4YWVA

Structural insight into the substrate inhibition mechanism of nadp+-dependent succinic semialdehyde dehydrogenase from streptococcus pyogenes
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
455
structure length
455
Chain Sequence
AYQTIYPYTNEVLHTFDNMTDQGLADVLERAHLLYKKWRKEDHLEERKAQLHQVANILRRDRDKYAEIMTKDMGKLFTEAQGEVDLCADIADYYADKADEFLMSTPLETDSGQAYYLKQSTGVILAVEPWNFPYYQIMRVFAPNFIVGNPMVLKHASICPRSAQSFEELVLEAGAEAGSITNLFISYDQVSQVIADKRVVGVCLTGSERGGASIAEEAGKNLKKTTLELGGDDAFIILDDADWDQLEKVLYFSRLYNAGQVCTSSKRFIVLDKDYDRFKELLTKVFKTAKWGDPMDPETTLAPLSSAQAKADVLDQIKLALDHGAELVYGGEAIDHPGHFVMPTIIAGLTKDNPIYYQEIFGPVGEIYKVSSEEEAIEVANDSNYGLGGTIFSSNQEHAKAVAAKIETGMSFINSGWTSLPELPFGGIKHSGYGRELSELGFTSFVNEHLIYIPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Succinic semialdehyde dehydrogenase
publication title Structural insight into the substrate inhibition mechanism of NADP(+)-dependent succinic semialdehyde dehydrogenase from Streptococcus pyogenes.
pubmed doi rcsb
source organism Streptococcus pyogenes mgas1882
total genus 163
structure length 455
sequence length 455
chains with identical sequence B
ec nomenclature ec 1.2.1.79: Succinate-semialdehyde dehydrogenase (NADP(+)).
pdb deposition date 2015-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00171 Aldedh Aldehyde dehydrogenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.309.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 2 Aldehyde Dehydrogenase; Chain A, domain 2 4ywvA02
3.40.605.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 1 Aldehyde Dehydrogenase; Chain A, domain 1 4ywvA01
1O02A 5AC2A 2Y51A 1BPWA 4IT9A 1O01A 2BJKA 2EHUA 4O5HA 5ABMA 2VLEA 4ITAA 4NS3A 2W8NA 5A2DA 4X4LA 3TY7A 3N81A 4I1WA 1UXQA 3MY7A 4JBEA 4OE2A 3SZAA 2WMEC 3N80A 4I9BA 4V3FC 2O2PA 3QANA 4X0TA 4E3XA 4IYMA 5AC1A 4KWFA 4WPNA 4K57A 3ROSA 2EHQA 4DALA 4OE6A 4GNZA 4ZZ7A 2J5NA 3K2WA 2H5GA 4GHKA 5EKCA 4DNGA 4I3VA 5A2DD 3VZ2A 4QETA 4ZVWA 2ONNA 1KY8A 4L1OA 4I8PA 4PXLB 4PXNA 4QYJA 4A0MA 4I26A 4GO3A 4IDSA 2QE0A 1WNDA 3RHHA 2O2QA 5F2CA 3V9JA 3V9IA 4ZWLA 1EUHA 1EYYA 3RJLA 3IWKA 4QGKA 1O05A 4H7NA 4NPIA 5KF0A 4LH3A 2VROA 3PRLA 4LIHA 3RHRA 2ONOA 5J6BA 3VZ0A 1BI9A 2W8OA 2JG7A 4I3TA 1QI1A 3N83A 4JDCA 2J40A 4I25A 5L2MA 1A4ZA 1BXSA 4YWEA 5J7IA 4OU2A 4QJEB 2IY6A 5DRUA 1CW3A 4CBBA 5J78A 2EIWA 4OE5A 4LGZA 4OE4A 3U4JA 2O2RA 5AC0A 5L2OA 4MPBA 3INLA 4ZVYA 1AG8A 4ITBA 4ZXUA 5A2DC 4L2OA 3EK1A 5EUYA 4GO4A 4ZVXA 3PQAA 3RHLA 3V9GA 4YWVA 5EK6A 2WOXA 1NZZA 5KLOA 1UXVA 4OGDA 4QN2A 4QTOA 1UXUA 4F3XA 4NMJA 1O00A 3JU8A 4ZULA 5KLNA 3B4WA 2Y5DA 4PXLA 3V4CA 3ZQAA 4NEAA 3V9HA 3IWJA 1T90A 3SZBA 4WB9A 3R64A 4I2RA 3INJA 1NZWA 2BJAA 3RHDA 4X2QA 3RHMA 2EIIA 3RH9A 3R31A 4FR8A 3V9KA 3EFVA 4ZUKA 2ESDA 4U3WA 4Q92A 3ETFA 1O20A 4GO2A 3RHQA 3RHJA 1VLUA 2WMEA 1UXNA 4I3XA 1QI6A 4V3FA 2J6LA 4LH1A 5JRYA 5EXFA 2BHPA 4LH2A 4QJEA 2OPXA 4IDMA 4NMKA 2ONMA 3RHOA 5L13A 4WJ9A 1AD3A 4WP7A 1UZBA 3SZ9A 4OUBA 1ZUMA 2EJ6A 2EUHA 1WNBA 5EEBA 4H73A 5L2NA 2EITA 4GO0A 4JZ6A 3V9LA 4CAZA 4OHTA 2IMPA 3I44A 4O6RA 3VZ3A 4V37A 1O9JA 2W8PA 3VZ1A 1O04A 2Y53A 5KLKA 1UXPA 4NU9A 1A4SA 3RHPA 5DBVA 5KJ5A 4KNAA 2W8QA 5DIBA 4YWUA 2EJLA 4FQFA 4KWGA 4PZ2A 5KLLA 2BHQA 5EYUA 4LEMA 5EZ4A 4H80A 4LH0A 3K9DA 2D4EA 2ID2A 4I3WA 4IHIA 4E4GA 1EZ0A 1UXTA 2EJDA 4X0UA 2ILUA 1UXRA 4QF6A 1NZXA 2HG2A 4C3SA 2Y52A 4I8QA 5KLMA 4MPYA 2XDRA 2ONPA 3N82A 4I3UA 2W8RA 5FHZA 3JZ4A
chains in the Genus database with same CATH superfamily
1O02A 5AC2A 2Y51A 1BPWA 4IT9A 1O01A 2BJKA 2EHUA 4O5HA 5ABMA 2VLEA 4ITAA 4NS3A 2W8NA 5A2DA 4X4LA 3TY7A 3N81A 4I1WA 1UXQA 3MY7A 4JBEA 4OE2A 3SZAA 2WMEC 3N80A 4I9BA 4V3FC 2O2PA 3QANA 4X0TA 4E3XA 4IYMA 5AC1A 4KWFA 4WPNA 4K57A 3ROSA 2EHQA 4DALA 4OE6A 4GNZA 4ZZ7A 2J5NA 3K2WA 2H5GA 4GHKA 5EKCA 4DNGA 4I3VA 5A2DD 3VZ2A 4QETA 4ZVWA 2ONNA 1KY8A 4L1OA 4I8PA 4PXLB 4PXNA 4QYJA 4A0MA 4I26A 4GO3A 4IDSA 2QE0A 1WNDA 3RHHA 2O2QA 5F2CA 3V9JA 3V9IA 4ZWLA 1EUHA 1EYYA 3RJLA 3IWKA 4QGKA 1O05A 4H7NA 4NPIA 5KF0A 4LH3A 2VROA 3PRLA 4LIHA 3RHRA 2ONOA 5J6BA 3VZ0A 1BI9A 2W8OA 2JG7A 4I3TA 1QI1A 3N83A 4JDCA 2J40A 4I25A 5L2MA 1A4ZA 1BXSA 4YWEA 5J7IA 4OU2A 4QJEB 2IY6A 5DRUA 1CW3A 4CBBA 5J78A 2EIWA 4OE5A 4LGZA 4OE4A 3U4JA 2O2RA 5AC0A 5L2OA 4MPBA 3INLA 4ZVYA 1AG8A 4ITBA 4ZXUA 5A2DC 4L2OA 3EK1A 5EUYA 4GO4A 4ZVXA 3PQAA 3RHLA 3V9GA 4YWVA 5EK6A 2WOXA 1NZZA 5KLOA 1UXVA 4OGDA 4QN2A 4QTOA 1UXUA 4F3XA 4NMJA 1O00A 3JU8A 4ZULA 5KLNA 3B4WA 2Y5DA 4PXLA 3V4CA 3ZQAA 4NEAA 3V9HA 3IWJA 1T90A 3SZBA 4WB9A 3R64A 4I2RA 3INJA 1NZWA 2BJAA 3RHDA 4X2QA 3RHMA 2EIIA 3RH9A 3R31A 4FR8A 3V9KA 3EFVA 4ZUKA 2ESDA 4U3WA 4Q92A 3ETFA 1O20A 4GO2A 3RHQA 3RHJA 1VLUA 2WMEA 1UXNA 4I3XA 1QI6A 4V3FA 2J6LA 4LH1A 5JRYA 5EXFA 2BHPA 4LH2A 4QJEA 2OPXA 4IDMA 4NMKA 2ONMA 3RHOA 5L13A 4WJ9A 1AD3A 4WP7A 1UZBA 3SZ9A 4OUBA 1ZUMA 2EJ6A 2EUHA 1WNBA 5EEBA 4H73A 5L2NA 2EITA 4GO0A 4JZ6A 3V9LA 4CAZA 4OHTA 2IMPA 3I44A 4O6RA 3VZ3A 4V37A 1O9JA 2W8PA 3VZ1A 1O04A 2Y53A 5KLKA 1UXPA 4NU9A 1A4SA 3RHPA 5DBVA 5KJ5A 4KNAA 2W8QA 5DIBA 4YWUA 2EJLA 4FQFA 4KWGA 4PZ2A 5KLLA 2BHQA 5EYUA 4LEMA 5EZ4A 4H80A 4LH0A 3K9DA 2D4EA 2ID2A 4I3WA 4IHIA 4E4GA 1EZ0A 1UXTA 2EJDA 4X0UA 2ILUA 1UXRA 4QF6A 1NZXA 2HG2A 4C3SA 2Y52A 4I8QA 5KLMA 4MPYA 2XDRA 2ONPA 3N82A 4I3UA 2W8RA 5FHZA 3JZ4A
chains in the Genus database with same CATH topology
1O02A 5AC2A 2Y51A 1BPWA 4IT9A 1O01A 2BJKA 2EHUA 4O5HA 5ABMA 2VLEA 4ITAA 4NS3A 2W8NA 5A2DA 4X4LA 3TY7A 3N81A 4I1WA 1UXQA 3MY7A 4JBEA 4OE2A 3SZAA 2WMEC 3N80A 4I9BA 4V3FC 2O2PA 3QANA 4X0TA 4E3XA 4IYMA 5AC1A 4KWFA 4WPNA 4K57A 3ROSA 2EHQA 4DALA 4OE6A 4GNZA 4ZZ7A 2J5NA 3K2WA 2H5GA 4GHKA 5EKCA 4DNGA 4I3VA 5A2DD 3VZ2A 4QETA 4ZVWA 2ONNA 1KY8A 4L1OA 4I8PA 4PXLB 4PXNA 4QYJA 4A0MA 4I26A 4GO3A 4IDSA 2QE0A 1WNDA 3RHHA 2O2QA 5F2CA 3V9JA 3V9IA 4ZWLA 1EUHA 1EYYA 3RJLA 3IWKA 4QGKA 1O05A 4H7NA 4NPIA 5KF0A 4LH3A 2VROA 3PRLA 4LIHA 3RHRA 2ONOA 5J6BA 3VZ0A 1BI9A 2W8OA 2JG7A 4I3TA 1QI1A 3N83A 4JDCA 2J40A 4I25A 5L2MA 1A4ZA 1BXSA 4YWEA 5J7IA 4OU2A 4QJEB 2IY6A 5DRUA 1CW3A 4CBBA 5J78A 2EIWA 4OE5A 4LGZA 4OE4A 3U4JA 2O2RA 5AC0A 5L2OA 4MPBA 3INLA 4ZVYA 1AG8A 4ITBA 4ZXUA 5A2DC 4L2OA 3EK1A 5EUYA 4GO4A 4ZVXA 3PQAA 3RHLA 3V9GA 4YWVA 5EK6A 2WOXA 1NZZA 5KLOA 1UXVA 4OGDA 4QN2A 4QTOA 1UXUA 4F3XA 4NMJA 1O00A 3JU8A 4ZULA 5KLNA 3B4WA 2Y5DA 4PXLA 3V4CA 3ZQAA 4NEAA 3V9HA 3IWJA 1T90A 3SZBA 4WB9A 3R64A 4I2RA 3INJA 1NZWA 2BJAA 3RHDA 4X2QA 3RHMA 2EIIA 3RH9A 3R31A 4FR8A 3V9KA 3EFVA 4ZUKA 2ESDA 4U3WA 4Q92A 3ETFA 1O20A 4GO2A 3RHQA 3RHJA 1VLUA 2WMEA 1UXNA 4I3XA 1QI6A 4V3FA 2J6LA 4LH1A 5JRYA 5EXFA 2BHPA 4LH2A 4QJEA 2OPXA 4IDMA 4NMKA 2ONMA 3RHOA 5L13A 4WJ9A 1AD3A 4WP7A 1UZBA 3SZ9A 4OUBA 1ZUMA 2EJ6A 2EUHA 1WNBA 5EEBA 4H73A 5L2NA 2EITA 4GO0A 4JZ6A 3V9LA 4CAZA 4OHTA 2IMPA 3I44A 4O6RA 3VZ3A 4V37A 1O9JA 2W8PA 3VZ1A 1O04A 2Y53A 5KLKA 1UXPA 4NU9A 1A4SA 3RHPA 5DBVA 5KJ5A 4KNAA 2W8QA 5DIBA 4YWUA 2EJLA 4FQFA 4KWGA 4PZ2A 5KLLA 2BHQA 5EYUA 4LEMA 5EZ4A 4H80A 4LH0A 3K9DA 2D4EA 2ID2A 4I3WA 4IHIA 4E4GA 1EZ0A 1UXTA 2EJDA 4X0UA 2ILUA 1UXRA 4QF6A 1NZXA 2HG2A 4C3SA 2Y52A 4I8QA 5KLMA 4MPYA 2XDRA 2ONPA 3N82A 4I3UA 2W8RA 5FHZA 3JZ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O02 A;  5AC2 A;  2Y51 A;  1BPW A;  4IT9 A;  1O01 A;  2BJK A;  2EHU A;  4O5H A;  5ABM A;  2VLE A;  4ITA A;  4NS3 A;  2W8N A;  5A2D A;  4X4L A;  3TY7 A;  3N81 A;  4I1W A;  1UXQ A;  3MY7 A;  4JBE A;  4OE2 A;  3SZA A;  2WME C;  3N80 A;  4I9B A;  4V3F C;  2O2P A;  3QAN A;  4X0T A;  4E3X A;  4IYM A;  5AC1 A;  4KWF A;  4WPN A;  4K57 A;  3ROS A;  2EHQ A;  4DAL A;  4OE6 A;  4GNZ A;  4ZZ7 A;  2J5N A;  3K2W A;  2H5G A;  4GHK A;  5EKC A;  4DNG A;  4I3V A;  5A2D D;  3VZ2 A;  4QET A;  4ZVW A;  2ONN A;  1KY8 A;  4L1O A;  4I8P A;  4PXL B;  4PXN A;  4QYJ A;  4A0M A;  4I26 A;  4GO3 A;  4IDS A;  2QE0 A;  1WND A;  3RHH A;  2O2Q A;  5F2C A;  3V9J A;  3V9I A;  4ZWL A;  1EUH A;  1EYY A;  3RJL A;  3IWK A;  4QGK A;  1O05 A;  4H7N A;  4NPI A;  5KF0 A;  4LH3 A;  2VRO A;  3PRL A;  4LIH A;  3RHR A;  2ONO A;  5J6B A;  3VZ0 A;  1BI9 A;  2W8O A;  2JG7 A;  4I3T A;  1QI1 A;  3N83 A;  4JDC A;  2J40 A;  4I25 A;  5L2M A;  1A4Z A;  1BXS A;  4YWE A;  5J7I A;  4OU2 A;  4QJE B;  2IY6 A;  5DRU A;  1CW3 A;  4CBB A;  5J78 A;  2EIW A;  4OE5 A;  4LGZ A;  4OE4 A;  3U4J A;  2O2R A;  5AC0 A;  5L2O A;  4MPB A;  3INL A;  4ZVY A;  1AG8 A;  4ITB A;  4ZXU A;  5A2D C;  4L2O A;  3EK1 A;  5EUY A;  4GO4 A;  4ZVX A;  3PQA A;  3RHL A;  3V9G A;  4YWV A;  5EK6 A;  2WOX A;  1NZZ A;  5KLO A;  1UXV A;  4OGD A;  4QN2 A;  4QTO A;  1UXU A;  4F3X A;  4NMJ A;  1O00 A;  3JU8 A;  4ZUL A;  5KLN A;  3B4W A;  2Y5D A;  4PXL A;  3V4C A;  3ZQA A;  4NEA A;  3V9H A;  3IWJ A;  1T90 A;  3SZB A;  4WB9 A;  3R64 A;  4I2R A;  3INJ A;  1NZW A;  2BJA A;  3RHD A;  4X2Q A;  3RHM A;  2EII A;  3RH9 A;  3R31 A;  4FR8 A;  3V9K A;  3EFV A;  4ZUK A;  2ESD A;  4U3W A;  4Q92 A;  3ETF A;  1O20 A;  4GO2 A;  3RHQ A;  3RHJ A;  1VLU A;  2WME A;  1UXN A;  4I3X A;  1QI6 A;  4V3F A;  2J6L A;  4LH1 A;  5JRY A;  5EXF A;  2BHP A;  4LH2 A;  4QJE A;  2OPX A;  4IDM A;  4NMK A;  2ONM A;  3RHO A;  5L13 A;  4WJ9 A;  1AD3 A;  4WP7 A;  1UZB A;  3SZ9 A;  4OUB A;  1ZUM A;  2EJ6 A;  2EUH A;  1WNB A;  5EEB A;  4H73 A;  5L2N A;  2EIT A;  4GO0 A;  4JZ6 A;  3V9L A;  4CAZ A;  4OHT A;  2IMP A;  3I44 A;  4O6R A;  3VZ3 A;  4V37 A;  1O9J A;  2W8P A;  3VZ1 A;  1O04 A;  2Y53 A;  5KLK A;  1UXP A;  4NU9 A;  1A4S A;  3RHP A;  5DBV A;  5KJ5 A;  4KNA A;  2W8Q A;  5DIB A;  4YWU A;  2EJL A;  4FQF A;  4KWG A;  4PZ2 A;  5KLL A;  2BHQ A;  5EYU A;  4LEM A;  5EZ4 A;  4H80 A;  4LH0 A;  3K9D A;  2D4E A;  2ID2 A;  4I3W A;  4IHI A;  4E4G A;  1EZ0 A;  1UXT A;  2EJD A;  4X0U A;  2ILU A;  1UXR A;  4QF6 A;  1NZX A;  2HG2 A;  4C3S A;  2Y52 A;  4I8Q A;  5KLM A;  4MPY A;  2XDR A;  2ONP A;  3N82 A;  4I3U A;  2W8R A;  5FHZ A;  3JZ4 A; 
#chains in the Genus database with same CATH topology
 1O02 A;  5AC2 A;  2Y51 A;  1BPW A;  4IT9 A;  1O01 A;  2BJK A;  2EHU A;  4O5H A;  5ABM A;  2VLE A;  4ITA A;  4NS3 A;  2W8N A;  5A2D A;  4X4L A;  3TY7 A;  3N81 A;  4I1W A;  1UXQ A;  3MY7 A;  4JBE A;  4OE2 A;  3SZA A;  2WME C;  3N80 A;  4I9B A;  4V3F C;  2O2P A;  3QAN A;  4X0T A;  4E3X A;  4IYM A;  5AC1 A;  4KWF A;  4WPN A;  4K57 A;  3ROS A;  2EHQ A;  4DAL A;  4OE6 A;  4GNZ A;  4ZZ7 A;  2J5N A;  3K2W A;  2H5G A;  4GHK A;  5EKC A;  4DNG A;  4I3V A;  5A2D D;  3VZ2 A;  4QET A;  4ZVW A;  2ONN A;  1KY8 A;  4L1O A;  4I8P A;  4PXL B;  4PXN A;  4QYJ A;  4A0M A;  4I26 A;  4GO3 A;  4IDS A;  2QE0 A;  1WND A;  3RHH A;  2O2Q A;  5F2C A;  3V9J A;  3V9I A;  4ZWL A;  1EUH A;  1EYY A;  3RJL A;  3IWK A;  4QGK A;  1O05 A;  4H7N A;  4NPI A;  5KF0 A;  4LH3 A;  2VRO A;  3PRL A;  4LIH A;  3RHR A;  2ONO A;  5J6B A;  3VZ0 A;  1BI9 A;  2W8O A;  2JG7 A;  4I3T A;  1QI1 A;  3N83 A;  4JDC A;  2J40 A;  4I25 A;  5L2M A;  1A4Z A;  1BXS A;  4YWE A;  5J7I A;  4OU2 A;  4QJE B;  2IY6 A;  5DRU A;  1CW3 A;  4CBB A;  5J78 A;  2EIW A;  4OE5 A;  4LGZ A;  4OE4 A;  3U4J A;  2O2R A;  5AC0 A;  5L2O A;  4MPB A;  3INL A;  4ZVY A;  1AG8 A;  4ITB A;  4ZXU A;  5A2D C;  4L2O A;  3EK1 A;  5EUY A;  4GO4 A;  4ZVX A;  3PQA A;  3RHL A;  3V9G A;  4YWV A;  5EK6 A;  2WOX A;  1NZZ A;  5KLO A;  1UXV A;  4OGD A;  4QN2 A;  4QTO A;  1UXU A;  4F3X A;  4NMJ A;  1O00 A;  3JU8 A;  4ZUL A;  5KLN A;  3B4W A;  2Y5D A;  4PXL A;  3V4C A;  3ZQA A;  4NEA A;  3V9H A;  3IWJ A;  1T90 A;  3SZB A;  4WB9 A;  3R64 A;  4I2R A;  3INJ A;  1NZW A;  2BJA A;  3RHD A;  4X2Q A;  3RHM A;  2EII A;  3RH9 A;  3R31 A;  4FR8 A;  3V9K A;  3EFV A;  4ZUK A;  2ESD A;  4U3W A;  4Q92 A;  3ETF A;  1O20 A;  4GO2 A;  3RHQ A;  3RHJ A;  1VLU A;  2WME A;  1UXN A;  4I3X A;  1QI6 A;  4V3F A;  2J6L A;  4LH1 A;  5JRY A;  5EXF A;  2BHP A;  4LH2 A;  4QJE A;  2OPX A;  4IDM A;  4NMK A;  2ONM A;  3RHO A;  5L13 A;  4WJ9 A;  1AD3 A;  4WP7 A;  1UZB A;  3SZ9 A;  4OUB A;  1ZUM A;  2EJ6 A;  2EUH A;  1WNB A;  5EEB A;  4H73 A;  5L2N A;  2EIT A;  4GO0 A;  4JZ6 A;  3V9L A;  4CAZ A;  4OHT A;  2IMP A;  3I44 A;  4O6R A;  3VZ3 A;  4V37 A;  1O9J A;  2W8P A;  3VZ1 A;  1O04 A;  2Y53 A;  5KLK A;  1UXP A;  4NU9 A;  1A4S A;  3RHP A;  5DBV A;  5KJ5 A;  4KNA A;  2W8Q A;  5DIB A;  4YWU A;  2EJL A;  4FQF A;  4KWG A;  4PZ2 A;  5KLL A;  2BHQ A;  5EYU A;  4LEM A;  5EZ4 A;  4H80 A;  4LH0 A;  3K9D A;  2D4E A;  2ID2 A;  4I3W A;  4IHI A;  4E4G A;  1EZ0 A;  1UXT A;  2EJD A;  4X0U A;  2ILU A;  1UXR A;  4QF6 A;  1NZX A;  2HG2 A;  4C3S A;  2Y52 A;  4I8Q A;  5KLM A;  4MPY A;  2XDR A;  2ONP A;  3N82 A;  4I3U A;  2W8R A;  5FHZ A;  3JZ4 A; 
#chains in the Genus database with same CATH homology
 1O02 A;  5AC2 A;  2Y51 A;  1BPW A;  4IT9 A;  1O01 A;  2BJK A;  2EHU A;  4O5H A;  5ABM A;  2VLE A;  4ITA A;  4NS3 A;  2W8N A;  5A2D A;  4X4L A;  3TY7 A;  3N81 A;  4I1W A;  1UXQ A;  3MY7 A;  4JBE A;  4OE2 A;  3SZA A;  2WME C;  3N80 A;  4I9B A;  4V3F C;  2O2P A;  3QAN A;  4X0T A;  4E3X A;  4IYM A;  5AC1 A;  4KWF A;  4WPN A;  4K57 A;  3ROS A;  2EHQ A;  4DAL A;  4OE6 A;  4GNZ A;  4ZZ7 A;  2J5N A;  3K2W A;  2H5G A;  4GHK A;  5EKC A;  4DNG A;  4I3V A;  5A2D D;  3VZ2 A;  4QET A;  4ZVW A;  2ONN A;  1KY8 A;  4L1O A;  4I8P A;  4PXL B;  4PXN A;  4QYJ A;  4A0M A;  4I26 A;  4GO3 A;  4IDS A;  2QE0 A;  1WND A;  3RHH A;  2O2Q A;  5F2C A;  3V9J A;  3V9I A;  4ZWL A;  1EUH A;  1EYY A;  3RJL A;  3IWK A;  4QGK A;  1O05 A;  4H7N A;  4NPI A;  5KF0 A;  4LH3 A;  2VRO A;  3PRL A;  4LIH A;  3RHR A;  2ONO A;  5J6B A;  3VZ0 A;  1BI9 A;  2W8O A;  2JG7 A;  4I3T A;  1QI1 A;  3N83 A;  4JDC A;  2J40 A;  4I25 A;  5L2M A;  1A4Z A;  1BXS A;  4YWE A;  5J7I A;  4OU2 A;  4QJE B;  2IY6 A;  5DRU A;  1CW3 A;  4CBB A;  5J78 A;  2EIW A;  4OE5 A;  4LGZ A;  4OE4 A;  3U4J A;  2O2R A;  5AC0 A;  5L2O A;  4MPB A;  3INL A;  4ZVY A;  1AG8 A;  4ITB A;  4ZXU A;  5A2D C;  4L2O A;  3EK1 A;  5EUY A;  4GO4 A;  4ZVX A;  3PQA A;  3RHL A;  3V9G A;  4YWV A;  5EK6 A;  2WOX A;  1NZZ A;  5KLO A;  1UXV A;  4OGD A;  4QN2 A;  4QTO A;  1UXU A;  4F3X A;  4NMJ A;  1O00 A;  3JU8 A;  4ZUL A;  5KLN A;  3B4W A;  2Y5D A;  4PXL A;  3V4C A;  3ZQA A;  4NEA A;  3V9H A;  3IWJ A;  1T90 A;  3SZB A;  4WB9 A;  3R64 A;  4I2R A;  3INJ A;  1NZW A;  2BJA A;  3RHD A;  4X2Q A;  3RHM A;  2EII A;  3RH9 A;  3R31 A;  4FR8 A;  3V9K A;  3EFV A;  4ZUK A;  2ESD A;  4U3W A;  4Q92 A;  3ETF A;  1O20 A;  4GO2 A;  3RHQ A;  3RHJ A;  1VLU A;  2WME A;  1UXN A;  4I3X A;  1QI6 A;  4V3F A;  2J6L A;  4LH1 A;  5JRY A;  5EXF A;  2BHP A;  4LH2 A;  4QJE A;  2OPX A;  4IDM A;  4NMK A;  2ONM A;  3RHO A;  5L13 A;  4WJ9 A;  1AD3 A;  4WP7 A;  1UZB A;  3SZ9 A;  4OUB A;  1ZUM A;  2EJ6 A;  2EUH A;  1WNB A;  5EEB A;  4H73 A;  5L2N A;  2EIT A;  4GO0 A;  4JZ6 A;  3V9L A;  4CAZ A;  4OHT A;  2IMP A;  3I44 A;  4O6R A;  3VZ3 A;  4V37 A;  1O9J A;  2W8P A;  3VZ1 A;  1O04 A;  2Y53 A;  5KLK A;  1UXP A;  4NU9 A;  1A4S A;  3RHP A;  5DBV A;  5KJ5 A;  4KNA A;  2W8Q A;  5DIB A;  4YWU A;  2EJL A;  4FQF A;  4KWG A;  4PZ2 A;  5KLL A;  2BHQ A;  5EYU A;  4LEM A;  5EZ4 A;  4H80 A;  4LH0 A;  3K9D A;  2D4E A;  2ID2 A;  4I3W A;  4IHI A;  4E4G A;  1EZ0 A;  1UXT A;  2EJD A;  4X0U A;  2ILU A;  1UXR A;  4QF6 A;  1NZX A;  2HG2 A;  4C3S A;  2Y52 A;  4I8Q A;  5KLM A;  4MPY A;  2XDR A;  2ONP A;  3N82 A;  4I3U A;  2W8R A;  5FHZ A;  3JZ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...