5AC2A

Human aldehyde dehydrogenase 1a1 with duocarmycin analog
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
494
structure length
494
Chain Sequence
DLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords RETINAL DEHYDROGENASE 1
publication title Structural, Biochemical, and Computational Studies Reveal the Mechanism of Selective Aldehyde Dehydrogenase 1A1 Inhibition by Cytotoxic Duocarmycin Analogues.
pubmed doi rcsb
source organism Homo sapiens
total genus 187
structure length 494
sequence length 494
ec nomenclature ec 1.2.1.36: Retinal dehydrogenase.
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00171 Aldedh Aldehyde dehydrogenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.309.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 2 Aldehyde Dehydrogenase; Chain A, domain 2 5ac2A02
3.40.605.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 1 Aldehyde Dehydrogenase; Chain A, domain 1 5ac2A01
3IWKA 4ITBA 4K57A 4JBEA 4NU9A 4GO0A 4NMJA 3VZ0A 3RHDA 1UXRA 5AC1A 4GNZA 5KJ5A 5A2DA 5DIBA 4OE6A 2EHUA 2EJLA 2WMEA 4LH3A 3V9IA 4I26A 2ESDA 3EFVA 4OHTA 3SZAA 4CBBA 2H5GA 4H73A 4YWEA 4I2RA 4OE2A 4ZXUA 2QE0A 2BHQA 4QN2A 3N80A 4ZWLA 2ID2A 4NS3A 3RJLA 4E3XA 4V3FC 1A4SA 1AD3A 1WNBA 3ZQAA 3ETFA 1O20A 2EJDA 4LH1A 2OPXA 4I8QA 2O2PA 4IT9A 3V9LA 4ZZ7A 2VLEA 4MPBA 3SZ9A 5A2DD 4OE4A 4ZULA 3V4CA 1NZZA 2BJAA 4WB9A 3RHRA 5EKCA 4YWVA 2J5NA 5AC0A 5KF0A 2Y51A 3PQAA 3U4JA 2ONPA 1NZWA 2W8QA 1O02A 3V9KA 1UZBA 2IY6A 1O01A 4KWFA 4PXNA 3QANA 1UXNA 4QYJA 1EUHA 1VLUA 3RH9A 4LH2A 4ITAA 4L1OA 4PXLA 4ZUKA 2HG2A 5L2MA 4LH0A 2EITA 4CAZA 2VROA 5KLMA 3INJA 1O00A 3N83A 4GO2A 4QGKA 4X4LA 3RHHA 3PRLA 4KWGA 1QI1A 3JZ4A 1BXSA 2BJKA 3K2WA 3MY7A 5FHZA 2J6LA 3JU8A 4OU2A 3B4WA 4X0UA 3VZ1A 5J7IA 5EK6A 2JG7A 3RHJA 1O05A 5DBVA 4GHKA 3V9HA 4V3FA 4NPIA 5JRYA 3R31A 2BHPA 4NEAA 4JZ6A 2ILUA 4DNGA 2EIIA 5KLOA 1AG8A 3VZ2A 5EZ4A 4IYMA 1UXTA 1WNDA 3VZ3A 4L2OA 2EUHA 1BI9A 4I3UA 4JDCA 1BPWA 4PXLB 4OGDA 4QTOA 5L13A 1A4ZA 4LGZA 4QJEB 4YWUA 4QJEA 4KNAA 2O2RA 5L2OA 4MPYA 4PZ2A 1NZXA 4A0MA 5EYUA 3ROSA 2EJ6A 5KLKA 5J78A 4FR8A 2EHQA 5A2DC 3V9GA 2D4EA 2IMPA 4I8PA 5DRUA 3N82A 2WMEC 5AC2A 2W8NA 4QETA 4I3TA 5L2NA 4IHIA 2W8OA 2ONMA 4I3XA 5F2CA 4IDMA 4I3VA 4LEMA 1O04A 3IWJA 3RHMA 3RHOA 1QI6A 4H80A 3V9JA 4FQFA 3K9DA 1EZ0A 3TY7A 4C3SA 4OUBA 5EUYA 4ZVXA 2XDRA 4U3WA 4X0TA 4ZVWA 4I1WA 3RHPA 4I9BA 4E4GA 1UXPA 4QF6A 4OE5A 4WP7A 1CW3A 2ONNA 4IDSA 3RHLA 4X2QA 3INLA 4LIHA 1UXQA 2J40A 2EIWA 4H7NA 3SZBA 1O9JA 1UXUA 1KY8A 2W8PA 4O5HA 5EEBA 4F3XA 5J6BA 1T90A 4GO3A 4NMKA 1ZUMA 3EK1A 4O6RA 4WJ9A 4WPNA 2Y5DA 3RHQA 4Q92A 4V37A 5ABMA 2O2QA 4GO4A 4I25A 3R64A 4ZVYA 2Y53A 3I44A 4I3WA 3N81A 5KLLA 1UXVA 2W8RA 2Y52A 5EXFA 5KLNA 2WOXA 1EYYA 2ONOA 4DALA
chains in the Genus database with same CATH superfamily
3IWKA 4ITBA 4K57A 4JBEA 4NU9A 4GO0A 4NMJA 3VZ0A 3RHDA 1UXRA 5AC1A 4GNZA 5KJ5A 5A2DA 5DIBA 4OE6A 2EHUA 2EJLA 2WMEA 4LH3A 3V9IA 4I26A 2ESDA 3EFVA 4OHTA 3SZAA 4CBBA 2H5GA 4H73A 4YWEA 4I2RA 4OE2A 4ZXUA 2QE0A 2BHQA 4QN2A 3N80A 4ZWLA 2ID2A 4NS3A 3RJLA 4E3XA 4V3FC 1A4SA 1AD3A 1WNBA 3ZQAA 3ETFA 1O20A 2EJDA 4LH1A 2OPXA 4I8QA 2O2PA 4IT9A 3V9LA 4ZZ7A 2VLEA 4MPBA 3SZ9A 5A2DD 4OE4A 4ZULA 3V4CA 1NZZA 2BJAA 4WB9A 3RHRA 5EKCA 4YWVA 2J5NA 5AC0A 5KF0A 2Y51A 3PQAA 3U4JA 2ONPA 1NZWA 2W8QA 1O02A 3V9KA 1UZBA 2IY6A 1O01A 4KWFA 4PXNA 3QANA 1UXNA 4QYJA 1EUHA 1VLUA 3RH9A 4LH2A 4ITAA 4L1OA 4PXLA 4ZUKA 2HG2A 5L2MA 4LH0A 2EITA 4CAZA 2VROA 5KLMA 3INJA 1O00A 3N83A 4GO2A 4QGKA 4X4LA 3RHHA 3PRLA 4KWGA 1QI1A 3JZ4A 1BXSA 2BJKA 3K2WA 3MY7A 5FHZA 2J6LA 3JU8A 4OU2A 3B4WA 4X0UA 3VZ1A 5J7IA 5EK6A 2JG7A 3RHJA 1O05A 5DBVA 4GHKA 3V9HA 4V3FA 4NPIA 5JRYA 3R31A 2BHPA 4NEAA 4JZ6A 2ILUA 4DNGA 2EIIA 5KLOA 1AG8A 3VZ2A 5EZ4A 4IYMA 1UXTA 1WNDA 3VZ3A 4L2OA 2EUHA 1BI9A 4I3UA 4JDCA 1BPWA 4PXLB 4OGDA 4QTOA 5L13A 1A4ZA 4LGZA 4QJEB 4YWUA 4QJEA 4KNAA 2O2RA 5L2OA 4MPYA 4PZ2A 1NZXA 4A0MA 5EYUA 3ROSA 2EJ6A 5KLKA 5J78A 4FR8A 2EHQA 5A2DC 3V9GA 2D4EA 2IMPA 4I8PA 5DRUA 3N82A 2WMEC 5AC2A 2W8NA 4QETA 4I3TA 5L2NA 4IHIA 2W8OA 2ONMA 4I3XA 5F2CA 4IDMA 4I3VA 4LEMA 1O04A 3IWJA 3RHMA 3RHOA 1QI6A 4H80A 3V9JA 4FQFA 3K9DA 1EZ0A 3TY7A 4C3SA 4OUBA 5EUYA 4ZVXA 2XDRA 4U3WA 4X0TA 4ZVWA 4I1WA 3RHPA 4I9BA 4E4GA 1UXPA 4QF6A 4OE5A 4WP7A 1CW3A 2ONNA 4IDSA 3RHLA 4X2QA 3INLA 4LIHA 1UXQA 2J40A 2EIWA 4H7NA 3SZBA 1O9JA 1UXUA 1KY8A 2W8PA 4O5HA 5EEBA 4F3XA 5J6BA 1T90A 4GO3A 4NMKA 1ZUMA 3EK1A 4O6RA 4WJ9A 4WPNA 2Y5DA 3RHQA 4Q92A 4V37A 5ABMA 2O2QA 4GO4A 4I25A 3R64A 4ZVYA 2Y53A 3I44A 4I3WA 3N81A 5KLLA 1UXVA 2W8RA 2Y52A 5EXFA 5KLNA 2WOXA 1EYYA 2ONOA 4DALA
chains in the Genus database with same CATH topology
3IWKA 4ITBA 4K57A 4JBEA 4NU9A 4GO0A 4NMJA 3VZ0A 3RHDA 1UXRA 5AC1A 4GNZA 5KJ5A 5A2DA 5DIBA 4OE6A 2EHUA 2EJLA 2WMEA 4LH3A 3V9IA 4I26A 2ESDA 3EFVA 4OHTA 3SZAA 4CBBA 2H5GA 4H73A 4YWEA 4I2RA 4OE2A 4ZXUA 2QE0A 2BHQA 4QN2A 3N80A 4ZWLA 2ID2A 4NS3A 3RJLA 4E3XA 4V3FC 1A4SA 1AD3A 1WNBA 3ZQAA 3ETFA 1O20A 2EJDA 4LH1A 2OPXA 4I8QA 2O2PA 4IT9A 3V9LA 4ZZ7A 2VLEA 4MPBA 3SZ9A 5A2DD 4OE4A 4ZULA 3V4CA 1NZZA 2BJAA 4WB9A 3RHRA 5EKCA 4YWVA 2J5NA 5AC0A 5KF0A 2Y51A 3PQAA 3U4JA 2ONPA 1NZWA 2W8QA 1O02A 3V9KA 1UZBA 2IY6A 1O01A 4KWFA 4PXNA 3QANA 1UXNA 4QYJA 1EUHA 1VLUA 3RH9A 4LH2A 4ITAA 4L1OA 4PXLA 4ZUKA 2HG2A 5L2MA 4LH0A 2EITA 4CAZA 2VROA 5KLMA 3INJA 1O00A 3N83A 4GO2A 4QGKA 4X4LA 3RHHA 3PRLA 4KWGA 1QI1A 3JZ4A 1BXSA 2BJKA 3K2WA 3MY7A 5FHZA 2J6LA 3JU8A 4OU2A 3B4WA 4X0UA 3VZ1A 5J7IA 5EK6A 2JG7A 3RHJA 1O05A 5DBVA 4GHKA 3V9HA 4V3FA 4NPIA 5JRYA 3R31A 2BHPA 4NEAA 4JZ6A 2ILUA 4DNGA 2EIIA 5KLOA 1AG8A 3VZ2A 5EZ4A 4IYMA 1UXTA 1WNDA 3VZ3A 4L2OA 2EUHA 1BI9A 4I3UA 4JDCA 1BPWA 4PXLB 4OGDA 4QTOA 5L13A 1A4ZA 4LGZA 4QJEB 4YWUA 4QJEA 4KNAA 2O2RA 5L2OA 4MPYA 4PZ2A 1NZXA 4A0MA 5EYUA 3ROSA 2EJ6A 5KLKA 5J78A 4FR8A 2EHQA 5A2DC 3V9GA 2D4EA 2IMPA 4I8PA 5DRUA 3N82A 2WMEC 5AC2A 2W8NA 4QETA 4I3TA 5L2NA 4IHIA 2W8OA 2ONMA 4I3XA 5F2CA 4IDMA 4I3VA 4LEMA 1O04A 3IWJA 3RHMA 3RHOA 1QI6A 4H80A 3V9JA 4FQFA 3K9DA 1EZ0A 3TY7A 4C3SA 4OUBA 5EUYA 4ZVXA 2XDRA 4U3WA 4X0TA 4ZVWA 4I1WA 3RHPA 4I9BA 4E4GA 1UXPA 4QF6A 4OE5A 4WP7A 1CW3A 2ONNA 4IDSA 3RHLA 4X2QA 3INLA 4LIHA 1UXQA 2J40A 2EIWA 4H7NA 3SZBA 1O9JA 1UXUA 1KY8A 2W8PA 4O5HA 5EEBA 4F3XA 5J6BA 1T90A 4GO3A 4NMKA 1ZUMA 3EK1A 4O6RA 4WJ9A 4WPNA 2Y5DA 3RHQA 4Q92A 4V37A 5ABMA 2O2QA 4GO4A 4I25A 3R64A 4ZVYA 2Y53A 3I44A 4I3WA 3N81A 5KLLA 1UXVA 2W8RA 2Y52A 5EXFA 5KLNA 2WOXA 1EYYA 2ONOA 4DALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IWK A;  4ITB A;  4K57 A;  4JBE A;  4NU9 A;  4GO0 A;  4NMJ A;  3VZ0 A;  3RHD A;  1UXR A;  5AC1 A;  4GNZ A;  5KJ5 A;  5A2D A;  5DIB A;  4OE6 A;  2EHU A;  2EJL A;  2WME A;  4LH3 A;  3V9I A;  4I26 A;  2ESD A;  3EFV A;  4OHT A;  3SZA A;  4CBB A;  2H5G A;  4H73 A;  4YWE A;  4I2R A;  4OE2 A;  4ZXU A;  2QE0 A;  2BHQ A;  4QN2 A;  3N80 A;  4ZWL A;  2ID2 A;  4NS3 A;  3RJL A;  4E3X A;  4V3F C;  1A4S A;  1AD3 A;  1WNB A;  3ZQA A;  3ETF A;  1O20 A;  2EJD A;  4LH1 A;  2OPX A;  4I8Q A;  2O2P A;  4IT9 A;  3V9L A;  4ZZ7 A;  2VLE A;  4MPB A;  3SZ9 A;  5A2D D;  4OE4 A;  4ZUL A;  3V4C A;  1NZZ A;  2BJA A;  4WB9 A;  3RHR A;  5EKC A;  4YWV A;  2J5N A;  5AC0 A;  5KF0 A;  2Y51 A;  3PQA A;  3U4J A;  2ONP A;  1NZW A;  2W8Q A;  1O02 A;  3V9K A;  1UZB A;  2IY6 A;  1O01 A;  4KWF A;  4PXN A;  3QAN A;  1UXN A;  4QYJ A;  1EUH A;  1VLU A;  3RH9 A;  4LH2 A;  4ITA A;  4L1O A;  4PXL A;  4ZUK A;  2HG2 A;  5L2M A;  4LH0 A;  2EIT A;  4CAZ A;  2VRO A;  5KLM A;  3INJ A;  1O00 A;  3N83 A;  4GO2 A;  4QGK A;  4X4L A;  3RHH A;  3PRL A;  4KWG A;  1QI1 A;  3JZ4 A;  1BXS A;  2BJK A;  3K2W A;  3MY7 A;  5FHZ A;  2J6L A;  3JU8 A;  4OU2 A;  3B4W A;  4X0U A;  3VZ1 A;  5J7I A;  5EK6 A;  2JG7 A;  3RHJ A;  1O05 A;  5DBV A;  4GHK A;  3V9H A;  4V3F A;  4NPI A;  5JRY A;  3R31 A;  2BHP A;  4NEA A;  4JZ6 A;  2ILU A;  4DNG A;  2EII A;  5KLO A;  1AG8 A;  3VZ2 A;  5EZ4 A;  4IYM A;  1UXT A;  1WND A;  3VZ3 A;  4L2O A;  2EUH A;  1BI9 A;  4I3U A;  4JDC A;  1BPW A;  4PXL B;  4OGD A;  4QTO A;  5L13 A;  1A4Z A;  4LGZ A;  4QJE B;  4YWU A;  4QJE A;  4KNA A;  2O2R A;  5L2O A;  4MPY A;  4PZ2 A;  1NZX A;  4A0M A;  5EYU A;  3ROS A;  2EJ6 A;  5KLK A;  5J78 A;  4FR8 A;  2EHQ A;  5A2D C;  3V9G A;  2D4E A;  2IMP A;  4I8P A;  5DRU A;  3N82 A;  2WME C;  5AC2 A;  2W8N A;  4QET A;  4I3T A;  5L2N A;  4IHI A;  2W8O A;  2ONM A;  4I3X A;  5F2C A;  4IDM A;  4I3V A;  4LEM A;  1O04 A;  3IWJ A;  3RHM A;  3RHO A;  1QI6 A;  4H80 A;  3V9J A;  4FQF A;  3K9D A;  1EZ0 A;  3TY7 A;  4C3S A;  4OUB A;  5EUY A;  4ZVX A;  2XDR A;  4U3W A;  4X0T A;  4ZVW A;  4I1W A;  3RHP A;  4I9B A;  4E4G A;  1UXP A;  4QF6 A;  4OE5 A;  4WP7 A;  1CW3 A;  2ONN A;  4IDS A;  3RHL A;  4X2Q A;  3INL A;  4LIH A;  1UXQ A;  2J40 A;  2EIW A;  4H7N A;  3SZB A;  1O9J A;  1UXU A;  1KY8 A;  2W8P A;  4O5H A;  5EEB A;  4F3X A;  5J6B A;  1T90 A;  4GO3 A;  4NMK A;  1ZUM A;  3EK1 A;  4O6R A;  4WJ9 A;  4WPN A;  2Y5D A;  3RHQ A;  4Q92 A;  4V37 A;  5ABM A;  2O2Q A;  4GO4 A;  4I25 A;  3R64 A;  4ZVY A;  2Y53 A;  3I44 A;  4I3W A;  3N81 A;  5KLL A;  1UXV A;  2W8R A;  2Y52 A;  5EXF A;  5KLN A;  2WOX A;  1EYY A;  2ONO A;  4DAL A; 
#chains in the Genus database with same CATH topology
 3IWK A;  4ITB A;  4K57 A;  4JBE A;  4NU9 A;  4GO0 A;  4NMJ A;  3VZ0 A;  3RHD A;  1UXR A;  5AC1 A;  4GNZ A;  5KJ5 A;  5A2D A;  5DIB A;  4OE6 A;  2EHU A;  2EJL A;  2WME A;  4LH3 A;  3V9I A;  4I26 A;  2ESD A;  3EFV A;  4OHT A;  3SZA A;  4CBB A;  2H5G A;  4H73 A;  4YWE A;  4I2R A;  4OE2 A;  4ZXU A;  2QE0 A;  2BHQ A;  4QN2 A;  3N80 A;  4ZWL A;  2ID2 A;  4NS3 A;  3RJL A;  4E3X A;  4V3F C;  1A4S A;  1AD3 A;  1WNB A;  3ZQA A;  3ETF A;  1O20 A;  2EJD A;  4LH1 A;  2OPX A;  4I8Q A;  2O2P A;  4IT9 A;  3V9L A;  4ZZ7 A;  2VLE A;  4MPB A;  3SZ9 A;  5A2D D;  4OE4 A;  4ZUL A;  3V4C A;  1NZZ A;  2BJA A;  4WB9 A;  3RHR A;  5EKC A;  4YWV A;  2J5N A;  5AC0 A;  5KF0 A;  2Y51 A;  3PQA A;  3U4J A;  2ONP A;  1NZW A;  2W8Q A;  1O02 A;  3V9K A;  1UZB A;  2IY6 A;  1O01 A;  4KWF A;  4PXN A;  3QAN A;  1UXN A;  4QYJ A;  1EUH A;  1VLU A;  3RH9 A;  4LH2 A;  4ITA A;  4L1O A;  4PXL A;  4ZUK A;  2HG2 A;  5L2M A;  4LH0 A;  2EIT A;  4CAZ A;  2VRO A;  5KLM A;  3INJ A;  1O00 A;  3N83 A;  4GO2 A;  4QGK A;  4X4L A;  3RHH A;  3PRL A;  4KWG A;  1QI1 A;  3JZ4 A;  1BXS A;  2BJK A;  3K2W A;  3MY7 A;  5FHZ A;  2J6L A;  3JU8 A;  4OU2 A;  3B4W A;  4X0U A;  3VZ1 A;  5J7I A;  5EK6 A;  2JG7 A;  3RHJ A;  1O05 A;  5DBV A;  4GHK A;  3V9H A;  4V3F A;  4NPI A;  5JRY A;  3R31 A;  2BHP A;  4NEA A;  4JZ6 A;  2ILU A;  4DNG A;  2EII A;  5KLO A;  1AG8 A;  3VZ2 A;  5EZ4 A;  4IYM A;  1UXT A;  1WND A;  3VZ3 A;  4L2O A;  2EUH A;  1BI9 A;  4I3U A;  4JDC A;  1BPW A;  4PXL B;  4OGD A;  4QTO A;  5L13 A;  1A4Z A;  4LGZ A;  4QJE B;  4YWU A;  4QJE A;  4KNA A;  2O2R A;  5L2O A;  4MPY A;  4PZ2 A;  1NZX A;  4A0M A;  5EYU A;  3ROS A;  2EJ6 A;  5KLK A;  5J78 A;  4FR8 A;  2EHQ A;  5A2D C;  3V9G A;  2D4E A;  2IMP A;  4I8P A;  5DRU A;  3N82 A;  2WME C;  5AC2 A;  2W8N A;  4QET A;  4I3T A;  5L2N A;  4IHI A;  2W8O A;  2ONM A;  4I3X A;  5F2C A;  4IDM A;  4I3V A;  4LEM A;  1O04 A;  3IWJ A;  3RHM A;  3RHO A;  1QI6 A;  4H80 A;  3V9J A;  4FQF A;  3K9D A;  1EZ0 A;  3TY7 A;  4C3S A;  4OUB A;  5EUY A;  4ZVX A;  2XDR A;  4U3W A;  4X0T A;  4ZVW A;  4I1W A;  3RHP A;  4I9B A;  4E4G A;  1UXP A;  4QF6 A;  4OE5 A;  4WP7 A;  1CW3 A;  2ONN A;  4IDS A;  3RHL A;  4X2Q A;  3INL A;  4LIH A;  1UXQ A;  2J40 A;  2EIW A;  4H7N A;  3SZB A;  1O9J A;  1UXU A;  1KY8 A;  2W8P A;  4O5H A;  5EEB A;  4F3X A;  5J6B A;  1T90 A;  4GO3 A;  4NMK A;  1ZUM A;  3EK1 A;  4O6R A;  4WJ9 A;  4WPN A;  2Y5D A;  3RHQ A;  4Q92 A;  4V37 A;  5ABM A;  2O2Q A;  4GO4 A;  4I25 A;  3R64 A;  4ZVY A;  2Y53 A;  3I44 A;  4I3W A;  3N81 A;  5KLL A;  1UXV A;  2W8R A;  2Y52 A;  5EXF A;  5KLN A;  2WOX A;  1EYY A;  2ONO A;  4DAL A; 
#chains in the Genus database with same CATH homology
 3IWK A;  4ITB A;  4K57 A;  4JBE A;  4NU9 A;  4GO0 A;  4NMJ A;  3VZ0 A;  3RHD A;  1UXR A;  5AC1 A;  4GNZ A;  5KJ5 A;  5A2D A;  5DIB A;  4OE6 A;  2EHU A;  2EJL A;  2WME A;  4LH3 A;  3V9I A;  4I26 A;  2ESD A;  3EFV A;  4OHT A;  3SZA A;  4CBB A;  2H5G A;  4H73 A;  4YWE A;  4I2R A;  4OE2 A;  4ZXU A;  2QE0 A;  2BHQ A;  4QN2 A;  3N80 A;  4ZWL A;  2ID2 A;  4NS3 A;  3RJL A;  4E3X A;  4V3F C;  1A4S A;  1AD3 A;  1WNB A;  3ZQA A;  3ETF A;  1O20 A;  2EJD A;  4LH1 A;  2OPX A;  4I8Q A;  2O2P A;  4IT9 A;  3V9L A;  4ZZ7 A;  2VLE A;  4MPB A;  3SZ9 A;  5A2D D;  4OE4 A;  4ZUL A;  3V4C A;  1NZZ A;  2BJA A;  4WB9 A;  3RHR A;  5EKC A;  4YWV A;  2J5N A;  5AC0 A;  5KF0 A;  2Y51 A;  3PQA A;  3U4J A;  2ONP A;  1NZW A;  2W8Q A;  1O02 A;  3V9K A;  1UZB A;  2IY6 A;  1O01 A;  4KWF A;  4PXN A;  3QAN A;  1UXN A;  4QYJ A;  1EUH A;  1VLU A;  3RH9 A;  4LH2 A;  4ITA A;  4L1O A;  4PXL A;  4ZUK A;  2HG2 A;  5L2M A;  4LH0 A;  2EIT A;  4CAZ A;  2VRO A;  5KLM A;  3INJ A;  1O00 A;  3N83 A;  4GO2 A;  4QGK A;  4X4L A;  3RHH A;  3PRL A;  4KWG A;  1QI1 A;  3JZ4 A;  1BXS A;  2BJK A;  3K2W A;  3MY7 A;  5FHZ A;  2J6L A;  3JU8 A;  4OU2 A;  3B4W A;  4X0U A;  3VZ1 A;  5J7I A;  5EK6 A;  2JG7 A;  3RHJ A;  1O05 A;  5DBV A;  4GHK A;  3V9H A;  4V3F A;  4NPI A;  5JRY A;  3R31 A;  2BHP A;  4NEA A;  4JZ6 A;  2ILU A;  4DNG A;  2EII A;  5KLO A;  1AG8 A;  3VZ2 A;  5EZ4 A;  4IYM A;  1UXT A;  1WND A;  3VZ3 A;  4L2O A;  2EUH A;  1BI9 A;  4I3U A;  4JDC A;  1BPW A;  4PXL B;  4OGD A;  4QTO A;  5L13 A;  1A4Z A;  4LGZ A;  4QJE B;  4YWU A;  4QJE A;  4KNA A;  2O2R A;  5L2O A;  4MPY A;  4PZ2 A;  1NZX A;  4A0M A;  5EYU A;  3ROS A;  2EJ6 A;  5KLK A;  5J78 A;  4FR8 A;  2EHQ A;  5A2D C;  3V9G A;  2D4E A;  2IMP A;  4I8P A;  5DRU A;  3N82 A;  2WME C;  5AC2 A;  2W8N A;  4QET A;  4I3T A;  5L2N A;  4IHI A;  2W8O A;  2ONM A;  4I3X A;  5F2C A;  4IDM A;  4I3V A;  4LEM A;  1O04 A;  3IWJ A;  3RHM A;  3RHO A;  1QI6 A;  4H80 A;  3V9J A;  4FQF A;  3K9D A;  1EZ0 A;  3TY7 A;  4C3S A;  4OUB A;  5EUY A;  4ZVX A;  2XDR A;  4U3W A;  4X0T A;  4ZVW A;  4I1W A;  3RHP A;  4I9B A;  4E4G A;  1UXP A;  4QF6 A;  4OE5 A;  4WP7 A;  1CW3 A;  2ONN A;  4IDS A;  3RHL A;  4X2Q A;  3INL A;  4LIH A;  1UXQ A;  2J40 A;  2EIW A;  4H7N A;  3SZB A;  1O9J A;  1UXU A;  1KY8 A;  2W8P A;  4O5H A;  5EEB A;  4F3X A;  5J6B A;  1T90 A;  4GO3 A;  4NMK A;  1ZUM A;  3EK1 A;  4O6R A;  4WJ9 A;  4WPN A;  2Y5D A;  3RHQ A;  4Q92 A;  4V37 A;  5ABM A;  2O2Q A;  4GO4 A;  4I25 A;  3R64 A;  4ZVY A;  2Y53 A;  3I44 A;  4I3W A;  3N81 A;  5KLL A;  1UXV A;  2W8R A;  2Y52 A;  5EXF A;  5KLN A;  2WOX A;  1EYY A;  2ONO A;  4DAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...