4WB9A

Human aldh1a1 complexed with nadh
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
493
structure length
493
Chain Sequence
LPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Development of a high-throughput in vitro assay to identify selective inhibitors for human ALDH1A1.
pubmed doi rcsb
molecule keywords Retinal dehydrogenase 1
molecule tags Oxidoreductase
source organism Homo sapiens
total genus 183
structure length 493
sequence length 493
ec nomenclature ec 1.2.1.36: Retinal dehydrogenase.
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00171 Aldedh Aldehyde dehydrogenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.309.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 2 Aldehyde Dehydrogenase; Chain A, domain 2 4wb9A02
3.40.605.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 1 Aldehyde Dehydrogenase; Chain A, domain 1 4wb9A01
2IMPA 5KLOA 3K2WA 1WNBA 1A4ZA 4DNGA 2BHPA 2D4EA 2Y53A 5KLKA 4I3WA 4OE2A 2QE0A 3ETFA 4IYMA 2BHQA 4QETA 4I3TA 4I9BA 4QF6A 3RHDA 4GO2A 4KWFA 4PXLA 5F2CA 4ITAA 2W8RA 4MPYA 4OUBA 3RHQA 5KLLA 2ONOA 2W8QA 2WMEA 2EIIA 4K57A 4O6RA 3ROSA 4DALA 2H5GA 3N81A 5A2DA 1O00A 2VLEA 3QANA 2J6LA 2JG7A 4ITBA 1NZZA 2WOXA 4NMKA 3VZ2A 4GNZA 3RHOA 3R64A 4QGKA 3RHMA 2EHQA 1UXVA 1WNDA 4KNAA 4L2OA 4X0TA 4OE4A 4U3WA 3K9DA 2ONNA 4YWVA 1O05A 1KY8A 1EYYA 2EITA 4I1WA 4ZZ7A 5L2MA 3JU8A 5J78A 3R31A 2W8OA 1O01A 3V9GA 5FHZA 1QI1A 2IY6A 4MPBA 5AC1A 4LH0A 5L13A 3SZBA 1ZUMA 4PXNA 1BXSA 4ZVWA 1VLUA 1O04A 1EZ0A 2W8PA 3MY7A 5EK6A 1UZBA 4FQFA 4LGZA 3V9LA 4LEMA 4F3XA 4A0MA 3ZQAA 2Y52A 4I8QA 4V3FC 4PXLB 4ZVXA 3V4CA 3VZ1A 4C3SA 3VZ0A 3U4JA 5EZ4A 4O5HA 4ZULA 4PZ2A 4WPNA 2Y51A 2BJAA 4H7NA 1O02A 1NZXA 4QYJA 2BJKA 4NU9A 4LH2A 4WP7A 4LH1A 4CAZA 4JBEA 1T90A 1CW3A 5J7IA 4ZXUA 3RHHA 4OE5A 3RHLA 4E3XA 1AG8A 3N80A 4YWEA 3N82A 1O20A 4NPIA 4QJEB 4LIHA 4GO3A 2O2PA 3EK1A 4QTOA 5EXFA 2ONPA 4GHKA 4ZUKA 5EUYA 4KWGA 4I8PA 2ESDA 3INJA 3PQAA 2EHUA 4OE6A 4IDMA 4Q92A 4X2QA 1UXTA 3RHPA 1UXPA 4IT9A 3RHRA 3V9HA 2J40A 5EEBA 4ZVYA 3EFVA 4GO4A 1BPWA 2EJ6A 4H80A 4I26A 5EKCA 4V37A 2WMEC 4E4GA 5AC2A 1NZWA 5A2DC 5L2OA 4X0UA 1UXQA 4JDCA 4WB9A 4GO0A 3INLA 3TY7A 4I3VA 2OPXA 1AD3A 4IDSA 3I44A 2ILUA 1O9JA 2EUHA 3PRLA 4IHIA 2Y5DA 4JZ6A 2O2RA 4NMJA 3V9IA 1UXRA 3B4WA 2EJDA 4CBBA 2EJLA 3V9KA 5L2NA 4FR8A 1EUHA 4V3FA 4ZWLA 3RJLA 5JRYA 4QN2A 4NS3A 3SZ9A 4YWUA 2VROA 5DBVA 1BI9A 4X4LA 1QI6A 3IWJA 3N83A 3JZ4A 4OU2A 5KJ5A 5KLMA 3IWKA 2ONMA 1UXUA 5DIBA 4OHTA 5AC0A 4L1OA 2EIWA 4WJ9A 3RH9A 4I3XA 5DRUA 2W8NA 1A4SA 3V9JA 5J6BA 4I25A 5KLNA 2HG2A 1UXNA 2J5NA 2O2QA 4I3UA 5EYUA 4NEAA 3RHJA 4LH3A 3SZAA 2ID2A 4H73A 2XDRA 5ABMA 5KF0A 4OGDA 4QJEA 3VZ3A 5A2DD 4I2RA
chains in the Genus database with same CATH superfamily
2IMPA 5KLOA 3K2WA 1WNBA 1A4ZA 4DNGA 2BHPA 2D4EA 2Y53A 5KLKA 4I3WA 4OE2A 2QE0A 3ETFA 4IYMA 2BHQA 4QETA 4I3TA 4I9BA 4QF6A 3RHDA 4GO2A 4KWFA 4PXLA 5F2CA 4ITAA 2W8RA 4MPYA 4OUBA 3RHQA 5KLLA 2ONOA 2W8QA 2WMEA 2EIIA 4K57A 4O6RA 3ROSA 4DALA 2H5GA 3N81A 5A2DA 1O00A 2VLEA 3QANA 2J6LA 2JG7A 4ITBA 1NZZA 2WOXA 4NMKA 3VZ2A 4GNZA 3RHOA 3R64A 4QGKA 3RHMA 2EHQA 1UXVA 1WNDA 4KNAA 4L2OA 4X0TA 4OE4A 4U3WA 3K9DA 2ONNA 4YWVA 1O05A 1KY8A 1EYYA 2EITA 4I1WA 4ZZ7A 5L2MA 3JU8A 5J78A 3R31A 2W8OA 1O01A 3V9GA 5FHZA 1QI1A 2IY6A 4MPBA 5AC1A 4LH0A 5L13A 3SZBA 1ZUMA 4PXNA 1BXSA 4ZVWA 1VLUA 1O04A 1EZ0A 2W8PA 3MY7A 5EK6A 1UZBA 4FQFA 4LGZA 3V9LA 4LEMA 4F3XA 4A0MA 3ZQAA 2Y52A 4I8QA 4V3FC 4PXLB 4ZVXA 3V4CA 3VZ1A 4C3SA 3VZ0A 3U4JA 5EZ4A 4O5HA 4ZULA 4PZ2A 4WPNA 2Y51A 2BJAA 4H7NA 1O02A 1NZXA 4QYJA 2BJKA 4NU9A 4LH2A 4WP7A 4LH1A 4CAZA 4JBEA 1T90A 1CW3A 5J7IA 4ZXUA 3RHHA 4OE5A 3RHLA 4E3XA 1AG8A 3N80A 4YWEA 3N82A 1O20A 4NPIA 4QJEB 4LIHA 4GO3A 2O2PA 3EK1A 4QTOA 5EXFA 2ONPA 4GHKA 4ZUKA 5EUYA 4KWGA 4I8PA 2ESDA 3INJA 3PQAA 2EHUA 4OE6A 4IDMA 4Q92A 4X2QA 1UXTA 3RHPA 1UXPA 4IT9A 3RHRA 3V9HA 2J40A 5EEBA 4ZVYA 3EFVA 4GO4A 1BPWA 2EJ6A 4H80A 4I26A 5EKCA 4V37A 2WMEC 4E4GA 5AC2A 1NZWA 5A2DC 5L2OA 4X0UA 1UXQA 4JDCA 4WB9A 4GO0A 3INLA 3TY7A 4I3VA 2OPXA 1AD3A 4IDSA 3I44A 2ILUA 1O9JA 2EUHA 3PRLA 4IHIA 2Y5DA 4JZ6A 2O2RA 4NMJA 3V9IA 1UXRA 3B4WA 2EJDA 4CBBA 2EJLA 3V9KA 5L2NA 4FR8A 1EUHA 4V3FA 4ZWLA 3RJLA 5JRYA 4QN2A 4NS3A 3SZ9A 4YWUA 2VROA 5DBVA 1BI9A 4X4LA 1QI6A 3IWJA 3N83A 3JZ4A 4OU2A 5KJ5A 5KLMA 3IWKA 2ONMA 1UXUA 5DIBA 4OHTA 5AC0A 4L1OA 2EIWA 4WJ9A 3RH9A 4I3XA 5DRUA 2W8NA 1A4SA 3V9JA 5J6BA 4I25A 5KLNA 2HG2A 1UXNA 2J5NA 2O2QA 4I3UA 5EYUA 4NEAA 3RHJA 4LH3A 3SZAA 2ID2A 4H73A 2XDRA 5ABMA 5KF0A 4OGDA 4QJEA 3VZ3A 5A2DD 4I2RA
chains in the Genus database with same CATH topology
2IMPA 5KLOA 3K2WA 1WNBA 1A4ZA 4DNGA 2BHPA 2D4EA 2Y53A 5KLKA 4I3WA 4OE2A 2QE0A 3ETFA 4IYMA 2BHQA 4QETA 4I3TA 4I9BA 4QF6A 3RHDA 4GO2A 4KWFA 4PXLA 5F2CA 4ITAA 2W8RA 4MPYA 4OUBA 3RHQA 5KLLA 2ONOA 2W8QA 2WMEA 2EIIA 4K57A 4O6RA 3ROSA 4DALA 2H5GA 3N81A 5A2DA 1O00A 2VLEA 3QANA 2J6LA 2JG7A 4ITBA 1NZZA 2WOXA 4NMKA 3VZ2A 4GNZA 3RHOA 3R64A 4QGKA 3RHMA 2EHQA 1UXVA 1WNDA 4KNAA 4L2OA 4X0TA 4OE4A 4U3WA 3K9DA 2ONNA 4YWVA 1O05A 1KY8A 1EYYA 2EITA 4I1WA 4ZZ7A 5L2MA 3JU8A 5J78A 3R31A 2W8OA 1O01A 3V9GA 5FHZA 1QI1A 2IY6A 4MPBA 5AC1A 4LH0A 5L13A 3SZBA 1ZUMA 4PXNA 1BXSA 4ZVWA 1VLUA 1O04A 1EZ0A 2W8PA 3MY7A 5EK6A 1UZBA 4FQFA 4LGZA 3V9LA 4LEMA 4F3XA 4A0MA 3ZQAA 2Y52A 4I8QA 4V3FC 4PXLB 4ZVXA 3V4CA 3VZ1A 4C3SA 3VZ0A 3U4JA 5EZ4A 4O5HA 4ZULA 4PZ2A 4WPNA 2Y51A 2BJAA 4H7NA 1O02A 1NZXA 4QYJA 2BJKA 4NU9A 4LH2A 4WP7A 4LH1A 4CAZA 4JBEA 1T90A 1CW3A 5J7IA 4ZXUA 3RHHA 4OE5A 3RHLA 4E3XA 1AG8A 3N80A 4YWEA 3N82A 1O20A 4NPIA 4QJEB 4LIHA 4GO3A 2O2PA 3EK1A 4QTOA 5EXFA 2ONPA 4GHKA 4ZUKA 5EUYA 4KWGA 4I8PA 2ESDA 3INJA 3PQAA 2EHUA 4OE6A 4IDMA 4Q92A 4X2QA 1UXTA 3RHPA 1UXPA 4IT9A 3RHRA 3V9HA 2J40A 5EEBA 4ZVYA 3EFVA 4GO4A 1BPWA 2EJ6A 4H80A 4I26A 5EKCA 4V37A 2WMEC 4E4GA 5AC2A 1NZWA 5A2DC 5L2OA 4X0UA 1UXQA 4JDCA 4WB9A 4GO0A 3INLA 3TY7A 4I3VA 2OPXA 1AD3A 4IDSA 3I44A 2ILUA 1O9JA 2EUHA 3PRLA 4IHIA 2Y5DA 4JZ6A 2O2RA 4NMJA 3V9IA 1UXRA 3B4WA 2EJDA 4CBBA 2EJLA 3V9KA 5L2NA 4FR8A 1EUHA 4V3FA 4ZWLA 3RJLA 5JRYA 4QN2A 4NS3A 3SZ9A 4YWUA 2VROA 5DBVA 1BI9A 4X4LA 1QI6A 3IWJA 3N83A 3JZ4A 4OU2A 5KJ5A 5KLMA 3IWKA 2ONMA 1UXUA 5DIBA 4OHTA 5AC0A 4L1OA 2EIWA 4WJ9A 3RH9A 4I3XA 5DRUA 2W8NA 1A4SA 3V9JA 5J6BA 4I25A 5KLNA 2HG2A 1UXNA 2J5NA 2O2QA 4I3UA 5EYUA 4NEAA 3RHJA 4LH3A 3SZAA 2ID2A 4H73A 2XDRA 5ABMA 5KF0A 4OGDA 4QJEA 3VZ3A 5A2DD 4I2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IMP A;  5KLO A;  3K2W A;  1WNB A;  1A4Z A;  4DNG A;  2BHP A;  2D4E A;  2Y53 A;  5KLK A;  4I3W A;  4OE2 A;  2QE0 A;  3ETF A;  4IYM A;  2BHQ A;  4QET A;  4I3T A;  4I9B A;  4QF6 A;  3RHD A;  4GO2 A;  4KWF A;  4PXL A;  5F2C A;  4ITA A;  2W8R A;  4MPY A;  4OUB A;  3RHQ A;  5KLL A;  2ONO A;  2W8Q A;  2WME A;  2EII A;  4K57 A;  4O6R A;  3ROS A;  4DAL A;  2H5G A;  3N81 A;  5A2D A;  1O00 A;  2VLE A;  3QAN A;  2J6L A;  2JG7 A;  4ITB A;  1NZZ A;  2WOX A;  4NMK A;  3VZ2 A;  4GNZ A;  3RHO A;  3R64 A;  4QGK A;  3RHM A;  2EHQ A;  1UXV A;  1WND A;  4KNA A;  4L2O A;  4X0T A;  4OE4 A;  4U3W A;  3K9D A;  2ONN A;  4YWV A;  1O05 A;  1KY8 A;  1EYY A;  2EIT A;  4I1W A;  4ZZ7 A;  5L2M A;  3JU8 A;  5J78 A;  3R31 A;  2W8O A;  1O01 A;  3V9G A;  5FHZ A;  1QI1 A;  2IY6 A;  4MPB A;  5AC1 A;  4LH0 A;  5L13 A;  3SZB A;  1ZUM A;  4PXN A;  1BXS A;  4ZVW A;  1VLU A;  1O04 A;  1EZ0 A;  2W8P A;  3MY7 A;  5EK6 A;  1UZB A;  4FQF A;  4LGZ A;  3V9L A;  4LEM A;  4F3X A;  4A0M A;  3ZQA A;  2Y52 A;  4I8Q A;  4V3F C;  4PXL B;  4ZVX A;  3V4C A;  3VZ1 A;  4C3S A;  3VZ0 A;  3U4J A;  5EZ4 A;  4O5H A;  4ZUL A;  4PZ2 A;  4WPN A;  2Y51 A;  2BJA A;  4H7N A;  1O02 A;  1NZX A;  4QYJ A;  2BJK A;  4NU9 A;  4LH2 A;  4WP7 A;  4LH1 A;  4CAZ A;  4JBE A;  1T90 A;  1CW3 A;  5J7I A;  4ZXU A;  3RHH A;  4OE5 A;  3RHL A;  4E3X A;  1AG8 A;  3N80 A;  4YWE A;  3N82 A;  1O20 A;  4NPI A;  4QJE B;  4LIH A;  4GO3 A;  2O2P A;  3EK1 A;  4QTO A;  5EXF A;  2ONP A;  4GHK A;  4ZUK A;  5EUY A;  4KWG A;  4I8P A;  2ESD A;  3INJ A;  3PQA A;  2EHU A;  4OE6 A;  4IDM A;  4Q92 A;  4X2Q A;  1UXT A;  3RHP A;  1UXP A;  4IT9 A;  3RHR A;  3V9H A;  2J40 A;  5EEB A;  4ZVY A;  3EFV A;  4GO4 A;  1BPW A;  2EJ6 A;  4H80 A;  4I26 A;  5EKC A;  4V37 A;  2WME C;  4E4G A;  5AC2 A;  1NZW A;  5A2D C;  5L2O A;  4X0U A;  1UXQ A;  4JDC A;  4WB9 A;  4GO0 A;  3INL A;  3TY7 A;  4I3V A;  2OPX A;  1AD3 A;  4IDS A;  3I44 A;  2ILU A;  1O9J A;  2EUH A;  3PRL A;  4IHI A;  2Y5D A;  4JZ6 A;  2O2R A;  4NMJ A;  3V9I A;  1UXR A;  3B4W A;  2EJD A;  4CBB A;  2EJL A;  3V9K A;  5L2N A;  4FR8 A;  1EUH A;  4V3F A;  4ZWL A;  3RJL A;  5JRY A;  4QN2 A;  4NS3 A;  3SZ9 A;  4YWU A;  2VRO A;  5DBV A;  1BI9 A;  4X4L A;  1QI6 A;  3IWJ A;  3N83 A;  3JZ4 A;  4OU2 A;  5KJ5 A;  5KLM A;  3IWK A;  2ONM A;  1UXU A;  5DIB A;  4OHT A;  5AC0 A;  4L1O A;  2EIW A;  4WJ9 A;  3RH9 A;  4I3X A;  5DRU A;  2W8N A;  1A4S A;  3V9J A;  5J6B A;  4I25 A;  5KLN A;  2HG2 A;  1UXN A;  2J5N A;  2O2Q A;  4I3U A;  5EYU A;  4NEA A;  3RHJ A;  4LH3 A;  3SZA A;  2ID2 A;  4H73 A;  2XDR A;  5ABM A;  5KF0 A;  4OGD A;  4QJE A;  3VZ3 A;  5A2D D;  4I2R A; 
#chains in the Genus database with same CATH topology
 2IMP A;  5KLO A;  3K2W A;  1WNB A;  1A4Z A;  4DNG A;  2BHP A;  2D4E A;  2Y53 A;  5KLK A;  4I3W A;  4OE2 A;  2QE0 A;  3ETF A;  4IYM A;  2BHQ A;  4QET A;  4I3T A;  4I9B A;  4QF6 A;  3RHD A;  4GO2 A;  4KWF A;  4PXL A;  5F2C A;  4ITA A;  2W8R A;  4MPY A;  4OUB A;  3RHQ A;  5KLL A;  2ONO A;  2W8Q A;  2WME A;  2EII A;  4K57 A;  4O6R A;  3ROS A;  4DAL A;  2H5G A;  3N81 A;  5A2D A;  1O00 A;  2VLE A;  3QAN A;  2J6L A;  2JG7 A;  4ITB A;  1NZZ A;  2WOX A;  4NMK A;  3VZ2 A;  4GNZ A;  3RHO A;  3R64 A;  4QGK A;  3RHM A;  2EHQ A;  1UXV A;  1WND A;  4KNA A;  4L2O A;  4X0T A;  4OE4 A;  4U3W A;  3K9D A;  2ONN A;  4YWV A;  1O05 A;  1KY8 A;  1EYY A;  2EIT A;  4I1W A;  4ZZ7 A;  5L2M A;  3JU8 A;  5J78 A;  3R31 A;  2W8O A;  1O01 A;  3V9G A;  5FHZ A;  1QI1 A;  2IY6 A;  4MPB A;  5AC1 A;  4LH0 A;  5L13 A;  3SZB A;  1ZUM A;  4PXN A;  1BXS A;  4ZVW A;  1VLU A;  1O04 A;  1EZ0 A;  2W8P A;  3MY7 A;  5EK6 A;  1UZB A;  4FQF A;  4LGZ A;  3V9L A;  4LEM A;  4F3X A;  4A0M A;  3ZQA A;  2Y52 A;  4I8Q A;  4V3F C;  4PXL B;  4ZVX A;  3V4C A;  3VZ1 A;  4C3S A;  3VZ0 A;  3U4J A;  5EZ4 A;  4O5H A;  4ZUL A;  4PZ2 A;  4WPN A;  2Y51 A;  2BJA A;  4H7N A;  1O02 A;  1NZX A;  4QYJ A;  2BJK A;  4NU9 A;  4LH2 A;  4WP7 A;  4LH1 A;  4CAZ A;  4JBE A;  1T90 A;  1CW3 A;  5J7I A;  4ZXU A;  3RHH A;  4OE5 A;  3RHL A;  4E3X A;  1AG8 A;  3N80 A;  4YWE A;  3N82 A;  1O20 A;  4NPI A;  4QJE B;  4LIH A;  4GO3 A;  2O2P A;  3EK1 A;  4QTO A;  5EXF A;  2ONP A;  4GHK A;  4ZUK A;  5EUY A;  4KWG A;  4I8P A;  2ESD A;  3INJ A;  3PQA A;  2EHU A;  4OE6 A;  4IDM A;  4Q92 A;  4X2Q A;  1UXT A;  3RHP A;  1UXP A;  4IT9 A;  3RHR A;  3V9H A;  2J40 A;  5EEB A;  4ZVY A;  3EFV A;  4GO4 A;  1BPW A;  2EJ6 A;  4H80 A;  4I26 A;  5EKC A;  4V37 A;  2WME C;  4E4G A;  5AC2 A;  1NZW A;  5A2D C;  5L2O A;  4X0U A;  1UXQ A;  4JDC A;  4WB9 A;  4GO0 A;  3INL A;  3TY7 A;  4I3V A;  2OPX A;  1AD3 A;  4IDS A;  3I44 A;  2ILU A;  1O9J A;  2EUH A;  3PRL A;  4IHI A;  2Y5D A;  4JZ6 A;  2O2R A;  4NMJ A;  3V9I A;  1UXR A;  3B4W A;  2EJD A;  4CBB A;  2EJL A;  3V9K A;  5L2N A;  4FR8 A;  1EUH A;  4V3F A;  4ZWL A;  3RJL A;  5JRY A;  4QN2 A;  4NS3 A;  3SZ9 A;  4YWU A;  2VRO A;  5DBV A;  1BI9 A;  4X4L A;  1QI6 A;  3IWJ A;  3N83 A;  3JZ4 A;  4OU2 A;  5KJ5 A;  5KLM A;  3IWK A;  2ONM A;  1UXU A;  5DIB A;  4OHT A;  5AC0 A;  4L1O A;  2EIW A;  4WJ9 A;  3RH9 A;  4I3X A;  5DRU A;  2W8N A;  1A4S A;  3V9J A;  5J6B A;  4I25 A;  5KLN A;  2HG2 A;  1UXN A;  2J5N A;  2O2Q A;  4I3U A;  5EYU A;  4NEA A;  3RHJ A;  4LH3 A;  3SZA A;  2ID2 A;  4H73 A;  2XDR A;  5ABM A;  5KF0 A;  4OGD A;  4QJE A;  3VZ3 A;  5A2D D;  4I2R A; 
#chains in the Genus database with same CATH homology
 2IMP A;  5KLO A;  3K2W A;  1WNB A;  1A4Z A;  4DNG A;  2BHP A;  2D4E A;  2Y53 A;  5KLK A;  4I3W A;  4OE2 A;  2QE0 A;  3ETF A;  4IYM A;  2BHQ A;  4QET A;  4I3T A;  4I9B A;  4QF6 A;  3RHD A;  4GO2 A;  4KWF A;  4PXL A;  5F2C A;  4ITA A;  2W8R A;  4MPY A;  4OUB A;  3RHQ A;  5KLL A;  2ONO A;  2W8Q A;  2WME A;  2EII A;  4K57 A;  4O6R A;  3ROS A;  4DAL A;  2H5G A;  3N81 A;  5A2D A;  1O00 A;  2VLE A;  3QAN A;  2J6L A;  2JG7 A;  4ITB A;  1NZZ A;  2WOX A;  4NMK A;  3VZ2 A;  4GNZ A;  3RHO A;  3R64 A;  4QGK A;  3RHM A;  2EHQ A;  1UXV A;  1WND A;  4KNA A;  4L2O A;  4X0T A;  4OE4 A;  4U3W A;  3K9D A;  2ONN A;  4YWV A;  1O05 A;  1KY8 A;  1EYY A;  2EIT A;  4I1W A;  4ZZ7 A;  5L2M A;  3JU8 A;  5J78 A;  3R31 A;  2W8O A;  1O01 A;  3V9G A;  5FHZ A;  1QI1 A;  2IY6 A;  4MPB A;  5AC1 A;  4LH0 A;  5L13 A;  3SZB A;  1ZUM A;  4PXN A;  1BXS A;  4ZVW A;  1VLU A;  1O04 A;  1EZ0 A;  2W8P A;  3MY7 A;  5EK6 A;  1UZB A;  4FQF A;  4LGZ A;  3V9L A;  4LEM A;  4F3X A;  4A0M A;  3ZQA A;  2Y52 A;  4I8Q A;  4V3F C;  4PXL B;  4ZVX A;  3V4C A;  3VZ1 A;  4C3S A;  3VZ0 A;  3U4J A;  5EZ4 A;  4O5H A;  4ZUL A;  4PZ2 A;  4WPN A;  2Y51 A;  2BJA A;  4H7N A;  1O02 A;  1NZX A;  4QYJ A;  2BJK A;  4NU9 A;  4LH2 A;  4WP7 A;  4LH1 A;  4CAZ A;  4JBE A;  1T90 A;  1CW3 A;  5J7I A;  4ZXU A;  3RHH A;  4OE5 A;  3RHL A;  4E3X A;  1AG8 A;  3N80 A;  4YWE A;  3N82 A;  1O20 A;  4NPI A;  4QJE B;  4LIH A;  4GO3 A;  2O2P A;  3EK1 A;  4QTO A;  5EXF A;  2ONP A;  4GHK A;  4ZUK A;  5EUY A;  4KWG A;  4I8P A;  2ESD A;  3INJ A;  3PQA A;  2EHU A;  4OE6 A;  4IDM A;  4Q92 A;  4X2Q A;  1UXT A;  3RHP A;  1UXP A;  4IT9 A;  3RHR A;  3V9H A;  2J40 A;  5EEB A;  4ZVY A;  3EFV A;  4GO4 A;  1BPW A;  2EJ6 A;  4H80 A;  4I26 A;  5EKC A;  4V37 A;  2WME C;  4E4G A;  5AC2 A;  1NZW A;  5A2D C;  5L2O A;  4X0U A;  1UXQ A;  4JDC A;  4WB9 A;  4GO0 A;  3INL A;  3TY7 A;  4I3V A;  2OPX A;  1AD3 A;  4IDS A;  3I44 A;  2ILU A;  1O9J A;  2EUH A;  3PRL A;  4IHI A;  2Y5D A;  4JZ6 A;  2O2R A;  4NMJ A;  3V9I A;  1UXR A;  3B4W A;  2EJD A;  4CBB A;  2EJL A;  3V9K A;  5L2N A;  4FR8 A;  1EUH A;  4V3F A;  4ZWL A;  3RJL A;  5JRY A;  4QN2 A;  4NS3 A;  3SZ9 A;  4YWU A;  2VRO A;  5DBV A;  1BI9 A;  4X4L A;  1QI6 A;  3IWJ A;  3N83 A;  3JZ4 A;  4OU2 A;  5KJ5 A;  5KLM A;  3IWK A;  2ONM A;  1UXU A;  5DIB A;  4OHT A;  5AC0 A;  4L1O A;  2EIW A;  4WJ9 A;  3RH9 A;  4I3X A;  5DRU A;  2W8N A;  1A4S A;  3V9J A;  5J6B A;  4I25 A;  5KLN A;  2HG2 A;  1UXN A;  2J5N A;  2O2Q A;  4I3U A;  5EYU A;  4NEA A;  3RHJ A;  4LH3 A;  3SZA A;  2ID2 A;  4H73 A;  2XDR A;  5ABM A;  5KF0 A;  4OGD A;  4QJE A;  3VZ3 A;  5A2D D;  4I2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...