4X2QA

Crystal structure of human aldehyde dehydrogenase, aldh1a2
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
493
structure length
472
Chain Sequence
LPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYGEFGLREYSEVKTVTVKIPQKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and In Vitro Testing of Bisdichloroacetyldiamine Analogs for Use as a Reversible Male Contraceptive
rcsb
molecule keywords Retinal dehydrogenase 2
molecule tags Oxidoreductase
source organism Homo sapiens
total genus 134
structure length 472
sequence length 493
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.36: Retinal dehydrogenase.
pdb deposition date 2014-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00171 Aldedh Aldehyde dehydrogenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.309.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 2 Aldehyde Dehydrogenase; Chain A, domain 2 4x2qA02
3.40.605.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 1 Aldehyde Dehydrogenase; Chain A, domain 1 4x2qA01
4PZ2A 5KLOA 4IT9A 2D4EA 2ESDA 2Y51A 2ONMA 5AC2A 4IDSA 2EHQA 4KWGA 4ZWLA 3VZ2A 1UZBA 5L2OA 3RHLA 2BJKA 3N81A 4I3VA 4I26A 4F3XA 5EZ4A 3K9DA 1QI1A 4YWVA 3PRLA 4PXLA 4QYJA 4DNGA 4CBBA 2OPXA 1AG8A 4GNZA 4V37A 3RHDA 4LH0A 1QI6A 2J40A 2VROA 4H80A 4KWFA 4QTOA 4LEMA 3RHPA 3SZAA 2W8OA 3SZ9A 3V9JA 4QJEA 4U3WA 3V4CA 5A2DD 3INJA 4I9BA 2J6LA 2Y5DA 3K2WA 5L2NA 5DBVA 4NMKA 5L2MA 2O2PA 1UXPA 3RHJA 3ROSA 4KNAA 4GHKA 2Y53A 4Q92A 4X4LA 4ZXUA 2ID2A 1O04A 4L2OA 4NU9A 3VZ3A 5EK6A 4I3WA 4IHIA 4LGZA 5KLLA 4PXLB 3RHRA 5EYUA 4QN2A 4I3XA 1UXUA 3N80A 4I3TA 4O6RA 2BHQA 2IMPA 4OE2A 3RHOA 2EUHA 3IWJA 4ITBA 2ONNA 1WNDA 2WMEC 4QF6A 5EXFA 5J7IA 1T90A 2EJ6A 3RHHA 2ONPA 1A4SA 3SZBA 4GO2A 2O2QA 4I25A 4ZVWA 2J5NA 1BI9A 5KLMA 3JU8A 2ILUA 4ITAA 4DALA 4FR8A 4O5HA 5AC1A 2W8RA 1O01A 4I8QA 2W8QA 4IYMA 4ZUKA 5L13A 2EITA 2HG2A 4JDCA 3INLA 1KY8A 2BHPA 4WB9A 5EEBA 4QETA 4ZVYA 4OUBA 4ZVXA 1NZXA 4JZ6A 2BJAA 4I8PA 4K57A 4WJ9A 3ZQAA 1A4ZA 5KF0A 3I44A 4OE6A 1O00A 3V9KA 4C3SA 1EYYA 5J78A 2XDRA 3R31A 1NZWA 2QE0A 4GO4A 5KLKA 1VLUA 2EHUA 4E4GA 1UXVA 3B4WA 4GO0A 4QJEB 3VZ1A 1NZZA 4OU2A 4PXNA 4X2QA 5DIBA 4CAZA 5AC0A 3N82A 4OGDA 5JRYA 3R64A 2WMEA 4YWEA 3V9HA 4I3UA 5ABMA 3QANA 4NEAA 4X0UA 2O2RA 3U4JA 1ZUMA 1O05A 4LIHA 4WPNA 3TY7A 4LH3A 3RHMA 4NMJA 3RHQA 5F2CA 1CW3A 4YWUA 4LH1A 4X0TA 4I1WA 5KLNA 2IY6A 5A2DC 1O20A 3PQAA 1UXRA 4OE4A 3RJLA 4A0MA 4H7NA 1BXSA 4JBEA 5A2DA 2VLEA 4FQFA 4H73A 2EJDA 3ETFA 4L1OA 4ZULA 3V9GA 1EUHA 1UXQA 2H5GA 4LH2A 4OHTA 3N83A 3V9IA 2W8NA 1UXNA 2JG7A 3EFVA 4V3FC 2EIIA 4NS3A 2Y52A 4MPBA 3MY7A 4MPYA 4IDMA 1O9JA 4OE5A 2WOXA 5DRUA 1O02A 5FHZA 3V9LA 1WNBA 3RH9A 4V3FA 3EK1A 3IWKA 2EJLA 2W8PA 1UXTA 4GO3A 4QGKA 4WP7A 5EKCA 1EZ0A 1BPWA 3VZ0A 2ONOA 4ZZ7A 4NPIA 5EUYA 5J6BA 3JZ4A 4I2RA 5KJ5A 4E3XA 2EIWA 1AD3A
chains in the Genus database with same CATH superfamily
4PZ2A 5KLOA 4IT9A 2D4EA 2ESDA 2Y51A 2ONMA 5AC2A 4IDSA 2EHQA 4KWGA 4ZWLA 3VZ2A 1UZBA 5L2OA 3RHLA 2BJKA 3N81A 4I3VA 4I26A 4F3XA 5EZ4A 3K9DA 1QI1A 4YWVA 3PRLA 4PXLA 4QYJA 4DNGA 4CBBA 2OPXA 1AG8A 4GNZA 4V37A 3RHDA 4LH0A 1QI6A 2J40A 2VROA 4H80A 4KWFA 4QTOA 4LEMA 3RHPA 3SZAA 2W8OA 3SZ9A 3V9JA 4QJEA 4U3WA 3V4CA 5A2DD 3INJA 4I9BA 2J6LA 2Y5DA 3K2WA 5L2NA 5DBVA 4NMKA 5L2MA 2O2PA 1UXPA 3RHJA 3ROSA 4KNAA 4GHKA 2Y53A 4Q92A 4X4LA 4ZXUA 2ID2A 1O04A 4L2OA 4NU9A 3VZ3A 5EK6A 4I3WA 4IHIA 4LGZA 5KLLA 4PXLB 3RHRA 5EYUA 4QN2A 4I3XA 1UXUA 3N80A 4I3TA 4O6RA 2BHQA 2IMPA 4OE2A 3RHOA 2EUHA 3IWJA 4ITBA 2ONNA 1WNDA 2WMEC 4QF6A 5EXFA 5J7IA 1T90A 2EJ6A 3RHHA 2ONPA 1A4SA 3SZBA 4GO2A 2O2QA 4I25A 4ZVWA 2J5NA 1BI9A 5KLMA 3JU8A 2ILUA 4ITAA 4DALA 4FR8A 4O5HA 5AC1A 2W8RA 1O01A 4I8QA 2W8QA 4IYMA 4ZUKA 5L13A 2EITA 2HG2A 4JDCA 3INLA 1KY8A 2BHPA 4WB9A 5EEBA 4QETA 4ZVYA 4OUBA 4ZVXA 1NZXA 4JZ6A 2BJAA 4I8PA 4K57A 4WJ9A 3ZQAA 1A4ZA 5KF0A 3I44A 4OE6A 1O00A 3V9KA 4C3SA 1EYYA 5J78A 2XDRA 3R31A 1NZWA 2QE0A 4GO4A 5KLKA 1VLUA 2EHUA 4E4GA 1UXVA 3B4WA 4GO0A 4QJEB 3VZ1A 1NZZA 4OU2A 4PXNA 4X2QA 5DIBA 4CAZA 5AC0A 3N82A 4OGDA 5JRYA 3R64A 2WMEA 4YWEA 3V9HA 4I3UA 5ABMA 3QANA 4NEAA 4X0UA 2O2RA 3U4JA 1ZUMA 1O05A 4LIHA 4WPNA 3TY7A 4LH3A 3RHMA 4NMJA 3RHQA 5F2CA 1CW3A 4YWUA 4LH1A 4X0TA 4I1WA 5KLNA 2IY6A 5A2DC 1O20A 3PQAA 1UXRA 4OE4A 3RJLA 4A0MA 4H7NA 1BXSA 4JBEA 5A2DA 2VLEA 4FQFA 4H73A 2EJDA 3ETFA 4L1OA 4ZULA 3V9GA 1EUHA 1UXQA 2H5GA 4LH2A 4OHTA 3N83A 3V9IA 2W8NA 1UXNA 2JG7A 3EFVA 4V3FC 2EIIA 4NS3A 2Y52A 4MPBA 3MY7A 4MPYA 4IDMA 1O9JA 4OE5A 2WOXA 5DRUA 1O02A 5FHZA 3V9LA 1WNBA 3RH9A 4V3FA 3EK1A 3IWKA 2EJLA 2W8PA 1UXTA 4GO3A 4QGKA 4WP7A 5EKCA 1EZ0A 1BPWA 3VZ0A 2ONOA 4ZZ7A 4NPIA 5EUYA 5J6BA 3JZ4A 4I2RA 5KJ5A 4E3XA 2EIWA 1AD3A
chains in the Genus database with same CATH topology
4PZ2A 5KLOA 4IT9A 2D4EA 2ESDA 2Y51A 2ONMA 5AC2A 4IDSA 2EHQA 4KWGA 4ZWLA 3VZ2A 1UZBA 5L2OA 3RHLA 2BJKA 3N81A 4I3VA 4I26A 4F3XA 5EZ4A 3K9DA 1QI1A 4YWVA 3PRLA 4PXLA 4QYJA 4DNGA 4CBBA 2OPXA 1AG8A 4GNZA 4V37A 3RHDA 4LH0A 1QI6A 2J40A 2VROA 4H80A 4KWFA 4QTOA 4LEMA 3RHPA 3SZAA 2W8OA 3SZ9A 3V9JA 4QJEA 4U3WA 3V4CA 5A2DD 3INJA 4I9BA 2J6LA 2Y5DA 3K2WA 5L2NA 5DBVA 4NMKA 5L2MA 2O2PA 1UXPA 3RHJA 3ROSA 4KNAA 4GHKA 2Y53A 4Q92A 4X4LA 4ZXUA 2ID2A 1O04A 4L2OA 4NU9A 3VZ3A 5EK6A 4I3WA 4IHIA 4LGZA 5KLLA 4PXLB 3RHRA 5EYUA 4QN2A 4I3XA 1UXUA 3N80A 4I3TA 4O6RA 2BHQA 2IMPA 4OE2A 3RHOA 2EUHA 3IWJA 4ITBA 2ONNA 1WNDA 2WMEC 4QF6A 5EXFA 5J7IA 1T90A 2EJ6A 3RHHA 2ONPA 1A4SA 3SZBA 4GO2A 2O2QA 4I25A 4ZVWA 2J5NA 1BI9A 5KLMA 3JU8A 2ILUA 4ITAA 4DALA 4FR8A 4O5HA 5AC1A 2W8RA 1O01A 4I8QA 2W8QA 4IYMA 4ZUKA 5L13A 2EITA 2HG2A 4JDCA 3INLA 1KY8A 2BHPA 4WB9A 5EEBA 4QETA 4ZVYA 4OUBA 4ZVXA 1NZXA 4JZ6A 2BJAA 4I8PA 4K57A 4WJ9A 3ZQAA 1A4ZA 5KF0A 3I44A 4OE6A 1O00A 3V9KA 4C3SA 1EYYA 5J78A 2XDRA 3R31A 1NZWA 2QE0A 4GO4A 5KLKA 1VLUA 2EHUA 4E4GA 1UXVA 3B4WA 4GO0A 4QJEB 3VZ1A 1NZZA 4OU2A 4PXNA 4X2QA 5DIBA 4CAZA 5AC0A 3N82A 4OGDA 5JRYA 3R64A 2WMEA 4YWEA 3V9HA 4I3UA 5ABMA 3QANA 4NEAA 4X0UA 2O2RA 3U4JA 1ZUMA 1O05A 4LIHA 4WPNA 3TY7A 4LH3A 3RHMA 4NMJA 3RHQA 5F2CA 1CW3A 4YWUA 4LH1A 4X0TA 4I1WA 5KLNA 2IY6A 5A2DC 1O20A 3PQAA 1UXRA 4OE4A 3RJLA 4A0MA 4H7NA 1BXSA 4JBEA 5A2DA 2VLEA 4FQFA 4H73A 2EJDA 3ETFA 4L1OA 4ZULA 3V9GA 1EUHA 1UXQA 2H5GA 4LH2A 4OHTA 3N83A 3V9IA 2W8NA 1UXNA 2JG7A 3EFVA 4V3FC 2EIIA 4NS3A 2Y52A 4MPBA 3MY7A 4MPYA 4IDMA 1O9JA 4OE5A 2WOXA 5DRUA 1O02A 5FHZA 3V9LA 1WNBA 3RH9A 4V3FA 3EK1A 3IWKA 2EJLA 2W8PA 1UXTA 4GO3A 4QGKA 4WP7A 5EKCA 1EZ0A 1BPWA 3VZ0A 2ONOA 4ZZ7A 4NPIA 5EUYA 5J6BA 3JZ4A 4I2RA 5KJ5A 4E3XA 2EIWA 1AD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PZ2 A;  5KLO A;  4IT9 A;  2D4E A;  2ESD A;  2Y51 A;  2ONM A;  5AC2 A;  4IDS A;  2EHQ A;  4KWG A;  4ZWL A;  3VZ2 A;  1UZB A;  5L2O A;  3RHL A;  2BJK A;  3N81 A;  4I3V A;  4I26 A;  4F3X A;  5EZ4 A;  3K9D A;  1QI1 A;  4YWV A;  3PRL A;  4PXL A;  4QYJ A;  4DNG A;  4CBB A;  2OPX A;  1AG8 A;  4GNZ A;  4V37 A;  3RHD A;  4LH0 A;  1QI6 A;  2J40 A;  2VRO A;  4H80 A;  4KWF A;  4QTO A;  4LEM A;  3RHP A;  3SZA A;  2W8O A;  3SZ9 A;  3V9J A;  4QJE A;  4U3W A;  3V4C A;  5A2D D;  3INJ A;  4I9B A;  2J6L A;  2Y5D A;  3K2W A;  5L2N A;  5DBV A;  4NMK A;  5L2M A;  2O2P A;  1UXP A;  3RHJ A;  3ROS A;  4KNA A;  4GHK A;  2Y53 A;  4Q92 A;  4X4L A;  4ZXU A;  2ID2 A;  1O04 A;  4L2O A;  4NU9 A;  3VZ3 A;  5EK6 A;  4I3W A;  4IHI A;  4LGZ A;  5KLL A;  4PXL B;  3RHR A;  5EYU A;  4QN2 A;  4I3X A;  1UXU A;  3N80 A;  4I3T A;  4O6R A;  2BHQ A;  2IMP A;  4OE2 A;  3RHO A;  2EUH A;  3IWJ A;  4ITB A;  2ONN A;  1WND A;  2WME C;  4QF6 A;  5EXF A;  5J7I A;  1T90 A;  2EJ6 A;  3RHH A;  2ONP A;  1A4S A;  3SZB A;  4GO2 A;  2O2Q A;  4I25 A;  4ZVW A;  2J5N A;  1BI9 A;  5KLM A;  3JU8 A;  2ILU A;  4ITA A;  4DAL A;  4FR8 A;  4O5H A;  5AC1 A;  2W8R A;  1O01 A;  4I8Q A;  2W8Q A;  4IYM A;  4ZUK A;  5L13 A;  2EIT A;  2HG2 A;  4JDC A;  3INL A;  1KY8 A;  2BHP A;  4WB9 A;  5EEB A;  4QET A;  4ZVY A;  4OUB A;  4ZVX A;  1NZX A;  4JZ6 A;  2BJA A;  4I8P A;  4K57 A;  4WJ9 A;  3ZQA A;  1A4Z A;  5KF0 A;  3I44 A;  4OE6 A;  1O00 A;  3V9K A;  4C3S A;  1EYY A;  5J78 A;  2XDR A;  3R31 A;  1NZW A;  2QE0 A;  4GO4 A;  5KLK A;  1VLU A;  2EHU A;  4E4G A;  1UXV A;  3B4W A;  4GO0 A;  4QJE B;  3VZ1 A;  1NZZ A;  4OU2 A;  4PXN A;  4X2Q A;  5DIB A;  4CAZ A;  5AC0 A;  3N82 A;  4OGD A;  5JRY A;  3R64 A;  2WME A;  4YWE A;  3V9H A;  4I3U A;  5ABM A;  3QAN A;  4NEA A;  4X0U A;  2O2R A;  3U4J A;  1ZUM A;  1O05 A;  4LIH A;  4WPN A;  3TY7 A;  4LH3 A;  3RHM A;  4NMJ A;  3RHQ A;  5F2C A;  1CW3 A;  4YWU A;  4LH1 A;  4X0T A;  4I1W A;  5KLN A;  2IY6 A;  5A2D C;  1O20 A;  3PQA A;  1UXR A;  4OE4 A;  3RJL A;  4A0M A;  4H7N A;  1BXS A;  4JBE A;  5A2D A;  2VLE A;  4FQF A;  4H73 A;  2EJD A;  3ETF A;  4L1O A;  4ZUL A;  3V9G A;  1EUH A;  1UXQ A;  2H5G A;  4LH2 A;  4OHT A;  3N83 A;  3V9I A;  2W8N A;  1UXN A;  2JG7 A;  3EFV A;  4V3F C;  2EII A;  4NS3 A;  2Y52 A;  4MPB A;  3MY7 A;  4MPY A;  4IDM A;  1O9J A;  4OE5 A;  2WOX A;  5DRU A;  1O02 A;  5FHZ A;  3V9L A;  1WNB A;  3RH9 A;  4V3F A;  3EK1 A;  3IWK A;  2EJL A;  2W8P A;  1UXT A;  4GO3 A;  4QGK A;  4WP7 A;  5EKC A;  1EZ0 A;  1BPW A;  3VZ0 A;  2ONO A;  4ZZ7 A;  4NPI A;  5EUY A;  5J6B A;  3JZ4 A;  4I2R A;  5KJ5 A;  4E3X A;  2EIW A;  1AD3 A; 
#chains in the Genus database with same CATH topology
 4PZ2 A;  5KLO A;  4IT9 A;  2D4E A;  2ESD A;  2Y51 A;  2ONM A;  5AC2 A;  4IDS A;  2EHQ A;  4KWG A;  4ZWL A;  3VZ2 A;  1UZB A;  5L2O A;  3RHL A;  2BJK A;  3N81 A;  4I3V A;  4I26 A;  4F3X A;  5EZ4 A;  3K9D A;  1QI1 A;  4YWV A;  3PRL A;  4PXL A;  4QYJ A;  4DNG A;  4CBB A;  2OPX A;  1AG8 A;  4GNZ A;  4V37 A;  3RHD A;  4LH0 A;  1QI6 A;  2J40 A;  2VRO A;  4H80 A;  4KWF A;  4QTO A;  4LEM A;  3RHP A;  3SZA A;  2W8O A;  3SZ9 A;  3V9J A;  4QJE A;  4U3W A;  3V4C A;  5A2D D;  3INJ A;  4I9B A;  2J6L A;  2Y5D A;  3K2W A;  5L2N A;  5DBV A;  4NMK A;  5L2M A;  2O2P A;  1UXP A;  3RHJ A;  3ROS A;  4KNA A;  4GHK A;  2Y53 A;  4Q92 A;  4X4L A;  4ZXU A;  2ID2 A;  1O04 A;  4L2O A;  4NU9 A;  3VZ3 A;  5EK6 A;  4I3W A;  4IHI A;  4LGZ A;  5KLL A;  4PXL B;  3RHR A;  5EYU A;  4QN2 A;  4I3X A;  1UXU A;  3N80 A;  4I3T A;  4O6R A;  2BHQ A;  2IMP A;  4OE2 A;  3RHO A;  2EUH A;  3IWJ A;  4ITB A;  2ONN A;  1WND A;  2WME C;  4QF6 A;  5EXF A;  5J7I A;  1T90 A;  2EJ6 A;  3RHH A;  2ONP A;  1A4S A;  3SZB A;  4GO2 A;  2O2Q A;  4I25 A;  4ZVW A;  2J5N A;  1BI9 A;  5KLM A;  3JU8 A;  2ILU A;  4ITA A;  4DAL A;  4FR8 A;  4O5H A;  5AC1 A;  2W8R A;  1O01 A;  4I8Q A;  2W8Q A;  4IYM A;  4ZUK A;  5L13 A;  2EIT A;  2HG2 A;  4JDC A;  3INL A;  1KY8 A;  2BHP A;  4WB9 A;  5EEB A;  4QET A;  4ZVY A;  4OUB A;  4ZVX A;  1NZX A;  4JZ6 A;  2BJA A;  4I8P A;  4K57 A;  4WJ9 A;  3ZQA A;  1A4Z A;  5KF0 A;  3I44 A;  4OE6 A;  1O00 A;  3V9K A;  4C3S A;  1EYY A;  5J78 A;  2XDR A;  3R31 A;  1NZW A;  2QE0 A;  4GO4 A;  5KLK A;  1VLU A;  2EHU A;  4E4G A;  1UXV A;  3B4W A;  4GO0 A;  4QJE B;  3VZ1 A;  1NZZ A;  4OU2 A;  4PXN A;  4X2Q A;  5DIB A;  4CAZ A;  5AC0 A;  3N82 A;  4OGD A;  5JRY A;  3R64 A;  2WME A;  4YWE A;  3V9H A;  4I3U A;  5ABM A;  3QAN A;  4NEA A;  4X0U A;  2O2R A;  3U4J A;  1ZUM A;  1O05 A;  4LIH A;  4WPN A;  3TY7 A;  4LH3 A;  3RHM A;  4NMJ A;  3RHQ A;  5F2C A;  1CW3 A;  4YWU A;  4LH1 A;  4X0T A;  4I1W A;  5KLN A;  2IY6 A;  5A2D C;  1O20 A;  3PQA A;  1UXR A;  4OE4 A;  3RJL A;  4A0M A;  4H7N A;  1BXS A;  4JBE A;  5A2D A;  2VLE A;  4FQF A;  4H73 A;  2EJD A;  3ETF A;  4L1O A;  4ZUL A;  3V9G A;  1EUH A;  1UXQ A;  2H5G A;  4LH2 A;  4OHT A;  3N83 A;  3V9I A;  2W8N A;  1UXN A;  2JG7 A;  3EFV A;  4V3F C;  2EII A;  4NS3 A;  2Y52 A;  4MPB A;  3MY7 A;  4MPY A;  4IDM A;  1O9J A;  4OE5 A;  2WOX A;  5DRU A;  1O02 A;  5FHZ A;  3V9L A;  1WNB A;  3RH9 A;  4V3F A;  3EK1 A;  3IWK A;  2EJL A;  2W8P A;  1UXT A;  4GO3 A;  4QGK A;  4WP7 A;  5EKC A;  1EZ0 A;  1BPW A;  3VZ0 A;  2ONO A;  4ZZ7 A;  4NPI A;  5EUY A;  5J6B A;  3JZ4 A;  4I2R A;  5KJ5 A;  4E3X A;  2EIW A;  1AD3 A; 
#chains in the Genus database with same CATH homology
 4PZ2 A;  5KLO A;  4IT9 A;  2D4E A;  2ESD A;  2Y51 A;  2ONM A;  5AC2 A;  4IDS A;  2EHQ A;  4KWG A;  4ZWL A;  3VZ2 A;  1UZB A;  5L2O A;  3RHL A;  2BJK A;  3N81 A;  4I3V A;  4I26 A;  4F3X A;  5EZ4 A;  3K9D A;  1QI1 A;  4YWV A;  3PRL A;  4PXL A;  4QYJ A;  4DNG A;  4CBB A;  2OPX A;  1AG8 A;  4GNZ A;  4V37 A;  3RHD A;  4LH0 A;  1QI6 A;  2J40 A;  2VRO A;  4H80 A;  4KWF A;  4QTO A;  4LEM A;  3RHP A;  3SZA A;  2W8O A;  3SZ9 A;  3V9J A;  4QJE A;  4U3W A;  3V4C A;  5A2D D;  3INJ A;  4I9B A;  2J6L A;  2Y5D A;  3K2W A;  5L2N A;  5DBV A;  4NMK A;  5L2M A;  2O2P A;  1UXP A;  3RHJ A;  3ROS A;  4KNA A;  4GHK A;  2Y53 A;  4Q92 A;  4X4L A;  4ZXU A;  2ID2 A;  1O04 A;  4L2O A;  4NU9 A;  3VZ3 A;  5EK6 A;  4I3W A;  4IHI A;  4LGZ A;  5KLL A;  4PXL B;  3RHR A;  5EYU A;  4QN2 A;  4I3X A;  1UXU A;  3N80 A;  4I3T A;  4O6R A;  2BHQ A;  2IMP A;  4OE2 A;  3RHO A;  2EUH A;  3IWJ A;  4ITB A;  2ONN A;  1WND A;  2WME C;  4QF6 A;  5EXF A;  5J7I A;  1T90 A;  2EJ6 A;  3RHH A;  2ONP A;  1A4S A;  3SZB A;  4GO2 A;  2O2Q A;  4I25 A;  4ZVW A;  2J5N A;  1BI9 A;  5KLM A;  3JU8 A;  2ILU A;  4ITA A;  4DAL A;  4FR8 A;  4O5H A;  5AC1 A;  2W8R A;  1O01 A;  4I8Q A;  2W8Q A;  4IYM A;  4ZUK A;  5L13 A;  2EIT A;  2HG2 A;  4JDC A;  3INL A;  1KY8 A;  2BHP A;  4WB9 A;  5EEB A;  4QET A;  4ZVY A;  4OUB A;  4ZVX A;  1NZX A;  4JZ6 A;  2BJA A;  4I8P A;  4K57 A;  4WJ9 A;  3ZQA A;  1A4Z A;  5KF0 A;  3I44 A;  4OE6 A;  1O00 A;  3V9K A;  4C3S A;  1EYY A;  5J78 A;  2XDR A;  3R31 A;  1NZW A;  2QE0 A;  4GO4 A;  5KLK A;  1VLU A;  2EHU A;  4E4G A;  1UXV A;  3B4W A;  4GO0 A;  4QJE B;  3VZ1 A;  1NZZ A;  4OU2 A;  4PXN A;  4X2Q A;  5DIB A;  4CAZ A;  5AC0 A;  3N82 A;  4OGD A;  5JRY A;  3R64 A;  2WME A;  4YWE A;  3V9H A;  4I3U A;  5ABM A;  3QAN A;  4NEA A;  4X0U A;  2O2R A;  3U4J A;  1ZUM A;  1O05 A;  4LIH A;  4WPN A;  3TY7 A;  4LH3 A;  3RHM A;  4NMJ A;  3RHQ A;  5F2C A;  1CW3 A;  4YWU A;  4LH1 A;  4X0T A;  4I1W A;  5KLN A;  2IY6 A;  5A2D C;  1O20 A;  3PQA A;  1UXR A;  4OE4 A;  3RJL A;  4A0M A;  4H7N A;  1BXS A;  4JBE A;  5A2D A;  2VLE A;  4FQF A;  4H73 A;  2EJD A;  3ETF A;  4L1O A;  4ZUL A;  3V9G A;  1EUH A;  1UXQ A;  2H5G A;  4LH2 A;  4OHT A;  3N83 A;  3V9I A;  2W8N A;  1UXN A;  2JG7 A;  3EFV A;  4V3F C;  2EII A;  4NS3 A;  2Y52 A;  4MPB A;  3MY7 A;  4MPY A;  4IDM A;  1O9J A;  4OE5 A;  2WOX A;  5DRU A;  1O02 A;  5FHZ A;  3V9L A;  1WNB A;  3RH9 A;  4V3F A;  3EK1 A;  3IWK A;  2EJL A;  2W8P A;  1UXT A;  4GO3 A;  4QGK A;  4WP7 A;  5EKC A;  1EZ0 A;  1BPW A;  3VZ0 A;  2ONO A;  4ZZ7 A;  4NPI A;  5EUY A;  5J6B A;  3JZ4 A;  4I2R A;  5KJ5 A;  4E3X A;  2EIW A;  1AD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...