA 2VROA 1O00A 5J6BA 1UXUA 2W8OA 4H73A 4WP7A 4LH3A 5KLMA 1VLUA 2ONNA 1O20A 5A2DA 3B4WA 2O2PA 1QI1A 3V9IA 1O01A 1WNBA 2W8RA 4Q92A 5DRUA 4I9BA 4L1OA 3VZ0A 4X0UA 3ZQAA 5EKCA 2EITA 1EUHA 4LH2A 2Y51A 4GHKA 2BJKA 4JBEA 1UXNA 4GO0A 4QGKA 4X4LA 4I1WA 3RHQA 3V9GA 3V9KA 5EXFA 1A4ZA 1NZZA 4QF6A 2ONPA 2ONOA 2O2RA 1BPWA 1UXQA 2VLEA 5F2CA 3INLA 4ZVXA 4LGZA 4V3FA 4OU2A 4QYJA 1AD3A 3SZBA 4NMJA 4PXLB 5AC0A 3N80A 3SZ9A 3RHDA 4C3SA 1EYYA 2H5GA 3RHMA 3PQAA 2QE0A 4V37A 5AC2A 5L2OA 4IHIA 2XDRA 4ZVYA 5A2DC 2WOXA 3ETFA 3JZ4A 3RHOA 1UXPA 3K9DA 5ABMA 4X0TA 4OE4A 2JG7A 5EUYA 1UXRA 4I3UA 1EZ0A 4LH1A 4OUBA 2WMEA 3IWJA 5J7IA 5L13A 4I26A 3N83A 3N82A 1O05A 4I8PA 5KJ5A 2ILUA 2EHUA 4OE2A 4I25A 1O02A 3PRLA 4A0MA 1BI9A 3VZ1A 5J78A 4I3XA 4ZULA 5L2NA 5EYUA 2Y52A 4WJ9A 4KNAA 1AG8A 2EIWA 3RH9A 1NZWA 4CBBA 2W8PA 5EEBA 4ITAA 4NU9A 4V3FC 2Y53A 5EZ4A 3EFVA 1O9JA 5DBVA 4WPNA 4JDCA 2BHQA 4OGDA 3VZ3A 3V9LA 4NPIA 2Y5DA 4YWVA 4O6RA 3RHRA 4I3VA 4I2RA 4QTOA 3RHLA 5DIBA 4YWUA 3RHJA 2ONMA 5KLOA 3IWKA 3R31A 3ROSA 2BJAA 5A2DD 3INJA 5JRYA 2EHQA 4E3XA 2IY6A 2OPXA 2EJLA 4PXNA 3RJLA 4CAZA 4KWGA 2ESDA 4I3TA 2EUHA 4DALA 4GO2A 3TY7A 4E4GA 4LEMA 4ITBA 4NMKA 2J5NA 3R64A 4K57A 1CW3A 4I8QA 4ZXUA 4I3WA 4OHTA 4MPYA 4F3XA 1WNDA 3V4CA 3I44A 5FHZA 4ZVWA 2D4EA 3QANA 1A4SA 5KF0A 3JU8A 4X2QA 3N81A 4NEAA 1O04A 1QI6A 4YWEA 2IMPA 4IDMA 3RHPA 1UXTA 3SZAA 3V9JA 4DNGA 4GO4A 4ZUKA 1UXVA 4QN2A 1NZXA 2HG2A 5KLLA 3V9HA 4L2OA 4O5HA 2ID2A 4GNZA 2EJ6A 4QETA 4NS3A 2J6LA 1ZUMA 5L2MA 4KWFA 4OE5A 1UZBA 1BXSA 4QJEA 1KY8A 3MY7A 2WMEC 4JZ6A 3RHHA 4FR8A 4GO3A 4PZ2A 4PXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZWL A;  3EK1 A;  5KLK A;  4MPB A;  4ZZ7 A;  2BHP A;  3U4J A;  3VZ2 A;  4IYM A;  2EJD A;  4LIH A;  2J40 A;  5EK6 A;  2EII A;  4U3W A;  5KLN A;  4H80 A;  4H7N A;  4WB9 A;  4QJE B;  4IT9 A;  2O2Q A;  4OE6 A;  1T90 A;  5AC1 A;  2W8N A;  3K2W A;  2W8Q A;  4LH0 A;  4FQF A;  4IDS A;  2VRO A;  1O00 A;  5J6B A;  1UXU A;  2W8O A;  4H73 A;  4WP7 A;  4LH3 A;  5KLM A;  1VLU A;  2ONN A;  1O20 A;  5A2D A;  3B4W A;  2O2P A;  1QI1 A;  3V9I A;  1O01 A;  1WNB A;  2W8R A;  4Q92 A;  5DRU A;  4I9B A;  4L1O A;  3VZ0 A;  4X0U A;  3ZQA A;  5EKC A;  2EIT A;  1EUH A;  4LH2 A;  2Y51 A;  4GHK A;  2BJK A;  4JBE A;  1UXN A;  4GO0 A;  4QGK A;  4X4L A;  4I1W A;  3RHQ A;  3V9G A;  3V9K A;  5EXF A;  1A4Z A;  1NZZ A;  4QF6 A;  2ONP A;  2ONO A;  2O2R A;  1BPW A;  1UXQ A;  2VLE A;  5F2C A;  3INL A;  4ZVX A;  4LGZ A;  4V3F A;  4OU2 A;  4QYJ A;  1AD3 A;  3SZB A;  4NMJ A;  4PXL B;  5AC0 A;  3N80 A;  3SZ9 A;  3RHD A;  4C3S A;  1EYY A;  2H5G A;  3RHM A;  3PQA A;  2QE0 A;  4V37 A;  5AC2 A;  5L2O A;  4IHI A;  2XDR A;  4ZVY A;  5A2D C;  2WOX A;  3ETF A;  3JZ4 A;  3RHO A;  1UXP A;  3K9D A;  5ABM A;  4X0T A;  4OE4 A;  2JG7 A;  5EUY A;  1UXR A;  4I3U A;  1EZ0 A;  4LH1 A;  4OUB A;  2WME A;  3IWJ A;  5J7I A;  5L13 A;  4I26 A;  3N83 A;  3N82 A;  1O05 A;  4I8P A;  5KJ5 A;  2ILU A;  2EHU A;  4OE2 A;  4I25 A;  1O02 A;  3PRL A;  4A0M A;  1BI9 A;  3VZ1 A;  5J78 A;  4I3X A;  4ZUL A;  5L2N A;  5EYU A;  2Y52 A;  4WJ9 A;  4KNA A;  1AG8 A;  2EIW A;  3RH9 A;  1NZW A;  4CBB A;  2W8P A;  5EEB A;  4ITA A;  4NU9 A;  4V3F C;  2Y53 A;  5EZ4 A;  3EFV A;  1O9J A;  5DBV A;  4WPN A;  4JDC A;  2BHQ A;  4OGD A;  3VZ3 A;  3V9L A;  4NPI A;  2Y5D A;  4YWV A;  4O6R A;  3RHR A;  4I3V A;  4I2R A;  4QTO A;  3RHL A;  5DIB A;  4YWU A;  3RHJ A;  2ONM A;  5KLO A;  3IWK A;  3R31 A;  3ROS A;  2BJA A;  5A2D D;  3INJ A;  5JRY A;  2EHQ A;  4E3X A;  2IY6 A;  2OPX A;  2EJL A;  4PXN A;  3RJL A;  4CAZ A;  4KWG A;  2ESD A;  4I3T A;  2EUH A;  4DAL A;  4GO2 A;  3TY7 A;  4E4G A;  4LEM A;  4ITB A;  4NMK A;  2J5N A;  3R64 A;  4K57 A;  1CW3 A;  4I8Q A;  4ZXU A;  4I3W A;  4OHT A;  4MPY A;  4F3X A;  1WND A;  3V4C A;  3I44 A;  5FHZ A;  4ZVW A;  2D4E A;  3QAN A;  1A4S A;  5KF0 A;  3JU8 A;  4X2Q A;  3N81 A;  4NEA A;  1O04 A;  1QI6 A;  4YWE A;  2IMP A;  4IDM A;  3RHP A;  1UXT A;  3SZA A;  3V9J A;  4DNG A;  4GO4 A;  4ZUK A;  1UXV A;  4QN2 A;  1NZX A;  2HG2 A;  5KLL A;  3V9H A;  4L2O A;  4O5H A;  2ID2 A;  4GNZ A;  2EJ6 A;  4QET A;  4NS3 A;  2J6L A;  1ZUM A;  5L2M A;  4KWF A;  4OE5 A;  1UZB A;  1BXS A;  4QJE A;  1KY8 A;  3MY7 A;  2WME C;  4JZ6 A;  3RHH A;  4FR8 A;  4GO3 A;  4PZ2 A;  4PXL A; 
#chains in the Genus database with same CATH topology
 4ZWL A;  3EK1 A;  5KLK A;  4MPB A;  4ZZ7 A;  2BHP A;  3U4J A;  3VZ2 A;  4IYM A;  2EJD A;  4LIH A;  2J40 A;  5EK6 A;  2EII A;  4U3W A;  5KLN A;  4H80 A;  4H7N A;  4WB9 A;  4QJE B;  4IT9 A;  2O2Q A;  4OE6 A;  1T90 A;  5AC1 A;  2W8N A;  3K2W A;  2W8Q A;  4LH0 A;  4FQF A;  4IDS A;  2VRO A;  1O00 A;  5J6B A;  1UXU A;  2W8O A;  4H73 A;  4WP7 A;  4LH3 A;  5KLM A;  1VLU A;  2ONN A;  1O20 A;  5A2D A;  3B4W A;  2O2P A;  1QI1 A;  3V9I A;  1O01 A;  1WNB A;  2W8R A;  4Q92 A;  5DRU A;  4I9B A;  4L1O A;  3VZ0 A;  4X0U A;  3ZQA A;  5EKC A;  2EIT A;  1EUH A;  4LH2 A;  2Y51 A;  4GHK A;  2BJK A;  4JBE A;  1UXN A;  4GO0 A;  4QGK A;  4X4L A;  4I1W A;  3RHQ A;  3V9G A;  3V9K A;  5EXF A;  1A4Z A;  1NZZ A;  4QF6 A;  2ONP A;  2ONO A;  2O2R A;  1BPW A;  1UXQ A;  2VLE A;  5F2C A;  3INL A;  4ZVX A;  4LGZ A;  4V3F A;  4OU2 A;  4QYJ A;  1AD3 A;  3SZB A;  4NMJ A;  4PXL B;  5AC0 A;  3N80 A;  3SZ9 A;  3RHD A;  4C3S A;  1EYY A;  2H5G A;  3RHM A;  3PQA A;  2QE0 A;  4V37 A;  5AC2 A;  5L2O A;  4IHI A;  2XDR A;  4ZVY A;  5A2D C;  2WOX A;  3ETF A;  3JZ4 A;  3RHO A;  1UXP A;  3K9D A;  5ABM A;  4X0T A;  4OE4 A;  2JG7 A;  5EUY A;  1UXR A;  4I3U A;  1EZ0 A;  4LH1 A;  4OUB A;  2WME A;  3IWJ A;  5J7I A;  5L13 A;  4I26 A;  3N83 A;  3N82 A;  1O05 A;  4I8P A;  5KJ5 A;  2ILU A;  2EHU A;  4OE2 A;  4I25 A;  1O02 A;  3PRL A;  4A0M A;  1BI9 A;  3VZ1 A;  5J78 A;  4I3X A;  4ZUL A;  5L2N A;  5EYU A;  2Y52 A;  4WJ9 A;  4KNA A;  1AG8 A;  2EIW A;  3RH9 A;  1NZW A;  4CBB A;  2W8P A;  5EEB A;  4ITA A;  4NU9 A;  4V3F C;  2Y53 A;  5EZ4 A;  3EFV A;  1O9J A;  5DBV A;  4WPN A;  4JDC A;  2BHQ A;  4OGD A;  3VZ3 A;  3V9L A;  4NPI A;  2Y5D A;  4YWV A;  4O6R A;  3RHR A;  4I3V A;  4I2R A;  4QTO A;  3RHL A;  5DIB A;  4YWU A;  3RHJ A;  2ONM A;  5KLO A;  3IWK A;  3R31 A;  3ROS A;  2BJA A;  5A2D D;  3INJ A;  5JRY A;  2EHQ A;  4E3X A;  2IY6 A;  2OPX A;  2EJL A;  4PXN A;  3RJL A;  4CAZ A;  4KWG A;  2ESD A;  4I3T A;  2EUH A;  4DAL A;  4GO2 A;  3TY7 A;  4E4G A;  4LEM A;  4ITB A;  4NMK A;  2J5N A;  3R64 A;  4K57 A;  1CW3 A;  4I8Q A;  4ZXU A;  4I3W A;  4OHT A;  4MPY A;  4F3X A;  1WND A;  3V4C A;  3I44 A;  5FHZ A;  4ZVW A;  2D4E A;  3QAN A;  1A4S A;  5KF0 A;  3JU8 A;  4X2Q A;  3N81 A;  4NEA A;  1O04 A;  1QI6 A;  4YWE A;  2IMP A;  4IDM A;  3RHP A;  1UXT A;  3SZA A;  3V9J A;  4DNG A;  4GO4 A;  4ZUK A;  1UXV A;  4QN2 A;  1NZX A;  2HG2 A;  5KLL A;  3V9H A;  4L2O A;  4O5H A;  2ID2 A;  4GNZ A;  2EJ6 A;  4QET A;  4NS3 A;  2J6L A;  1ZUM A;  5L2M A;  4KWF A;  4OE5 A;  1UZB A;  1BXS A;  4QJE A;  1KY8 A;  3MY7 A;  2WME C;  4JZ6 A;  3RHH A;  4FR8 A;  4GO3 A;  4PZ2 A;  4PXL A; 
#chains in the Genus database with same CATH homology
 4ZWL A;  3EK1 A;  5KLK A;  4MPB A;  4ZZ7 A;  2BHP A;  3U4J A;  3VZ2 A;  4IYM A;  2EJD A;  4LIH A;  2J40 A;  5EK6 A;  2EII A;  4U3W A;  5KLN A;  4H80 A;  4H7N A;  4WB9 A;  4QJE B;  4IT9 A;  2O2Q A;  4OE6 A;  1T90 A;  5AC1 A;  2W8N A;  3K2W A;  2W8Q A;  4LH0 A;  4FQF A;  4IDS A;  2VRO A;  1O00 A;  5J6B A;  1UXU A;  2W8O A;  4H73 A;  4WP7 A;  4LH3 A;  5KLM A;  1VLU A;  2ONN A;  1O20 A;  5A2D A;  3B4W A;  2O2P A;  1QI1 A;  3V9I A;  1O01 A;  1WNB A;  2W8R A;  4Q92 A;  5DRU A;  4I9B A;  4L1O A;  3VZ0 A;  4X0U A;  3ZQA A;  5EKC A;  2EIT A;  1EUH A;  4LH2 A;  2Y51 A;  4GHK A;  2BJK A;  4JBE A;  1UXN A;  4GO0 A;  4QGK A;  4X4L A;  4I1W A;  3RHQ A;  3V9G A;  3V9K A;  5EXF A;  1A4Z A;  1NZZ A;  4QF6 A;  2ONP A;  2ONO A;  2O2R A;  1BPW A;  1UXQ A;  2VLE A;  5F2C A;  3INL A;  4ZVX A;  4LGZ A;  4V3F A;  4OU2 A;  4QYJ A;  1AD3 A;  3SZB A;  4NMJ A;  4PXL B;  5AC0 A;  3N80 A;  3SZ9 A;  3RHD A;  4C3S A;  1EYY A;  2H5G A;  3RHM A;  3PQA A;  2QE0 A;  4V37 A;  5AC2 A;  5L2O A;  4IHI A;  2XDR A;  4ZVY A;  5A2D C;  2WOX A;  3ETF A;  3JZ4 A;  3RHO A;  1UXP A;  3K9D A;  5ABM A;  4X0T A;  4OE4 A;  2JG7 A;  5EUY A;  1UXR A;  4I3U A;  1EZ0 A;  4LH1 A;  4OUB A;  2WME A;  3IWJ A;  5J7I A;  5L13 A;  4I26 A;  3N83 A;  3N82 A;  1O05 A;  4I8P A;  5KJ5 A;  2ILU A;  2EHU A;  4OE2 A;  4I25 A;  1O02 A;  3PRL A;  4A0M A;  1BI9 A;  3VZ1 A;  5J78 A;  4I3X A;  4ZUL A;  5L2N A;  5EYU A;  2Y52 A;  4WJ9 A;  4KNA A;  1AG8 A;  2EIW A;  3RH9 A;  1NZW A;  4CBB A;  2W8P A;  5EEB A;  4ITA A;  4NU9 A;  4V3F C;  2Y53 A;  5EZ4 A;  3EFV A;  1O9J A;  5DBV A;  4WPN A;  4JDC A;  2BHQ A;  4OGD A;  3VZ3 A;  3V9L A;  4NPI A;  2Y5D A;  4YWV A;  4O6R A;  3RHR A;  4I3V A;  4I2R A;  4QTO A;  3RHL A;  5DIB A;  4YWU A;  3RHJ A;  2ONM A;  5KLO A;  3IWK A;  3R31 A;  3ROS A;  2BJA A;  5A2D D;  3INJ A;  5JRY A;  2EHQ A;  4E3X A;  2IY6 A;  2OPX A;  2EJL A;  4PXN A;  3RJL A;  4CAZ A;  4KWG A;  2ESD A;  4I3T A;  2EUH A;  4DAL A;  4GO2 A;  3TY7 A;  4E4G A;  4LEM A;  4ITB A;  4NMK A;  2J5N A;  3R64 A;  4K57 A;  1CW3 A;  4I8Q A;  4ZXU A;  4I3W A;  4OHT A;  4MPY A;  4F3X A;  1WND A;  3V4C A;  3I44 A;  5FHZ A;  4ZVW A;  2D4E A;  3QAN A;  1A4S A;  5KF0 A;  3JU8 A;  4X2Q A;  3N81 A;  4NEA A;  1O04 A;  1QI6 A;  4YWE A;  2IMP A;  4IDM A;  3RHP A;  1UXT A;  3SZA A;  3V9J A;  4DNG A;  4GO4 A;  4ZUK A;  1UXV A;  4QN2 A;  1NZX A;  2HG2 A;  5KLL A;  3V9H A;  4L2O A;  4O5H A;  2ID2 A;  4GNZ A;  2EJ6 A;  4QET A;  4NS3 A;  2J6L A;  1ZUM A;  5L2M A;  4KWF A;  4OE5 A;  1UZB A;  1BXS A;  4QJE A;  1KY8 A;  3MY7 A;  2WME C;  4JZ6 A;  3RHH A;  4FR8 A;  4GO3 A;  4PZ2 A;  4PXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...