4YWUA

Structural insight into the substrate inhibition mechanism of nadp+-dependent succinic semialdehyde dehydrogenase from streptococcus pyogenes
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
455
structure length
455
Chain Sequence
AYQTIYPYTNEVLHTFDNMTDQGLADVLERAHLLYKKWRKEDHLEERKAQLHQVANILRRDRDKYAEIMTKDMGKLFTEAQGEVDLCADIADYYADKADEFLMSTPLETDSGQAYYLKQSTGVILAVEPWNFPYYQIMRVFAPNFIVGNPMVLKHASICPRSAQSFEELVLEAGAEAGSITNLFISYDQVSQVIADKRVVGVCLTGSERGGASIAEEAGKNLKKTTLELGGDDAFIILDDADWDQLEKVLYFSRLYNAGQVCTSSKRFIVLDKDYDRFKELLTKVFKTAKWGDPMDPETTLAPLSSAQAKADVLDQIKLALDHGAELVYGGEAIDHPGHFVMPTIIAGLTKDNPIYYQEIFGPVGEIYKVSSEEEAIEVANDSNYGLGGTIFSSNQEHAKAVAAKIETGMSFINSGWTSLPELPFGGIKHSGYGRELSELGFTSFVNEHLIYIPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Succinic semialdehyde dehydrogenase
publication title Structural insight into the substrate inhibition mechanism of NADP(+)-dependent succinic semialdehyde dehydrogenase from Streptococcus pyogenes.
pubmed doi rcsb
source organism Streptococcus pyogenes mgas1882
total genus 166
structure length 455
sequence length 455
chains with identical sequence B
ec nomenclature ec 1.2.1.79: Succinate-semialdehyde dehydrogenase (NADP(+)).
pdb deposition date 2015-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00171 Aldedh Aldehyde dehydrogenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.309.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 2 Aldehyde Dehydrogenase; Chain A, domain 2 4ywuA02
3.40.605.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 1 Aldehyde Dehydrogenase; Chain A, domain 1 4ywuA01
1UXPA 1NZWA 4KNAA 4I8QA 3PQAA 3R64A 5EEBA 1UXVA 4KWFA 3RHMA 2WMEA 4QJEB 3ZQAA 4GHKA 4PXLB 4JZ6A 4QYJA 4X0TA 5F2CA 4NMJA 4I3XA 2EUHA 3V9JA 2W8RA 2ONNA 1UZBA 2ONOA 2J40A 1EUHA 5AC1A 4I8PA 4F3XA 4C3SA 4U3WA 5EK6A 1WNBA 3VZ3A 4DALA 2W8PA 1BXSA 3RHHA 1O01A 4H73A 1A4SA 1QI6A 4I25A 4ITBA 3V9LA 5KLKA 2Y51A 3MY7A 4I3VA 4OE2A 4QF6A 4LH0A 5EXFA 3VZ0A 2VLEA 2EHUA 3VZ1A 1UXNA 2EJ6A 4ZVYA 1EZ0A 4X2QA 3V9KA 3SZAA 2Y52A 5ABMA 4GO0A 3V9GA 4WJ9A 4H80A 3V4CA 4V3FA 3U4JA 4OUBA 4L2OA 2ONPA 4QETA 3RJLA 5J78A 5J6BA 5L2MA 4ZZ7A 4OHTA 4I3UA 2BHQA 4JDCA 1O00A 1BPWA 3N81A 3RHLA 3B4WA 1EYYA 5JRYA 2QE0A 3INLA 4ZVXA 3SZBA 5KLOA 1AD3A 2EHQA 3IWKA 4YWEA 4E4GA 2BJKA 2EJDA 5A2DC 3JU8A 2Y53A 4O5HA 4IHIA 2W8OA 1O9JA 2ID2A 1AG8A 1ZUMA 4GO2A 5EYUA 1CW3A 5AC0A 5KF0A 3VZ2A 5KLMA 4I3WA 4PXNA 4FR8A 4LH3A 3RHDA 4H7NA 4I2RA 4WPNA 2IMPA 4GNZA 4DNGA 4IDSA 4NEAA 2J5NA 4GO4A 4IT9A 2O2PA 2W8QA 4NU9A 3INJA 4QN2A 3JZ4A 4V37A 2EITA 5KJ5A 4QJEA 4PXLA 3QANA 2O2QA 3IWJA 4LIHA 3N83A 4X4LA 5FHZA 1KY8A 3K2WA 4NPIA 4WP7A 5DRUA 1BI9A 3N80A 4OE6A 3RHOA 2ESDA 3K9DA 4QGKA 5DIBA 4L1OA 3N82A 4ITAA 4QTOA 4IYMA 3ROSA 5L2NA 4IDMA 4YWVA 1NZZA 5AC2A 4PZ2A 4YWUA 2O2RA 2W8NA 2VROA 4ZWLA 1UXRA 4CBBA 4MPBA 4ZUKA 4ZULA 3SZ9A 5A2DA 1O20A 3RH9A 4JBEA 4OGDA 5EZ4A 3I44A 4KWGA 4LGZA 5EKCA 4E3XA 4ZXUA 5EUYA 4OE4A 2BHPA 4O6RA 3PRLA 2WOXA 2ILUA 1A4ZA 4I26A 4I3TA 3RHJA 4MPYA 4OE5A 2JG7A 1VLUA 4LEMA 3RHQA 2EIIA 1O02A 5KLLA 3ETFA 4GO3A 4Q92A 2Y5DA 4K57A 3EK1A 1T90A 3EFVA 2H5GA 5L2OA 2IY6A 4LH1A 3R31A 4NMKA 1WNDA 1O05A 5A2DD 2OPXA 2HG2A 4V3FC 3TY7A 3V9IA 4CAZA 4WB9A 3RHRA 5J7IA 2EIWA 1UXTA 4I1WA 4NS3A 4X0UA 1QI1A 4ZVWA 5KLNA 3V9HA 5L13A 2ONMA 4FQFA 2BJAA 4A0MA 2WMEC 2EJLA 1UXQA 5DBVA 1NZXA 1UXUA 2J6LA 4I9BA 4LH2A 4OU2A 2XDRA 3RHPA 2D4EA 1O04A
chains in the Genus database with same CATH superfamily
1UXPA 1NZWA 4KNAA 4I8QA 3PQAA 3R64A 5EEBA 1UXVA 4KWFA 3RHMA 2WMEA 4QJEB 3ZQAA 4GHKA 4PXLB 4JZ6A 4QYJA 4X0TA 5F2CA 4NMJA 4I3XA 2EUHA 3V9JA 2W8RA 2ONNA 1UZBA 2ONOA 2J40A 1EUHA 5AC1A 4I8PA 4F3XA 4C3SA 4U3WA 5EK6A 1WNBA 3VZ3A 4DALA 2W8PA 1BXSA 3RHHA 1O01A 4H73A 1A4SA 1QI6A 4I25A 4ITBA 3V9LA 5KLKA 2Y51A 3MY7A 4I3VA 4OE2A 4QF6A 4LH0A 5EXFA 3VZ0A 2VLEA 2EHUA 3VZ1A 1UXNA 2EJ6A 4ZVYA 1EZ0A 4X2QA 3V9KA 3SZAA 2Y52A 5ABMA 4GO0A 3V9GA 4WJ9A 4H80A 3V4CA 4V3FA 3U4JA 4OUBA 4L2OA 2ONPA 4QETA 3RJLA 5J78A 5J6BA 5L2MA 4ZZ7A 4OHTA 4I3UA 2BHQA 4JDCA 1O00A 1BPWA 3N81A 3RHLA 3B4WA 1EYYA 5JRYA 2QE0A 3INLA 4ZVXA 3SZBA 5KLOA 1AD3A 2EHQA 3IWKA 4YWEA 4E4GA 2BJKA 2EJDA 5A2DC 3JU8A 2Y53A 4O5HA 4IHIA 2W8OA 1O9JA 2ID2A 1AG8A 1ZUMA 4GO2A 5EYUA 1CW3A 5AC0A 5KF0A 3VZ2A 5KLMA 4I3WA 4PXNA 4FR8A 4LH3A 3RHDA 4H7NA 4I2RA 4WPNA 2IMPA 4GNZA 4DNGA 4IDSA 4NEAA 2J5NA 4GO4A 4IT9A 2O2PA 2W8QA 4NU9A 3INJA 4QN2A 3JZ4A 4V37A 2EITA 5KJ5A 4QJEA 4PXLA 3QANA 2O2QA 3IWJA 4LIHA 3N83A 4X4LA 5FHZA 1KY8A 3K2WA 4NPIA 4WP7A 5DRUA 1BI9A 3N80A 4OE6A 3RHOA 2ESDA 3K9DA 4QGKA 5DIBA 4L1OA 3N82A 4ITAA 4QTOA 4IYMA 3ROSA 5L2NA 4IDMA 4YWVA 1NZZA 5AC2A 4PZ2A 4YWUA 2O2RA 2W8NA 2VROA 4ZWLA 1UXRA 4CBBA 4MPBA 4ZUKA 4ZULA 3SZ9A 5A2DA 1O20A 3RH9A 4JBEA 4OGDA 5EZ4A 3I44A 4KWGA 4LGZA 5EKCA 4E3XA 4ZXUA 5EUYA 4OE4A 2BHPA 4O6RA 3PRLA 2WOXA 2ILUA 1A4ZA 4I26A 4I3TA 3RHJA 4MPYA 4OE5A 2JG7A 1VLUA 4LEMA 3RHQA 2EIIA 1O02A 5KLLA 3ETFA 4GO3A 4Q92A 2Y5DA 4K57A 3EK1A 1T90A 3EFVA 2H5GA 5L2OA 2IY6A 4LH1A 3R31A 4NMKA 1WNDA 1O05A 5A2DD 2OPXA 2HG2A 4V3FC 3TY7A 3V9IA 4CAZA 4WB9A 3RHRA 5J7IA 2EIWA 1UXTA 4I1WA 4NS3A 4X0UA 1QI1A 4ZVWA 5KLNA 3V9HA 5L13A 2ONMA 4FQFA 2BJAA 4A0MA 2WMEC 2EJLA 1UXQA 5DBVA 1NZXA 1UXUA 2J6LA 4I9BA 4LH2A 4OU2A 2XDRA 3RHPA 2D4EA 1O04A
chains in the Genus database with same CATH topology
1UXPA 1NZWA 4KNAA 4I8QA 3PQAA 3R64A 5EEBA 1UXVA 4KWFA 3RHMA 2WMEA 4QJEB 3ZQAA 4GHKA 4PXLB 4JZ6A 4QYJA 4X0TA 5F2CA 4NMJA 4I3XA 2EUHA 3V9JA 2W8RA 2ONNA 1UZBA 2ONOA 2J40A 1EUHA 5AC1A 4I8PA 4F3XA 4C3SA 4U3WA 5EK6A 1WNBA 3VZ3A 4DALA 2W8PA 1BXSA 3RHHA 1O01A 4H73A 1A4SA 1QI6A 4I25A 4ITBA 3V9LA 5KLKA 2Y51A 3MY7A 4I3VA 4OE2A 4QF6A 4LH0A 5EXFA 3VZ0A 2VLEA 2EHUA 3VZ1A 1UXNA 2EJ6A 4ZVYA 1EZ0A 4X2QA 3V9KA 3SZAA 2Y52A 5ABMA 4GO0A 3V9GA 4WJ9A 4H80A 3V4CA 4V3FA 3U4JA 4OUBA 4L2OA 2ONPA 4QETA 3RJLA 5J78A 5J6BA 5L2MA 4ZZ7A 4OHTA 4I3UA 2BHQA 4JDCA 1O00A 1BPWA 3N81A 3RHLA 3B4WA 1EYYA 5JRYA 2QE0A 3INLA 4ZVXA 3SZBA 5KLOA 1AD3A 2EHQA 3IWKA 4YWEA 4E4GA 2BJKA 2EJDA 5A2DC 3JU8A 2Y53A 4O5HA 4IHIA 2W8OA 1O9JA 2ID2A 1AG8A 1ZUMA 4GO2A 5EYUA 1CW3A 5AC0A 5KF0A 3VZ2A 5KLMA 4I3WA 4PXNA 4FR8A 4LH3A 3RHDA 4H7NA 4I2RA 4WPNA 2IMPA 4GNZA 4DNGA 4IDSA 4NEAA 2J5NA 4GO4A 4IT9A 2O2PA 2W8QA 4NU9A 3INJA 4QN2A 3JZ4A 4V37A 2EITA 5KJ5A 4QJEA 4PXLA 3QANA 2O2QA 3IWJA 4LIHA 3N83A 4X4LA 5FHZA 1KY8A 3K2WA 4NPIA 4WP7A 5DRUA 1BI9A 3N80A 4OE6A 3RHOA 2ESDA 3K9DA 4QGKA 5DIBA 4L1OA 3N82A 4ITAA 4QTOA 4IYMA 3ROSA 5L2NA 4IDMA 4YWVA 1NZZA 5AC2A 4PZ2A 4YWUA 2O2RA 2W8NA 2VROA 4ZWLA 1UXRA 4CBBA 4MPBA 4ZUKA 4ZULA 3SZ9A 5A2DA 1O20A 3RH9A 4JBEA 4OGDA 5EZ4A 3I44A 4KWGA 4LGZA 5EKCA 4E3XA 4ZXUA 5EUYA 4OE4A 2BHPA 4O6RA 3PRLA 2WOXA 2ILUA 1A4ZA 4I26A 4I3TA 3RHJA 4MPYA 4OE5A 2JG7A 1VLUA 4LEMA 3RHQA 2EIIA 1O02A 5KLLA 3ETFA 4GO3A 4Q92A 2Y5DA 4K57A 3EK1A 1T90A 3EFVA 2H5GA 5L2OA 2IY6A 4LH1A 3R31A 4NMKA 1WNDA 1O05A 5A2DD 2OPXA 2HG2A 4V3FC 3TY7A 3V9IA 4CAZA 4WB9A 3RHRA 5J7IA 2EIWA 1UXTA 4I1WA 4NS3A 4X0UA 1QI1A 4ZVWA 5KLNA 3V9HA 5L13A 2ONMA 4FQFA 2BJAA 4A0MA 2WMEC 2EJLA 1UXQA 5DBVA 1NZXA 1UXUA 2J6LA 4I9BA 4LH2A 4OU2A 2XDRA 3RHPA 2D4EA 1O04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UXP A;  1NZW A;  4KNA A;  4I8Q A;  3PQA A;  3R64 A;  5EEB A;  1UXV A;  4KWF A;  3RHM A;  2WME A;  4QJE B;  3ZQA A;  4GHK A;  4PXL B;  4JZ6 A;  4QYJ A;  4X0T A;  5F2C A;  4NMJ A;  4I3X A;  2EUH A;  3V9J A;  2W8R A;  2ONN A;  1UZB A;  2ONO A;  2J40 A;  1EUH A;  5AC1 A;  4I8P A;  4F3X A;  4C3S A;  4U3W A;  5EK6 A;  1WNB A;  3VZ3 A;  4DAL A;  2W8P A;  1BXS A;  3RHH A;  1O01 A;  4H73 A;  1A4S A;  1QI6 A;  4I25 A;  4ITB A;  3V9L A;  5KLK A;  2Y51 A;  3MY7 A;  4I3V A;  4OE2 A;  4QF6 A;  4LH0 A;  5EXF A;  3VZ0 A;  2VLE A;  2EHU A;  3VZ1 A;  1UXN A;  2EJ6 A;  4ZVY A;  1EZ0 A;  4X2Q A;  3V9K A;  3SZA A;  2Y52 A;  5ABM A;  4GO0 A;  3V9G A;  4WJ9 A;  4H80 A;  3V4C A;  4V3F A;  3U4J A;  4OUB A;  4L2O A;  2ONP A;  4QET A;  3RJL A;  5J78 A;  5J6B A;  5L2M A;  4ZZ7 A;  4OHT A;  4I3U A;  2BHQ A;  4JDC A;  1O00 A;  1BPW A;  3N81 A;  3RHL A;  3B4W A;  1EYY A;  5JRY A;  2QE0 A;  3INL A;  4ZVX A;  3SZB A;  5KLO A;  1AD3 A;  2EHQ A;  3IWK A;  4YWE A;  4E4G A;  2BJK A;  2EJD A;  5A2D C;  3JU8 A;  2Y53 A;  4O5H A;  4IHI A;  2W8O A;  1O9J A;  2ID2 A;  1AG8 A;  1ZUM A;  4GO2 A;  5EYU A;  1CW3 A;  5AC0 A;  5KF0 A;  3VZ2 A;  5KLM A;  4I3W A;  4PXN A;  4FR8 A;  4LH3 A;  3RHD A;  4H7N A;  4I2R A;  4WPN A;  2IMP A;  4GNZ A;  4DNG A;  4IDS A;  4NEA A;  2J5N A;  4GO4 A;  4IT9 A;  2O2P A;  2W8Q A;  4NU9 A;  3INJ A;  4QN2 A;  3JZ4 A;  4V37 A;  2EIT A;  5KJ5 A;  4QJE A;  4PXL A;  3QAN A;  2O2Q A;  3IWJ A;  4LIH A;  3N83 A;  4X4L A;  5FHZ A;  1KY8 A;  3K2W A;  4NPI A;  4WP7 A;  5DRU A;  1BI9 A;  3N80 A;  4OE6 A;  3RHO A;  2ESD A;  3K9D A;  4QGK A;  5DIB A;  4L1O A;  3N82 A;  4ITA A;  4QTO A;  4IYM A;  3ROS A;  5L2N A;  4IDM A;  4YWV A;  1NZZ A;  5AC2 A;  4PZ2 A;  4YWU A;  2O2R A;  2W8N A;  2VRO A;  4ZWL A;  1UXR A;  4CBB A;  4MPB A;  4ZUK A;  4ZUL A;  3SZ9 A;  5A2D A;  1O20 A;  3RH9 A;  4JBE A;  4OGD A;  5EZ4 A;  3I44 A;  4KWG A;  4LGZ A;  5EKC A;  4E3X A;  4ZXU A;  5EUY A;  4OE4 A;  2BHP A;  4O6R A;  3PRL A;  2WOX A;  2ILU A;  1A4Z A;  4I26 A;  4I3T A;  3RHJ A;  4MPY A;  4OE5 A;  2JG7 A;  1VLU A;  4LEM A;  3RHQ A;  2EII A;  1O02 A;  5KLL A;  3ETF A;  4GO3 A;  4Q92 A;  2Y5D A;  4K57 A;  3EK1 A;  1T90 A;  3EFV A;  2H5G A;  5L2O A;  2IY6 A;  4LH1 A;  3R31 A;  4NMK A;  1WND A;  1O05 A;  5A2D D;  2OPX A;  2HG2 A;  4V3F C;  3TY7 A;  3V9I A;  4CAZ A;  4WB9 A;  3RHR A;  5J7I A;  2EIW A;  1UXT A;  4I1W A;  4NS3 A;  4X0U A;  1QI1 A;  4ZVW A;  5KLN A;  3V9H A;  5L13 A;  2ONM A;  4FQF A;  2BJA A;  4A0M A;  2WME C;  2EJL A;  1UXQ A;  5DBV A;  1NZX A;  1UXU A;  2J6L A;  4I9B A;  4LH2 A;  4OU2 A;  2XDR A;  3RHP A;  2D4E A;  1O04 A; 
#chains in the Genus database with same CATH topology
 1UXP A;  1NZW A;  4KNA A;  4I8Q A;  3PQA A;  3R64 A;  5EEB A;  1UXV A;  4KWF A;  3RHM A;  2WME A;  4QJE B;  3ZQA A;  4GHK A;  4PXL B;  4JZ6 A;  4QYJ A;  4X0T A;  5F2C A;  4NMJ A;  4I3X A;  2EUH A;  3V9J A;  2W8R A;  2ONN A;  1UZB A;  2ONO A;  2J40 A;  1EUH A;  5AC1 A;  4I8P A;  4F3X A;  4C3S A;  4U3W A;  5EK6 A;  1WNB A;  3VZ3 A;  4DAL A;  2W8P A;  1BXS A;  3RHH A;  1O01 A;  4H73 A;  1A4S A;  1QI6 A;  4I25 A;  4ITB A;  3V9L A;  5KLK A;  2Y51 A;  3MY7 A;  4I3V A;  4OE2 A;  4QF6 A;  4LH0 A;  5EXF A;  3VZ0 A;  2VLE A;  2EHU A;  3VZ1 A;  1UXN A;  2EJ6 A;  4ZVY A;  1EZ0 A;  4X2Q A;  3V9K A;  3SZA A;  2Y52 A;  5ABM A;  4GO0 A;  3V9G A;  4WJ9 A;  4H80 A;  3V4C A;  4V3F A;  3U4J A;  4OUB A;  4L2O A;  2ONP A;  4QET A;  3RJL A;  5J78 A;  5J6B A;  5L2M A;  4ZZ7 A;  4OHT A;  4I3U A;  2BHQ A;  4JDC A;  1O00 A;  1BPW A;  3N81 A;  3RHL A;  3B4W A;  1EYY A;  5JRY A;  2QE0 A;  3INL A;  4ZVX A;  3SZB A;  5KLO A;  1AD3 A;  2EHQ A;  3IWK A;  4YWE A;  4E4G A;  2BJK A;  2EJD A;  5A2D C;  3JU8 A;  2Y53 A;  4O5H A;  4IHI A;  2W8O A;  1O9J A;  2ID2 A;  1AG8 A;  1ZUM A;  4GO2 A;  5EYU A;  1CW3 A;  5AC0 A;  5KF0 A;  3VZ2 A;  5KLM A;  4I3W A;  4PXN A;  4FR8 A;  4LH3 A;  3RHD A;  4H7N A;  4I2R A;  4WPN A;  2IMP A;  4GNZ A;  4DNG A;  4IDS A;  4NEA A;  2J5N A;  4GO4 A;  4IT9 A;  2O2P A;  2W8Q A;  4NU9 A;  3INJ A;  4QN2 A;  3JZ4 A;  4V37 A;  2EIT A;  5KJ5 A;  4QJE A;  4PXL A;  3QAN A;  2O2Q A;  3IWJ A;  4LIH A;  3N83 A;  4X4L A;  5FHZ A;  1KY8 A;  3K2W A;  4NPI A;  4WP7 A;  5DRU A;  1BI9 A;  3N80 A;  4OE6 A;  3RHO A;  2ESD A;  3K9D A;  4QGK A;  5DIB A;  4L1O A;  3N82 A;  4ITA A;  4QTO A;  4IYM A;  3ROS A;  5L2N A;  4IDM A;  4YWV A;  1NZZ A;  5AC2 A;  4PZ2 A;  4YWU A;  2O2R A;  2W8N A;  2VRO A;  4ZWL A;  1UXR A;  4CBB A;  4MPB A;  4ZUK A;  4ZUL A;  3SZ9 A;  5A2D A;  1O20 A;  3RH9 A;  4JBE A;  4OGD A;  5EZ4 A;  3I44 A;  4KWG A;  4LGZ A;  5EKC A;  4E3X A;  4ZXU A;  5EUY A;  4OE4 A;  2BHP A;  4O6R A;  3PRL A;  2WOX A;  2ILU A;  1A4Z A;  4I26 A;  4I3T A;  3RHJ A;  4MPY A;  4OE5 A;  2JG7 A;  1VLU A;  4LEM A;  3RHQ A;  2EII A;  1O02 A;  5KLL A;  3ETF A;  4GO3 A;  4Q92 A;  2Y5D A;  4K57 A;  3EK1 A;  1T90 A;  3EFV A;  2H5G A;  5L2O A;  2IY6 A;  4LH1 A;  3R31 A;  4NMK A;  1WND A;  1O05 A;  5A2D D;  2OPX A;  2HG2 A;  4V3F C;  3TY7 A;  3V9I A;  4CAZ A;  4WB9 A;  3RHR A;  5J7I A;  2EIW A;  1UXT A;  4I1W A;  4NS3 A;  4X0U A;  1QI1 A;  4ZVW A;  5KLN A;  3V9H A;  5L13 A;  2ONM A;  4FQF A;  2BJA A;  4A0M A;  2WME C;  2EJL A;  1UXQ A;  5DBV A;  1NZX A;  1UXU A;  2J6L A;  4I9B A;  4LH2 A;  4OU2 A;  2XDR A;  3RHP A;  2D4E A;  1O04 A; 
#chains in the Genus database with same CATH homology
 1UXP A;  1NZW A;  4KNA A;  4I8Q A;  3PQA A;  3R64 A;  5EEB A;  1UXV A;  4KWF A;  3RHM A;  2WME A;  4QJE B;  3ZQA A;  4GHK A;  4PXL B;  4JZ6 A;  4QYJ A;  4X0T A;  5F2C A;  4NMJ A;  4I3X A;  2EUH A;  3V9J A;  2W8R A;  2ONN A;  1UZB A;  2ONO A;  2J40 A;  1EUH A;  5AC1 A;  4I8P A;  4F3X A;  4C3S A;  4U3W A;  5EK6 A;  1WNB A;  3VZ3 A;  4DAL A;  2W8P A;  1BXS A;  3RHH A;  1O01 A;  4H73 A;  1A4S A;  1QI6 A;  4I25 A;  4ITB A;  3V9L A;  5KLK A;  2Y51 A;  3MY7 A;  4I3V A;  4OE2 A;  4QF6 A;  4LH0 A;  5EXF A;  3VZ0 A;  2VLE A;  2EHU A;  3VZ1 A;  1UXN A;  2EJ6 A;  4ZVY A;  1EZ0 A;  4X2Q A;  3V9K A;  3SZA A;  2Y52 A;  5ABM A;  4GO0 A;  3V9G A;  4WJ9 A;  4H80 A;  3V4C A;  4V3F A;  3U4J A;  4OUB A;  4L2O A;  2ONP A;  4QET A;  3RJL A;  5J78 A;  5J6B A;  5L2M A;  4ZZ7 A;  4OHT A;  4I3U A;  2BHQ A;  4JDC A;  1O00 A;  1BPW A;  3N81 A;  3RHL A;  3B4W A;  1EYY A;  5JRY A;  2QE0 A;  3INL A;  4ZVX A;  3SZB A;  5KLO A;  1AD3 A;  2EHQ A;  3IWK A;  4YWE A;  4E4G A;  2BJK A;  2EJD A;  5A2D C;  3JU8 A;  2Y53 A;  4O5H A;  4IHI A;  2W8O A;  1O9J A;  2ID2 A;  1AG8 A;  1ZUM A;  4GO2 A;  5EYU A;  1CW3 A;  5AC0 A;  5KF0 A;  3VZ2 A;  5KLM A;  4I3W A;  4PXN A;  4FR8 A;  4LH3 A;  3RHD A;  4H7N A;  4I2R A;  4WPN A;  2IMP A;  4GNZ A;  4DNG A;  4IDS A;  4NEA A;  2J5N A;  4GO4 A;  4IT9 A;  2O2P A;  2W8Q A;  4NU9 A;  3INJ A;  4QN2 A;  3JZ4 A;  4V37 A;  2EIT A;  5KJ5 A;  4QJE A;  4PXL A;  3QAN A;  2O2Q A;  3IWJ A;  4LIH A;  3N83 A;  4X4L A;  5FHZ A;  1KY8 A;  3K2W A;  4NPI A;  4WP7 A;  5DRU A;  1BI9 A;  3N80 A;  4OE6 A;  3RHO A;  2ESD A;  3K9D A;  4QGK A;  5DIB A;  4L1O A;  3N82 A;  4ITA A;  4QTO A;  4IYM A;  3ROS A;  5L2N A;  4IDM A;  4YWV A;  1NZZ A;  5AC2 A;  4PZ2 A;  4YWU A;  2O2R A;  2W8N A;  2VRO A;  4ZWL A;  1UXR A;  4CBB A;  4MPB A;  4ZUK A;  4ZUL A;  3SZ9 A;  5A2D A;  1O20 A;  3RH9 A;  4JBE A;  4OGD A;  5EZ4 A;  3I44 A;  4KWG A;  4LGZ A;  5EKC A;  4E3X A;  4ZXU A;  5EUY A;  4OE4 A;  2BHP A;  4O6R A;  3PRL A;  2WOX A;  2ILU A;  1A4Z A;  4I26 A;  4I3T A;  3RHJ A;  4MPY A;  4OE5 A;  2JG7 A;  1VLU A;  4LEM A;  3RHQ A;  2EII A;  1O02 A;  5KLL A;  3ETF A;  4GO3 A;  4Q92 A;  2Y5D A;  4K57 A;  3EK1 A;  1T90 A;  3EFV A;  2H5G A;  5L2O A;  2IY6 A;  4LH1 A;  3R31 A;  4NMK A;  1WND A;  1O05 A;  5A2D D;  2OPX A;  2HG2 A;  4V3F C;  3TY7 A;  3V9I A;  4CAZ A;  4WB9 A;  3RHR A;  5J7I A;  2EIW A;  1UXT A;  4I1W A;  4NS3 A;  4X0U A;  1QI1 A;  4ZVW A;  5KLN A;  3V9H A;  5L13 A;  2ONM A;  4FQF A;  2BJA A;  4A0M A;  2WME C;  2EJL A;  1UXQ A;  5DBV A;  1NZX A;  1UXU A;  2J6L A;  4I9B A;  4LH2 A;  4OU2 A;  2XDR A;  3RHP A;  2D4E A;  1O04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...