5AC2A

Human aldehyde dehydrogenase 1a1 with duocarmycin analog
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
494
structure length
494
Chain Sequence
b'DLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RETINAL DEHYDROGENASE 1
publication title Structural, Biochemical, and Computational Studies Reveal the Mechanism of Selective Aldehyde Dehydrogenase 1A1 Inhibition by Cytotoxic Duocarmycin Analogues.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 187
structure length 494
sequence length 494
ec nomenclature ec 1.2.1.36: Retinal dehydrogenase.
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00171 Aldedh Aldehyde dehydrogenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.309.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 2 Aldehyde Dehydrogenase; Chain A, domain 2 5ac2A02
3.40.605.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 1 Aldehyde Dehydrogenase; Chain A, domain 1 5ac2A01
4I2RA 5A2DA 1BI9A 2ILUA 1UXRA 5L13A 4OHTA 4V3FC 5EZ4A 4ZVXA 3U4JA 4I25A 1KY8A 4E4GA 4GO0A 2BHQA 4OGDA 4FQFA 1UZBA 4GNZA 3INJA 4U3WA 2JG7A 4IYMA 2VLEA 3B4WA 4OE5A 4H73A 4YWEA 4LGZA 4QJEB 4OUBA 3N81A 4ZUKA 1O02A 3V9KA 1UXTA 2W8PA 4C3SA 1T90A 2Y51A 4YWVA 1VLUA 4QGKA 3RHOA 4DNGA 5J78A 4OU2A 4ITAA 3I44A 2EJ6A 2Y52A 4H80A 4IHIA 3SZBA 5L2MA 1O05A 1O20A 4O6RA 4QJEA 3RH9A 1NZXA 4QF6A 5KLLA 2EJDA 2D4EA 4I9BA 4KWGA 4PXNA 4I3UA 4L2OA 4ZULA 3V9JA 4JZ6A 4LH1A 5L2OA 2QE0A 5DBVA 2WMEC 3K9DA 5J7IA 3VZ0A 1BPWA 1A4SA 2ONOA 4NMKA 4YWUA 5KF0A 1UXPA 2BJAA 3RHMA 4NU9A 4DALA 4X4LA 4ZVYA 5J6BA 3RHQA 2O2PA 4I3WA 1QI1A 1WNBA 4I3TA 3RHPA 1EYYA 4QETA 4IDMA 3IWJA 1A4ZA 1UXNA 4WP7A 5KLNA 2XDRA 3VZ2A 4A0MA 5EYUA 4QYJA 4L1OA 2EHUA 2ESDA 2ONMA 4ITBA 4LH3A 2W8RA 2IMPA 4OE4A 3JZ4A 5DIBA 5L2NA 3R64A 2EITA 2BJKA 4CBBA 3MY7A 3N80A 4MPYA 4NPIA 3V4CA 4ZZ7A 2WMEA 4JBEA 4PZ2A 3V9IA 4X0UA 2O2QA 4QN2A 2Y5DA 4LIHA 4O5HA 3V9LA 2J6LA 4I26A 3R31A 5EXFA 1O01A 2Y53A 5KLOA 4OE6A 4X0TA 5AC1A 1WNDA 2IY6A 1EUHA 2J5NA 2BHPA 4PXLA 2J40A 4KNAA 4H7NA 1EZ0A 2EUHA 2EHQA 4V37A 3VZ3A 5EKCA 3K2WA 4QTOA 3N83A 3VZ1A 5KLMA 1O00A 4I1WA 3ZQAA 1QI6A 1AG8A 4IT9A 4WPNA 3RHHA 1O04A 3EK1A 4ZXUA 1AD3A 4WB9A 2W8NA 2ONNA 3JU8A 5A2DD 3RHJA 3QANA 3INLA 4I3XA 1UXUA 4LH0A 4WJ9A 5EUYA 3PRLA 5KLKA 2ID2A 1ZUMA 4I8PA 4LH2A 2OPXA 4PXLB 4KWFA 5EEBA 5AC2A 3IWKA 5EK6A 3PQAA 1O9JA 1UXQA 4GO3A 4OE2A 4GHKA 4GO4A 4X2QA 4E3XA 5A2DC 3SZ9A 1BXSA 4JDCA 4LEMA 5F2CA 4ZWLA 5AC0A 5DRUA 2HG2A 3RHDA 4CAZA 5KJ5A 1NZWA 1NZZA 4NEAA 4NMJA 2W8OA 4MPBA 3ROSA 3RHRA 2VROA 3V9GA 3RHLA 3V9HA 5FHZA 1CW3A 4F3XA 2EIWA 2H5GA 2O2RA 2EIIA 4GO2A 2WOXA 2EJLA 4I8QA 3RJLA 5JRYA 4NS3A 4ZVWA 3N82A 5ABMA 2W8QA 4I3VA 4Q92A 3SZAA 2ONPA 4V3FA 3TY7A 4FR8A 3ETFA 4IDSA 3EFVA 1UXVA 4K57A
chains in the Genus database with same CATH superfamily
4I2RA 5A2DA 1BI9A 2ILUA 1UXRA 5L13A 4OHTA 4V3FC 5EZ4A 4ZVXA 3U4JA 4I25A 1KY8A 4E4GA 4GO0A 2BHQA 4OGDA 4FQFA 1UZBA 4GNZA 3INJA 4U3WA 2JG7A 4IYMA 2VLEA 3B4WA 4OE5A 4H73A 4YWEA 4LGZA 4QJEB 4OUBA 3N81A 4ZUKA 1O02A 3V9KA 1UXTA 2W8PA 4C3SA 1T90A 2Y51A 4YWVA 1VLUA 4QGKA 3RHOA 4DNGA 5J78A 4OU2A 4ITAA 3I44A 2EJ6A 2Y52A 4H80A 4IHIA 3SZBA 5L2MA 1O05A 1O20A 4O6RA 4QJEA 3RH9A 1NZXA 4QF6A 5KLLA 2EJDA 2D4EA 4I9BA 4KWGA 4PXNA 4I3UA 4L2OA 4ZULA 3V9JA 4JZ6A 4LH1A 5L2OA 2QE0A 5DBVA 2WMEC 3K9DA 5J7IA 3VZ0A 1BPWA 1A4SA 2ONOA 4NMKA 4YWUA 5KF0A 1UXPA 2BJAA 3RHMA 4NU9A 4DALA 4X4LA 4ZVYA 5J6BA 3RHQA 2O2PA 4I3WA 1QI1A 1WNBA 4I3TA 3RHPA 1EYYA 4QETA 4IDMA 3IWJA 1A4ZA 1UXNA 4WP7A 5KLNA 2XDRA 3VZ2A 4A0MA 5EYUA 4QYJA 4L1OA 2EHUA 2ESDA 2ONMA 4ITBA 4LH3A 2W8RA 2IMPA 4OE4A 3JZ4A 5DIBA 5L2NA 3R64A 2EITA 2BJKA 4CBBA 3MY7A 3N80A 4MPYA 4NPIA 3V4CA 4ZZ7A 2WMEA 4JBEA 4PZ2A 3V9IA 4X0UA 2O2QA 4QN2A 2Y5DA 4LIHA 4O5HA 3V9LA 2J6LA 4I26A 3R31A 5EXFA 1O01A 2Y53A 5KLOA 4OE6A 4X0TA 5AC1A 1WNDA 2IY6A 1EUHA 2J5NA 2BHPA 4PXLA 2J40A 4KNAA 4H7NA 1EZ0A 2EUHA 2EHQA 4V37A 3VZ3A 5EKCA 3K2WA 4QTOA 3N83A 3VZ1A 5KLMA 1O00A 4I1WA 3ZQAA 1QI6A 1AG8A 4IT9A 4WPNA 3RHHA 1O04A 3EK1A 4ZXUA 1AD3A 4WB9A 2W8NA 2ONNA 3JU8A 5A2DD 3RHJA 3QANA 3INLA 4I3XA 1UXUA 4LH0A 4WJ9A 5EUYA 3PRLA 5KLKA 2ID2A 1ZUMA 4I8PA 4LH2A 2OPXA 4PXLB 4KWFA 5EEBA 5AC2A 3IWKA 5EK6A 3PQAA 1O9JA 1UXQA 4GO3A 4OE2A 4GHKA 4GO4A 4X2QA 4E3XA 5A2DC 3SZ9A 1BXSA 4JDCA 4LEMA 5F2CA 4ZWLA 5AC0A 5DRUA 2HG2A 3RHDA 4CAZA 5KJ5A 1NZWA 1NZZA 4NEAA 4NMJA 2W8OA 4MPBA 3ROSA 3RHRA 2VROA 3V9GA 3RHLA 3V9HA 5FHZA 1CW3A 4F3XA 2EIWA 2H5GA 2O2RA 2EIIA 4GO2A 2WOXA 2EJLA 4I8QA 3RJLA 5JRYA 4NS3A 4ZVWA 3N82A 5ABMA 2W8QA 4I3VA 4Q92A 3SZAA 2ONPA 4V3FA 3TY7A 4FR8A 3ETFA 4IDSA 3EFVA 1UXVA 4K57A
chains in the Genus database with same CATH topology
4I2RA 5A2DA 1BI9A 2ILUA 1UXRA 5L13A 4OHTA 4V3FC 5EZ4A 4ZVXA 3U4JA 4I25A 1KY8A 4E4GA 4GO0A 2BHQA 4OGDA 4FQFA 1UZBA 4GNZA 3INJA 4U3WA 2JG7A 4IYMA 2VLEA 3B4WA 4OE5A 4H73A 4YWEA 4LGZA 4QJEB 4OUBA 3N81A 4ZUKA 1O02A 3V9KA 1UXTA 2W8PA 4C3SA 1T90A 2Y51A 4YWVA 1VLUA 4QGKA 3RHOA 4DNGA 5J78A 4OU2A 4ITAA 3I44A 2EJ6A 2Y52A 4H80A 4IHIA 3SZBA 5L2MA 1O05A 1O20A 4O6RA 4QJEA 3RH9A 1NZXA 4QF6A 5KLLA 2EJDA 2D4EA 4I9BA 4KWGA 4PXNA 4I3UA 4L2OA 4ZULA 3V9JA 4JZ6A 4LH1A 5L2OA 2QE0A 5DBVA 2WMEC 3K9DA 5J7IA 3VZ0A 1BPWA 1A4SA 2ONOA 4NMKA 4YWUA 5KF0A 1UXPA 2BJAA 3RHMA 4NU9A 4DALA 4X4LA 4ZVYA 5J6BA 3RHQA 2O2PA 4I3WA 1QI1A 1WNBA 4I3TA 3RHPA 1EYYA 4QETA 4IDMA 3IWJA 1A4ZA 1UXNA 4WP7A 5KLNA 2XDRA 3VZ2A 4A0MA 5EYUA 4QYJA 4L1OA 2EHUA 2ESDA 2ONMA 4ITBA 4LH3A 2W8RA 2IMPA 4OE4A 3JZ4A 5DIBA 5L2NA 3R64A 2EITA 2BJKA 4CBBA 3MY7A 3N80A 4MPYA 4NPIA 3V4CA 4ZZ7A 2WMEA 4JBEA 4PZ2A 3V9IA 4X0UA 2O2QA 4QN2A 2Y5DA 4LIHA 4O5HA 3V9LA 2J6LA 4I26A 3R31A 5EXFA 1O01A 2Y53A 5KLOA 4OE6A 4X0TA 5AC1A 1WNDA 2IY6A 1EUHA 2J5NA 2BHPA 4PXLA 2J40A 4KNAA 4H7NA 1EZ0A 2EUHA 2EHQA 4V37A 3VZ3A 5EKCA 3K2WA 4QTOA 3N83A 3VZ1A 5KLMA 1O00A 4I1WA 3ZQAA 1QI6A 1AG8A 4IT9A 4WPNA 3RHHA 1O04A 3EK1A 4ZXUA 1AD3A 4WB9A 2W8NA 2ONNA 3JU8A 5A2DD 3RHJA 3QANA 3INLA 4I3XA 1UXUA 4LH0A 4WJ9A 5EUYA 3PRLA 5KLKA 2ID2A 1ZUMA 4I8PA 4LH2A 2OPXA 4PXLB 4KWFA 5EEBA 5AC2A 3IWKA 5EK6A 3PQAA 1O9JA 1UXQA 4GO3A 4OE2A 4GHKA 4GO4A 4X2QA 4E3XA 5A2DC 3SZ9A 1BXSA 4JDCA 4LEMA 5F2CA 4ZWLA 5AC0A 5DRUA 2HG2A 3RHDA 4CAZA 5KJ5A 1NZWA 1NZZA 4NEAA 4NMJA 2W8OA 4MPBA 3ROSA 3RHRA 2VROA 3V9GA 3RHLA 3V9HA 5FHZA 1CW3A 4F3XA 2EIWA 2H5GA 2O2RA 2EIIA 4GO2A 2WOXA 2EJLA 4I8QA 3RJLA 5JRYA 4NS3A 4ZVWA 3N82A 5ABMA 2W8QA 4I3VA 4Q92A 3SZAA 2ONPA 4V3FA 3TY7A 4FR8A 3ETFA 4IDSA 3EFVA 1UXVA 4K57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I2R A;  5A2D A;  1BI9 A;  2ILU A;  1UXR A;  5L13 A;  4OHT A;  4V3F C;  5EZ4 A;  4ZVX A;  3U4J A;  4I25 A;  1KY8 A;  4E4G A;  4GO0 A;  2BHQ A;  4OGD A;  4FQF A;  1UZB A;  4GNZ A;  3INJ A;  4U3W A;  2JG7 A;  4IYM A;  2VLE A;  3B4W A;  4OE5 A;  4H73 A;  4YWE A;  4LGZ A;  4QJE B;  4OUB A;  3N81 A;  4ZUK A;  1O02 A;  3V9K A;  1UXT A;  2W8P A;  4C3S A;  1T90 A;  2Y51 A;  4YWV A;  1VLU A;  4QGK A;  3RHO A;  4DNG A;  5J78 A;  4OU2 A;  4ITA A;  3I44 A;  2EJ6 A;  2Y52 A;  4H80 A;  4IHI A;  3SZB A;  5L2M A;  1O05 A;  1O20 A;  4O6R A;  4QJE A;  3RH9 A;  1NZX A;  4QF6 A;  5KLL A;  2EJD A;  2D4E A;  4I9B A;  4KWG A;  4PXN A;  4I3U A;  4L2O A;  4ZUL A;  3V9J A;  4JZ6 A;  4LH1 A;  5L2O A;  2QE0 A;  5DBV A;  2WME C;  3K9D A;  5J7I A;  3VZ0 A;  1BPW A;  1A4S A;  2ONO A;  4NMK A;  4YWU A;  5KF0 A;  1UXP A;  2BJA A;  3RHM A;  4NU9 A;  4DAL A;  4X4L A;  4ZVY A;  5J6B A;  3RHQ A;  2O2P A;  4I3W A;  1QI1 A;  1WNB A;  4I3T A;  3RHP A;  1EYY A;  4QET A;  4IDM A;  3IWJ A;  1A4Z A;  1UXN A;  4WP7 A;  5KLN A;  2XDR A;  3VZ2 A;  4A0M A;  5EYU A;  4QYJ A;  4L1O A;  2EHU A;  2ESD A;  2ONM A;  4ITB A;  4LH3 A;  2W8R A;  2IMP A;  4OE4 A;  3JZ4 A;  5DIB A;  5L2N A;  3R64 A;  2EIT A;  2BJK A;  4CBB A;  3MY7 A;  3N80 A;  4MPY A;  4NPI A;  3V4C A;  4ZZ7 A;  2WME A;  4JBE A;  4PZ2 A;  3V9I A;  4X0U A;  2O2Q A;  4QN2 A;  2Y5D A;  4LIH A;  4O5H A;  3V9L A;  2J6L A;  4I26 A;  3R31 A;  5EXF A;  1O01 A;  2Y53 A;  5KLO A;  4OE6 A;  4X0T A;  5AC1 A;  1WND A;  2IY6 A;  1EUH A;  2J5N A;  2BHP A;  4PXL A;  2J40 A;  4KNA A;  4H7N A;  1EZ0 A;  2EUH A;  2EHQ A;  4V37 A;  3VZ3 A;  5EKC A;  3K2W A;  4QTO A;  3N83 A;  3VZ1 A;  5KLM A;  1O00 A;  4I1W A;  3ZQA A;  1QI6 A;  1AG8 A;  4IT9 A;  4WPN A;  3RHH A;  1O04 A;  3EK1 A;  4ZXU A;  1AD3 A;  4WB9 A;  2W8N A;  2ONN A;  3JU8 A;  5A2D D;  3RHJ A;  3QAN A;  3INL A;  4I3X A;  1UXU A;  4LH0 A;  4WJ9 A;  5EUY A;  3PRL A;  5KLK A;  2ID2 A;  1ZUM A;  4I8P A;  4LH2 A;  2OPX A;  4PXL B;  4KWF A;  5EEB A;  5AC2 A;  3IWK A;  5EK6 A;  3PQA A;  1O9J A;  1UXQ A;  4GO3 A;  4OE2 A;  4GHK A;  4GO4 A;  4X2Q A;  4E3X A;  5A2D C;  3SZ9 A;  1BXS A;  4JDC A;  4LEM A;  5F2C A;  4ZWL A;  5AC0 A;  5DRU A;  2HG2 A;  3RHD A;  4CAZ A;  5KJ5 A;  1NZW A;  1NZZ A;  4NEA A;  4NMJ A;  2W8O A;  4MPB A;  3ROS A;  3RHR A;  2VRO A;  3V9G A;  3RHL A;  3V9H A;  5FHZ A;  1CW3 A;  4F3X A;  2EIW A;  2H5G A;  2O2R A;  2EII A;  4GO2 A;  2WOX A;  2EJL A;  4I8Q A;  3RJL A;  5JRY A;  4NS3 A;  4ZVW A;  3N82 A;  5ABM A;  2W8Q A;  4I3V A;  4Q92 A;  3SZA A;  2ONP A;  4V3F A;  3TY7 A;  4FR8 A;  3ETF A;  4IDS A;  3EFV A;  1UXV A;  4K57 A; 
#chains in the Genus database with same CATH topology
 4I2R A;  5A2D A;  1BI9 A;  2ILU A;  1UXR A;  5L13 A;  4OHT A;  4V3F C;  5EZ4 A;  4ZVX A;  3U4J A;  4I25 A;  1KY8 A;  4E4G A;  4GO0 A;  2BHQ A;  4OGD A;  4FQF A;  1UZB A;  4GNZ A;  3INJ A;  4U3W A;  2JG7 A;  4IYM A;  2VLE A;  3B4W A;  4OE5 A;  4H73 A;  4YWE A;  4LGZ A;  4QJE B;  4OUB A;  3N81 A;  4ZUK A;  1O02 A;  3V9K A;  1UXT A;  2W8P A;  4C3S A;  1T90 A;  2Y51 A;  4YWV A;  1VLU A;  4QGK A;  3RHO A;  4DNG A;  5J78 A;  4OU2 A;  4ITA A;  3I44 A;  2EJ6 A;  2Y52 A;  4H80 A;  4IHI A;  3SZB A;  5L2M A;  1O05 A;  1O20 A;  4O6R A;  4QJE A;  3RH9 A;  1NZX A;  4QF6 A;  5KLL A;  2EJD A;  2D4E A;  4I9B A;  4KWG A;  4PXN A;  4I3U A;  4L2O A;  4ZUL A;  3V9J A;  4JZ6 A;  4LH1 A;  5L2O A;  2QE0 A;  5DBV A;  2WME C;  3K9D A;  5J7I A;  3VZ0 A;  1BPW A;  1A4S A;  2ONO A;  4NMK A;  4YWU A;  5KF0 A;  1UXP A;  2BJA A;  3RHM A;  4NU9 A;  4DAL A;  4X4L A;  4ZVY A;  5J6B A;  3RHQ A;  2O2P A;  4I3W A;  1QI1 A;  1WNB A;  4I3T A;  3RHP A;  1EYY A;  4QET A;  4IDM A;  3IWJ A;  1A4Z A;  1UXN A;  4WP7 A;  5KLN A;  2XDR A;  3VZ2 A;  4A0M A;  5EYU A;  4QYJ A;  4L1O A;  2EHU A;  2ESD A;  2ONM A;  4ITB A;  4LH3 A;  2W8R A;  2IMP A;  4OE4 A;  3JZ4 A;  5DIB A;  5L2N A;  3R64 A;  2EIT A;  2BJK A;  4CBB A;  3MY7 A;  3N80 A;  4MPY A;  4NPI A;  3V4C A;  4ZZ7 A;  2WME A;  4JBE A;  4PZ2 A;  3V9I A;  4X0U A;  2O2Q A;  4QN2 A;  2Y5D A;  4LIH A;  4O5H A;  3V9L A;  2J6L A;  4I26 A;  3R31 A;  5EXF A;  1O01 A;  2Y53 A;  5KLO A;  4OE6 A;  4X0T A;  5AC1 A;  1WND A;  2IY6 A;  1EUH A;  2J5N A;  2BHP A;  4PXL A;  2J40 A;  4KNA A;  4H7N A;  1EZ0 A;  2EUH A;  2EHQ A;  4V37 A;  3VZ3 A;  5EKC A;  3K2W A;  4QTO A;  3N83 A;  3VZ1 A;  5KLM A;  1O00 A;  4I1W A;  3ZQA A;  1QI6 A;  1AG8 A;  4IT9 A;  4WPN A;  3RHH A;  1O04 A;  3EK1 A;  4ZXU A;  1AD3 A;  4WB9 A;  2W8N A;  2ONN A;  3JU8 A;  5A2D D;  3RHJ A;  3QAN A;  3INL A;  4I3X A;  1UXU A;  4LH0 A;  4WJ9 A;  5EUY A;  3PRL A;  5KLK A;  2ID2 A;  1ZUM A;  4I8P A;  4LH2 A;  2OPX A;  4PXL B;  4KWF A;  5EEB A;  5AC2 A;  3IWK A;  5EK6 A;  3PQA A;  1O9J A;  1UXQ A;  4GO3 A;  4OE2 A;  4GHK A;  4GO4 A;  4X2Q A;  4E3X A;  5A2D C;  3SZ9 A;  1BXS A;  4JDC A;  4LEM A;  5F2C A;  4ZWL A;  5AC0 A;  5DRU A;  2HG2 A;  3RHD A;  4CAZ A;  5KJ5 A;  1NZW A;  1NZZ A;  4NEA A;  4NMJ A;  2W8O A;  4MPB A;  3ROS A;  3RHR A;  2VRO A;  3V9G A;  3RHL A;  3V9H A;  5FHZ A;  1CW3 A;  4F3X A;  2EIW A;  2H5G A;  2O2R A;  2EII A;  4GO2 A;  2WOX A;  2EJL A;  4I8Q A;  3RJL A;  5JRY A;  4NS3 A;  4ZVW A;  3N82 A;  5ABM A;  2W8Q A;  4I3V A;  4Q92 A;  3SZA A;  2ONP A;  4V3F A;  3TY7 A;  4FR8 A;  3ETF A;  4IDS A;  3EFV A;  1UXV A;  4K57 A; 
#chains in the Genus database with same CATH homology
 4I2R A;  5A2D A;  1BI9 A;  2ILU A;  1UXR A;  5L13 A;  4OHT A;  4V3F C;  5EZ4 A;  4ZVX A;  3U4J A;  4I25 A;  1KY8 A;  4E4G A;  4GO0 A;  2BHQ A;  4OGD A;  4FQF A;  1UZB A;  4GNZ A;  3INJ A;  4U3W A;  2JG7 A;  4IYM A;  2VLE A;  3B4W A;  4OE5 A;  4H73 A;  4YWE A;  4LGZ A;  4QJE B;  4OUB A;  3N81 A;  4ZUK A;  1O02 A;  3V9K A;  1UXT A;  2W8P A;  4C3S A;  1T90 A;  2Y51 A;  4YWV A;  1VLU A;  4QGK A;  3RHO A;  4DNG A;  5J78 A;  4OU2 A;  4ITA A;  3I44 A;  2EJ6 A;  2Y52 A;  4H80 A;  4IHI A;  3SZB A;  5L2M A;  1O05 A;  1O20 A;  4O6R A;  4QJE A;  3RH9 A;  1NZX A;  4QF6 A;  5KLL A;  2EJD A;  2D4E A;  4I9B A;  4KWG A;  4PXN A;  4I3U A;  4L2O A;  4ZUL A;  3V9J A;  4JZ6 A;  4LH1 A;  5L2O A;  2QE0 A;  5DBV A;  2WME C;  3K9D A;  5J7I A;  3VZ0 A;  1BPW A;  1A4S A;  2ONO A;  4NMK A;  4YWU A;  5KF0 A;  1UXP A;  2BJA A;  3RHM A;  4NU9 A;  4DAL A;  4X4L A;  4ZVY A;  5J6B A;  3RHQ A;  2O2P A;  4I3W A;  1QI1 A;  1WNB A;  4I3T A;  3RHP A;  1EYY A;  4QET A;  4IDM A;  3IWJ A;  1A4Z A;  1UXN A;  4WP7 A;  5KLN A;  2XDR A;  3VZ2 A;  4A0M A;  5EYU A;  4QYJ A;  4L1O A;  2EHU A;  2ESD A;  2ONM A;  4ITB A;  4LH3 A;  2W8R A;  2IMP A;  4OE4 A;  3JZ4 A;  5DIB A;  5L2N A;  3R64 A;  2EIT A;  2BJK A;  4CBB A;  3MY7 A;  3N80 A;  4MPY A;  4NPI A;  3V4C A;  4ZZ7 A;  2WME A;  4JBE A;  4PZ2 A;  3V9I A;  4X0U A;  2O2Q A;  4QN2 A;  2Y5D A;  4LIH A;  4O5H A;  3V9L A;  2J6L A;  4I26 A;  3R31 A;  5EXF A;  1O01 A;  2Y53 A;  5KLO A;  4OE6 A;  4X0T A;  5AC1 A;  1WND A;  2IY6 A;  1EUH A;  2J5N A;  2BHP A;  4PXL A;  2J40 A;  4KNA A;  4H7N A;  1EZ0 A;  2EUH A;  2EHQ A;  4V37 A;  3VZ3 A;  5EKC A;  3K2W A;  4QTO A;  3N83 A;  3VZ1 A;  5KLM A;  1O00 A;  4I1W A;  3ZQA A;  1QI6 A;  1AG8 A;  4IT9 A;  4WPN A;  3RHH A;  1O04 A;  3EK1 A;  4ZXU A;  1AD3 A;  4WB9 A;  2W8N A;  2ONN A;  3JU8 A;  5A2D D;  3RHJ A;  3QAN A;  3INL A;  4I3X A;  1UXU A;  4LH0 A;  4WJ9 A;  5EUY A;  3PRL A;  5KLK A;  2ID2 A;  1ZUM A;  4I8P A;  4LH2 A;  2OPX A;  4PXL B;  4KWF A;  5EEB A;  5AC2 A;  3IWK A;  5EK6 A;  3PQA A;  1O9J A;  1UXQ A;  4GO3 A;  4OE2 A;  4GHK A;  4GO4 A;  4X2Q A;  4E3X A;  5A2D C;  3SZ9 A;  1BXS A;  4JDC A;  4LEM A;  5F2C A;  4ZWL A;  5AC0 A;  5DRU A;  2HG2 A;  3RHD A;  4CAZ A;  5KJ5 A;  1NZW A;  1NZZ A;  4NEA A;  4NMJ A;  2W8O A;  4MPB A;  3ROS A;  3RHR A;  2VRO A;  3V9G A;  3RHL A;  3V9H A;  5FHZ A;  1CW3 A;  4F3X A;  2EIW A;  2H5G A;  2O2R A;  2EII A;  4GO2 A;  2WOX A;  2EJL A;  4I8Q A;  3RJL A;  5JRY A;  4NS3 A;  4ZVW A;  3N82 A;  5ABM A;  2W8Q A;  4I3V A;  4Q92 A;  3SZA A;  2ONP A;  4V3F A;  3TY7 A;  4FR8 A;  3ETF A;  4IDS A;  3EFV A;  1UXV A;  4K57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...