The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
33
|
sequence length |
88
|
structure length |
88
|
Chain Sequence |
LSASATELLQDYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCINLRQLYGDSRKFLLLGLRPFIPEKDSQHFENFLETIGVKDLE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural Insights into the Molecular Recognition between Cerebral Cavernous Malformation 2 and Mitogen-Activated Protein Kinase Kinase Kinase 3
pubmed doi rcsb |
molecule tags |
Protein binding
|
source organism |
Homo sapiens
|
molecule keywords |
Malcavernin
|
total genus |
33
|
structure length |
88
|
sequence length |
88
|
ec nomenclature | |
pdb deposition date | 2015-03-05 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | Paired amphipathic helix 2 (pah2 repeat) | Paired amphipathic helix 2 (pah2 repeat) |
#chains in the Genus database with same CATH superfamily 4FQN A; 2KBR A; 4YKC A; 3K1R A; 4Y5O A; 4YL6 A; 5F3X A; 4YKD A; 2KBQ A; 2LSR A; #chains in the Genus database with same CATH topology 2CZY A; 2L9S B; 1G1E B; 4Y5O A; 4YKD A; 1E91 A; 2LSR A; 4FQN A; 4YKC A; 1S5Q B; 2CR7 A; 2F05 A; 3K1R A; 4YL6 A; 2KBQ A; 2KBR A; 2RMR A; 2LD7 B; 1S5R B; 2RMS A; 1PD7 A; 5F3X A; #chains in the Genus database with same CATH homology 4FQN A; 2KBR A; 4YKC A; 3K1R A; 4Y5O A; 4YL6 A; 5F3X A; 4YKD A; 2KBQ A; 2LSR A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...