4WPNA

Structure of human aldh1a1 with inhibitor cm053
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
494
structure length
494
Chain Sequence
DLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization of Two Distinct Structural Classes of Selective Aldehyde Dehydrogenase 1A1 Inhibitors.
pubmed doi rcsb
molecule keywords Retinal dehydrogenase 1
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Homo sapiens
total genus 187
structure length 494
sequence length 494
ec nomenclature ec 1.2.1.36: Retinal dehydrogenase.
pdb deposition date 2014-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00171 Aldedh Aldehyde dehydrogenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.309.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 2 Aldehyde Dehydrogenase; Chain A, domain 2 4wpnA02
3.40.605.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 1 Aldehyde Dehydrogenase; Chain A, domain 1 4wpnA01
1UXPA 4MPBA 3RHQA 3K9DA 4CBBA 2J40A 1UXVA 2ONMA 4LH3A 4IHIA 4ZVXA 5AC2A 4GO3A 4GO4A 4I3TA 4I8PA 4I1WA 4NEAA 4KWFA 1AG8A 2W8OA 4L2OA 1QI1A 2W8QA 4O5HA 4H80A 4NU9A 1O04A 2Y51A 3INLA 4ITBA 4WJ9A 2Y52A 1UXTA 3JZ4A 2D4EA 3EFVA 4OE2A 1O05A 4FQFA 4V37A 4X0UA 3V9KA 5A2DD 2W8RA 4GO0A 5KF0A 4LGZA 4CAZA 5KJ5A 3SZ9A 4E3XA 3IWJA 4I3XA 3TY7A 4PXLB 4LH2A 2Y53A 3VZ3A 3R64A 5KLOA 3ZQAA 1WNBA 3RHOA 4IDMA 2ONNA 3V9IA 5A2DA 1O01A 4GHKA 4NPIA 1O9JA 4OE6A 2IMPA 2BHPA 4I26A 2EJ6A 4X0TA 4YWUA 4IYMA 3V9HA 5JRYA 2EJLA 4IT9A 4QJEA 2W8NA 4LH0A 4WP7A 2ONPA 5L13A 2J6LA 5EXFA 5J78A 4OE4A 3RHPA 3R31A 2EJDA 4LIHA 2BJAA 2BHQA 2VROA 4H73A 3SZBA 4JDCA 3VZ0A 4ZULA 3V9GA 5ABMA 4OU2A 5EYUA 2EIIA 4YWEA 1O00A 3RHHA 2EITA 1NZWA 4I25A 2H5GA 4V3FC 3RHJA 4E4GA 3K2WA 1UXRA 4I3WA 3N82A 4I3UA 2O2RA 3QANA 4V3FA 4PXLA 5EZ4A 3RHRA 2EHQA 1NZZA 4QTOA 2W8PA 3RHMA 4C3SA 5DIBA 1EZ0A 3MY7A 2JG7A 4I2RA 5KLKA 3ROSA 4H7NA 5DRUA 5FHZA 3RHDA 2WMEC 4K57A 1O02A 4O6RA 5EUYA 2VLEA 4QYJA 2QE0A 1QI6A 5J7IA 4ZZ7A 1BI9A 4LEMA 4L1OA 3VZ2A 4JZ6A 1BXSA 3V9JA 4ZWLA 4I3VA 1A4ZA 2J5NA 3SZAA 3JU8A 4WPNA 2O2QA 4OUBA 4QN2A 4QETA 4LH1A 2EUHA 1ZUMA 2ID2A 2O2PA 1AD3A 4OGDA 1NZXA 4YWVA 2ESDA 1A4SA 5AC1A 5J6BA 1KY8A 1UXQA 4I9BA 4QGKA 1VLUA 3EK1A 3RH9A 4U3WA 3V9LA 1BPWA 2HG2A 4KNAA 4JBEA 3N81A 2BJKA 4OHTA 4NS3A 4QF6A 4ZVYA 2EHUA 2ILUA 4Q92A 4PZ2A 1UXUA 1T90A 3IWKA 3B4WA 2EIWA 4GO2A 3N80A 5DBVA 5EKCA 1UXNA 4DALA 3PRLA 5KLNA 4I8QA 5EEBA 4KWGA 4NMJA 4OE5A 5F2CA 3RJLA 3U4JA 1O20A 5A2DC 5L2NA 4DNGA 5KLMA 1EYYA 1WNDA 4GNZA 2WOXA 4IDSA 2IY6A 1EUHA 4ZVWA 5AC0A 2WMEA 5L2MA 2Y5DA 5L2OA 2XDRA 3ETFA 3I44A 4ZUKA 4MPYA 2OPXA 4WB9A 2ONOA 4X4LA 3VZ1A 3V4CA 4FR8A 4PXNA 4F3XA 3INJA 5KLLA 4ZXUA 4X2QA 4ITAA 1CW3A 1UZBA 3RHLA 3PQAA 4NMKA 5EK6A 4QJEB 3N83A 4A0MA
chains in the Genus database with same CATH superfamily
1UXPA 4MPBA 3RHQA 3K9DA 4CBBA 2J40A 1UXVA 2ONMA 4LH3A 4IHIA 4ZVXA 5AC2A 4GO3A 4GO4A 4I3TA 4I8PA 4I1WA 4NEAA 4KWFA 1AG8A 2W8OA 4L2OA 1QI1A 2W8QA 4O5HA 4H80A 4NU9A 1O04A 2Y51A 3INLA 4ITBA 4WJ9A 2Y52A 1UXTA 3JZ4A 2D4EA 3EFVA 4OE2A 1O05A 4FQFA 4V37A 4X0UA 3V9KA 5A2DD 2W8RA 4GO0A 5KF0A 4LGZA 4CAZA 5KJ5A 3SZ9A 4E3XA 3IWJA 4I3XA 3TY7A 4PXLB 4LH2A 2Y53A 3VZ3A 3R64A 5KLOA 3ZQAA 1WNBA 3RHOA 4IDMA 2ONNA 3V9IA 5A2DA 1O01A 4GHKA 4NPIA 1O9JA 4OE6A 2IMPA 2BHPA 4I26A 2EJ6A 4X0TA 4YWUA 4IYMA 3V9HA 5JRYA 2EJLA 4IT9A 4QJEA 2W8NA 4LH0A 4WP7A 2ONPA 5L13A 2J6LA 5EXFA 5J78A 4OE4A 3RHPA 3R31A 2EJDA 4LIHA 2BJAA 2BHQA 2VROA 4H73A 3SZBA 4JDCA 3VZ0A 4ZULA 3V9GA 5ABMA 4OU2A 5EYUA 2EIIA 4YWEA 1O00A 3RHHA 2EITA 1NZWA 4I25A 2H5GA 4V3FC 3RHJA 4E4GA 3K2WA 1UXRA 4I3WA 3N82A 4I3UA 2O2RA 3QANA 4V3FA 4PXLA 5EZ4A 3RHRA 2EHQA 1NZZA 4QTOA 2W8PA 3RHMA 4C3SA 5DIBA 1EZ0A 3MY7A 2JG7A 4I2RA 5KLKA 3ROSA 4H7NA 5DRUA 5FHZA 3RHDA 2WMEC 4K57A 1O02A 4O6RA 5EUYA 2VLEA 4QYJA 2QE0A 1QI6A 5J7IA 4ZZ7A 1BI9A 4LEMA 4L1OA 3VZ2A 4JZ6A 1BXSA 3V9JA 4ZWLA 4I3VA 1A4ZA 2J5NA 3SZAA 3JU8A 4WPNA 2O2QA 4OUBA 4QN2A 4QETA 4LH1A 2EUHA 1ZUMA 2ID2A 2O2PA 1AD3A 4OGDA 1NZXA 4YWVA 2ESDA 1A4SA 5AC1A 5J6BA 1KY8A 1UXQA 4I9BA 4QGKA 1VLUA 3EK1A 3RH9A 4U3WA 3V9LA 1BPWA 2HG2A 4KNAA 4JBEA 3N81A 2BJKA 4OHTA 4NS3A 4QF6A 4ZVYA 2EHUA 2ILUA 4Q92A 4PZ2A 1UXUA 1T90A 3IWKA 3B4WA 2EIWA 4GO2A 3N80A 5DBVA 5EKCA 1UXNA 4DALA 3PRLA 5KLNA 4I8QA 5EEBA 4KWGA 4NMJA 4OE5A 5F2CA 3RJLA 3U4JA 1O20A 5A2DC 5L2NA 4DNGA 5KLMA 1EYYA 1WNDA 4GNZA 2WOXA 4IDSA 2IY6A 1EUHA 4ZVWA 5AC0A 2WMEA 5L2MA 2Y5DA 5L2OA 2XDRA 3ETFA 3I44A 4ZUKA 4MPYA 2OPXA 4WB9A 2ONOA 4X4LA 3VZ1A 3V4CA 4FR8A 4PXNA 4F3XA 3INJA 5KLLA 4ZXUA 4X2QA 4ITAA 1CW3A 1UZBA 3RHLA 3PQAA 4NMKA 5EK6A 4QJEB 3N83A 4A0MA
chains in the Genus database with same CATH topology
1UXPA 4MPBA 3RHQA 3K9DA 4CBBA 2J40A 1UXVA 2ONMA 4LH3A 4IHIA 4ZVXA 5AC2A 4GO3A 4GO4A 4I3TA 4I8PA 4I1WA 4NEAA 4KWFA 1AG8A 2W8OA 4L2OA 1QI1A 2W8QA 4O5HA 4H80A 4NU9A 1O04A 2Y51A 3INLA 4ITBA 4WJ9A 2Y52A 1UXTA 3JZ4A 2D4EA 3EFVA 4OE2A 1O05A 4FQFA 4V37A 4X0UA 3V9KA 5A2DD 2W8RA 4GO0A 5KF0A 4LGZA 4CAZA 5KJ5A 3SZ9A 4E3XA 3IWJA 4I3XA 3TY7A 4PXLB 4LH2A 2Y53A 3VZ3A 3R64A 5KLOA 3ZQAA 1WNBA 3RHOA 4IDMA 2ONNA 3V9IA 5A2DA 1O01A 4GHKA 4NPIA 1O9JA 4OE6A 2IMPA 2BHPA 4I26A 2EJ6A 4X0TA 4YWUA 4IYMA 3V9HA 5JRYA 2EJLA 4IT9A 4QJEA 2W8NA 4LH0A 4WP7A 2ONPA 5L13A 2J6LA 5EXFA 5J78A 4OE4A 3RHPA 3R31A 2EJDA 4LIHA 2BJAA 2BHQA 2VROA 4H73A 3SZBA 4JDCA 3VZ0A 4ZULA 3V9GA 5ABMA 4OU2A 5EYUA 2EIIA 4YWEA 1O00A 3RHHA 2EITA 1NZWA 4I25A 2H5GA 4V3FC 3RHJA 4E4GA 3K2WA 1UXRA 4I3WA 3N82A 4I3UA 2O2RA 3QANA 4V3FA 4PXLA 5EZ4A 3RHRA 2EHQA 1NZZA 4QTOA 2W8PA 3RHMA 4C3SA 5DIBA 1EZ0A 3MY7A 2JG7A 4I2RA 5KLKA 3ROSA 4H7NA 5DRUA 5FHZA 3RHDA 2WMEC 4K57A 1O02A 4O6RA 5EUYA 2VLEA 4QYJA 2QE0A 1QI6A 5J7IA 4ZZ7A 1BI9A 4LEMA 4L1OA 3VZ2A 4JZ6A 1BXSA 3V9JA 4ZWLA 4I3VA 1A4ZA 2J5NA 3SZAA 3JU8A 4WPNA 2O2QA 4OUBA 4QN2A 4QETA 4LH1A 2EUHA 1ZUMA 2ID2A 2O2PA 1AD3A 4OGDA 1NZXA 4YWVA 2ESDA 1A4SA 5AC1A 5J6BA 1KY8A 1UXQA 4I9BA 4QGKA 1VLUA 3EK1A 3RH9A 4U3WA 3V9LA 1BPWA 2HG2A 4KNAA 4JBEA 3N81A 2BJKA 4OHTA 4NS3A 4QF6A 4ZVYA 2EHUA 2ILUA 4Q92A 4PZ2A 1UXUA 1T90A 3IWKA 3B4WA 2EIWA 4GO2A 3N80A 5DBVA 5EKCA 1UXNA 4DALA 3PRLA 5KLNA 4I8QA 5EEBA 4KWGA 4NMJA 4OE5A 5F2CA 3RJLA 3U4JA 1O20A 5A2DC 5L2NA 4DNGA 5KLMA 1EYYA 1WNDA 4GNZA 2WOXA 4IDSA 2IY6A 1EUHA 4ZVWA 5AC0A 2WMEA 5L2MA 2Y5DA 5L2OA 2XDRA 3ETFA 3I44A 4ZUKA 4MPYA 2OPXA 4WB9A 2ONOA 4X4LA 3VZ1A 3V4CA 4FR8A 4PXNA 4F3XA 3INJA 5KLLA 4ZXUA 4X2QA 4ITAA 1CW3A 1UZBA 3RHLA 3PQAA 4NMKA 5EK6A 4QJEB 3N83A 4A0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UXP A;  4MPB A;  3RHQ A;  3K9D A;  4CBB A;  2J40 A;  1UXV A;  2ONM A;  4LH3 A;  4IHI A;  4ZVX A;  5AC2 A;  4GO3 A;  4GO4 A;  4I3T A;  4I8P A;  4I1W A;  4NEA A;  4KWF A;  1AG8 A;  2W8O A;  4L2O A;  1QI1 A;  2W8Q A;  4O5H A;  4H80 A;  4NU9 A;  1O04 A;  2Y51 A;  3INL A;  4ITB A;  4WJ9 A;  2Y52 A;  1UXT A;  3JZ4 A;  2D4E A;  3EFV A;  4OE2 A;  1O05 A;  4FQF A;  4V37 A;  4X0U A;  3V9K A;  5A2D D;  2W8R A;  4GO0 A;  5KF0 A;  4LGZ A;  4CAZ A;  5KJ5 A;  3SZ9 A;  4E3X A;  3IWJ A;  4I3X A;  3TY7 A;  4PXL B;  4LH2 A;  2Y53 A;  3VZ3 A;  3R64 A;  5KLO A;  3ZQA A;  1WNB A;  3RHO A;  4IDM A;  2ONN A;  3V9I A;  5A2D A;  1O01 A;  4GHK A;  4NPI A;  1O9J A;  4OE6 A;  2IMP A;  2BHP A;  4I26 A;  2EJ6 A;  4X0T A;  4YWU A;  4IYM A;  3V9H A;  5JRY A;  2EJL A;  4IT9 A;  4QJE A;  2W8N A;  4LH0 A;  4WP7 A;  2ONP A;  5L13 A;  2J6L A;  5EXF A;  5J78 A;  4OE4 A;  3RHP A;  3R31 A;  2EJD A;  4LIH A;  2BJA A;  2BHQ A;  2VRO A;  4H73 A;  3SZB A;  4JDC A;  3VZ0 A;  4ZUL A;  3V9G A;  5ABM A;  4OU2 A;  5EYU A;  2EII A;  4YWE A;  1O00 A;  3RHH A;  2EIT A;  1NZW A;  4I25 A;  2H5G A;  4V3F C;  3RHJ A;  4E4G A;  3K2W A;  1UXR A;  4I3W A;  3N82 A;  4I3U A;  2O2R A;  3QAN A;  4V3F A;  4PXL A;  5EZ4 A;  3RHR A;  2EHQ A;  1NZZ A;  4QTO A;  2W8P A;  3RHM A;  4C3S A;  5DIB A;  1EZ0 A;  3MY7 A;  2JG7 A;  4I2R A;  5KLK A;  3ROS A;  4H7N A;  5DRU A;  5FHZ A;  3RHD A;  2WME C;  4K57 A;  1O02 A;  4O6R A;  5EUY A;  2VLE A;  4QYJ A;  2QE0 A;  1QI6 A;  5J7I A;  4ZZ7 A;  1BI9 A;  4LEM A;  4L1O A;  3VZ2 A;  4JZ6 A;  1BXS A;  3V9J A;  4ZWL A;  4I3V A;  1A4Z A;  2J5N A;  3SZA A;  3JU8 A;  4WPN A;  2O2Q A;  4OUB A;  4QN2 A;  4QET A;  4LH1 A;  2EUH A;  1ZUM A;  2ID2 A;  2O2P A;  1AD3 A;  4OGD A;  1NZX A;  4YWV A;  2ESD A;  1A4S A;  5AC1 A;  5J6B A;  1KY8 A;  1UXQ A;  4I9B A;  4QGK A;  1VLU A;  3EK1 A;  3RH9 A;  4U3W A;  3V9L A;  1BPW A;  2HG2 A;  4KNA A;  4JBE A;  3N81 A;  2BJK A;  4OHT A;  4NS3 A;  4QF6 A;  4ZVY A;  2EHU A;  2ILU A;  4Q92 A;  4PZ2 A;  1UXU A;  1T90 A;  3IWK A;  3B4W A;  2EIW A;  4GO2 A;  3N80 A;  5DBV A;  5EKC A;  1UXN A;  4DAL A;  3PRL A;  5KLN A;  4I8Q A;  5EEB A;  4KWG A;  4NMJ A;  4OE5 A;  5F2C A;  3RJL A;  3U4J A;  1O20 A;  5A2D C;  5L2N A;  4DNG A;  5KLM A;  1EYY A;  1WND A;  4GNZ A;  2WOX A;  4IDS A;  2IY6 A;  1EUH A;  4ZVW A;  5AC0 A;  2WME A;  5L2M A;  2Y5D A;  5L2O A;  2XDR A;  3ETF A;  3I44 A;  4ZUK A;  4MPY A;  2OPX A;  4WB9 A;  2ONO A;  4X4L A;  3VZ1 A;  3V4C A;  4FR8 A;  4PXN A;  4F3X A;  3INJ A;  5KLL A;  4ZXU A;  4X2Q A;  4ITA A;  1CW3 A;  1UZB A;  3RHL A;  3PQA A;  4NMK A;  5EK6 A;  4QJE B;  3N83 A;  4A0M A; 
#chains in the Genus database with same CATH topology
 1UXP A;  4MPB A;  3RHQ A;  3K9D A;  4CBB A;  2J40 A;  1UXV A;  2ONM A;  4LH3 A;  4IHI A;  4ZVX A;  5AC2 A;  4GO3 A;  4GO4 A;  4I3T A;  4I8P A;  4I1W A;  4NEA A;  4KWF A;  1AG8 A;  2W8O A;  4L2O A;  1QI1 A;  2W8Q A;  4O5H A;  4H80 A;  4NU9 A;  1O04 A;  2Y51 A;  3INL A;  4ITB A;  4WJ9 A;  2Y52 A;  1UXT A;  3JZ4 A;  2D4E A;  3EFV A;  4OE2 A;  1O05 A;  4FQF A;  4V37 A;  4X0U A;  3V9K A;  5A2D D;  2W8R A;  4GO0 A;  5KF0 A;  4LGZ A;  4CAZ A;  5KJ5 A;  3SZ9 A;  4E3X A;  3IWJ A;  4I3X A;  3TY7 A;  4PXL B;  4LH2 A;  2Y53 A;  3VZ3 A;  3R64 A;  5KLO A;  3ZQA A;  1WNB A;  3RHO A;  4IDM A;  2ONN A;  3V9I A;  5A2D A;  1O01 A;  4GHK A;  4NPI A;  1O9J A;  4OE6 A;  2IMP A;  2BHP A;  4I26 A;  2EJ6 A;  4X0T A;  4YWU A;  4IYM A;  3V9H A;  5JRY A;  2EJL A;  4IT9 A;  4QJE A;  2W8N A;  4LH0 A;  4WP7 A;  2ONP A;  5L13 A;  2J6L A;  5EXF A;  5J78 A;  4OE4 A;  3RHP A;  3R31 A;  2EJD A;  4LIH A;  2BJA A;  2BHQ A;  2VRO A;  4H73 A;  3SZB A;  4JDC A;  3VZ0 A;  4ZUL A;  3V9G A;  5ABM A;  4OU2 A;  5EYU A;  2EII A;  4YWE A;  1O00 A;  3RHH A;  2EIT A;  1NZW A;  4I25 A;  2H5G A;  4V3F C;  3RHJ A;  4E4G A;  3K2W A;  1UXR A;  4I3W A;  3N82 A;  4I3U A;  2O2R A;  3QAN A;  4V3F A;  4PXL A;  5EZ4 A;  3RHR A;  2EHQ A;  1NZZ A;  4QTO A;  2W8P A;  3RHM A;  4C3S A;  5DIB A;  1EZ0 A;  3MY7 A;  2JG7 A;  4I2R A;  5KLK A;  3ROS A;  4H7N A;  5DRU A;  5FHZ A;  3RHD A;  2WME C;  4K57 A;  1O02 A;  4O6R A;  5EUY A;  2VLE A;  4QYJ A;  2QE0 A;  1QI6 A;  5J7I A;  4ZZ7 A;  1BI9 A;  4LEM A;  4L1O A;  3VZ2 A;  4JZ6 A;  1BXS A;  3V9J A;  4ZWL A;  4I3V A;  1A4Z A;  2J5N A;  3SZA A;  3JU8 A;  4WPN A;  2O2Q A;  4OUB A;  4QN2 A;  4QET A;  4LH1 A;  2EUH A;  1ZUM A;  2ID2 A;  2O2P A;  1AD3 A;  4OGD A;  1NZX A;  4YWV A;  2ESD A;  1A4S A;  5AC1 A;  5J6B A;  1KY8 A;  1UXQ A;  4I9B A;  4QGK A;  1VLU A;  3EK1 A;  3RH9 A;  4U3W A;  3V9L A;  1BPW A;  2HG2 A;  4KNA A;  4JBE A;  3N81 A;  2BJK A;  4OHT A;  4NS3 A;  4QF6 A;  4ZVY A;  2EHU A;  2ILU A;  4Q92 A;  4PZ2 A;  1UXU A;  1T90 A;  3IWK A;  3B4W A;  2EIW A;  4GO2 A;  3N80 A;  5DBV A;  5EKC A;  1UXN A;  4DAL A;  3PRL A;  5KLN A;  4I8Q A;  5EEB A;  4KWG A;  4NMJ A;  4OE5 A;  5F2C A;  3RJL A;  3U4J A;  1O20 A;  5A2D C;  5L2N A;  4DNG A;  5KLM A;  1EYY A;  1WND A;  4GNZ A;  2WOX A;  4IDS A;  2IY6 A;  1EUH A;  4ZVW A;  5AC0 A;  2WME A;  5L2M A;  2Y5D A;  5L2O A;  2XDR A;  3ETF A;  3I44 A;  4ZUK A;  4MPY A;  2OPX A;  4WB9 A;  2ONO A;  4X4L A;  3VZ1 A;  3V4C A;  4FR8 A;  4PXN A;  4F3X A;  3INJ A;  5KLL A;  4ZXU A;  4X2Q A;  4ITA A;  1CW3 A;  1UZB A;  3RHL A;  3PQA A;  4NMK A;  5EK6 A;  4QJE B;  3N83 A;  4A0M A; 
#chains in the Genus database with same CATH homology
 1UXP A;  4MPB A;  3RHQ A;  3K9D A;  4CBB A;  2J40 A;  1UXV A;  2ONM A;  4LH3 A;  4IHI A;  4ZVX A;  5AC2 A;  4GO3 A;  4GO4 A;  4I3T A;  4I8P A;  4I1W A;  4NEA A;  4KWF A;  1AG8 A;  2W8O A;  4L2O A;  1QI1 A;  2W8Q A;  4O5H A;  4H80 A;  4NU9 A;  1O04 A;  2Y51 A;  3INL A;  4ITB A;  4WJ9 A;  2Y52 A;  1UXT A;  3JZ4 A;  2D4E A;  3EFV A;  4OE2 A;  1O05 A;  4FQF A;  4V37 A;  4X0U A;  3V9K A;  5A2D D;  2W8R A;  4GO0 A;  5KF0 A;  4LGZ A;  4CAZ A;  5KJ5 A;  3SZ9 A;  4E3X A;  3IWJ A;  4I3X A;  3TY7 A;  4PXL B;  4LH2 A;  2Y53 A;  3VZ3 A;  3R64 A;  5KLO A;  3ZQA A;  1WNB A;  3RHO A;  4IDM A;  2ONN A;  3V9I A;  5A2D A;  1O01 A;  4GHK A;  4NPI A;  1O9J A;  4OE6 A;  2IMP A;  2BHP A;  4I26 A;  2EJ6 A;  4X0T A;  4YWU A;  4IYM A;  3V9H A;  5JRY A;  2EJL A;  4IT9 A;  4QJE A;  2W8N A;  4LH0 A;  4WP7 A;  2ONP A;  5L13 A;  2J6L A;  5EXF A;  5J78 A;  4OE4 A;  3RHP A;  3R31 A;  2EJD A;  4LIH A;  2BJA A;  2BHQ A;  2VRO A;  4H73 A;  3SZB A;  4JDC A;  3VZ0 A;  4ZUL A;  3V9G A;  5ABM A;  4OU2 A;  5EYU A;  2EII A;  4YWE A;  1O00 A;  3RHH A;  2EIT A;  1NZW A;  4I25 A;  2H5G A;  4V3F C;  3RHJ A;  4E4G A;  3K2W A;  1UXR A;  4I3W A;  3N82 A;  4I3U A;  2O2R A;  3QAN A;  4V3F A;  4PXL A;  5EZ4 A;  3RHR A;  2EHQ A;  1NZZ A;  4QTO A;  2W8P A;  3RHM A;  4C3S A;  5DIB A;  1EZ0 A;  3MY7 A;  2JG7 A;  4I2R A;  5KLK A;  3ROS A;  4H7N A;  5DRU A;  5FHZ A;  3RHD A;  2WME C;  4K57 A;  1O02 A;  4O6R A;  5EUY A;  2VLE A;  4QYJ A;  2QE0 A;  1QI6 A;  5J7I A;  4ZZ7 A;  1BI9 A;  4LEM A;  4L1O A;  3VZ2 A;  4JZ6 A;  1BXS A;  3V9J A;  4ZWL A;  4I3V A;  1A4Z A;  2J5N A;  3SZA A;  3JU8 A;  4WPN A;  2O2Q A;  4OUB A;  4QN2 A;  4QET A;  4LH1 A;  2EUH A;  1ZUM A;  2ID2 A;  2O2P A;  1AD3 A;  4OGD A;  1NZX A;  4YWV A;  2ESD A;  1A4S A;  5AC1 A;  5J6B A;  1KY8 A;  1UXQ A;  4I9B A;  4QGK A;  1VLU A;  3EK1 A;  3RH9 A;  4U3W A;  3V9L A;  1BPW A;  2HG2 A;  4KNA A;  4JBE A;  3N81 A;  2BJK A;  4OHT A;  4NS3 A;  4QF6 A;  4ZVY A;  2EHU A;  2ILU A;  4Q92 A;  4PZ2 A;  1UXU A;  1T90 A;  3IWK A;  3B4W A;  2EIW A;  4GO2 A;  3N80 A;  5DBV A;  5EKC A;  1UXN A;  4DAL A;  3PRL A;  5KLN A;  4I8Q A;  5EEB A;  4KWG A;  4NMJ A;  4OE5 A;  5F2C A;  3RJL A;  3U4J A;  1O20 A;  5A2D C;  5L2N A;  4DNG A;  5KLM A;  1EYY A;  1WND A;  4GNZ A;  2WOX A;  4IDS A;  2IY6 A;  1EUH A;  4ZVW A;  5AC0 A;  2WME A;  5L2M A;  2Y5D A;  5L2O A;  2XDR A;  3ETF A;  3I44 A;  4ZUK A;  4MPY A;  2OPX A;  4WB9 A;  2ONO A;  4X4L A;  3VZ1 A;  3V4C A;  4FR8 A;  4PXN A;  4F3X A;  3INJ A;  5KLL A;  4ZXU A;  4X2Q A;  4ITA A;  1CW3 A;  1UZB A;  3RHL A;  3PQA A;  4NMK A;  5EK6 A;  4QJE B;  3N83 A;  4A0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...