5JRYA

Crystal structure of a nad-dependent aldehyde dehydrogenase from burkholderia multivorans in covalent complex with nad
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
477
structure length
477
Chain Sequence
MLKETYPYYLANAAVYANTDLEVTDKYSGKVATRVALADAKAIDAAIGAAVDATKPMRELPAYKRQAVLDHCVARFRERFDELAEALCIEAGKPINDAKGEVTRLIDTFRVASEEAVRIDGEVLNLEISARAQGYTGYTRRVPIGPCSFISPFNFPLNLAAHKVAPALAAGCPFVLKPASRTPVGALIIGEVLAETDLPKGAFSVLPAHRDGADLFTTDDRFRLLSFTGSPAVGWALKEKAGKKKVVLELGGNAAAIVDADQLDRLDYVVDRLAFGAFYQSGQSCIGVQRILAHADIYDALRDKLIAKTRSLKMGDPKDPSTFVGPMISESESRRLSGWMDAAVAAGAKIVAGGKVDGAMFEATLLENVGRDQDLYRKEAFGPIAILEKFDRFDDALARVNDSDFGLQAGVFTDSLAHTQQAWDELEVGGVVINDVPSFRVDNMPYGGVKDSGLGREGIRYAIEDMTEPRLLVVRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NAD-dependent aldehyde dehydrogenase
publication title Crystal structure of a NAD-dependent Aldehyde dehydrogenase from Burkholderia multivorans
rcsb
source organism Burkholderia multivorans (strain atcc 17616 / 249)
total genus 173
structure length 477
sequence length 477
ec nomenclature ec 1.2.1.-:
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00171 Aldedh Aldehyde dehydrogenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.309.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 2 Aldehyde Dehydrogenase; Chain A, domain 2 5jryA02
3.40.605.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 1 Aldehyde Dehydrogenase; Chain A, domain 1 5jryA01
1AD3A 4GO0A 4I26A 4NMJA 4GO4A 5EUYA 4PXLA 1UXPA 4MPYA 2J40A 5KLLA 1CW3A 2EIWA 2OPXA 4LH0A 3N83A 2WMEA 2VROA 3IWJA 5EXFA 2W8QA 4L2OA 1NZZA 4GNZA 3VZ2A 1A4SA 4V3FC 3V9KA 3EFVA 4GO2A 2O2QA 4NPIA 5F2CA 4A0MA 4H80A 1ZUMA 3SZ9A 3N82A 4X0UA 5A2DD 4L1OA 1QI1A 4OUBA 5DIBA 5A2DC 3PQAA 4LGZA 2Y53A 3RHRA 3INLA 1EYYA 1QI6A 4CBBA 2ID2A 4K57A 2ILUA 4CAZA 2BJAA 2W8OA 4KWGA 4WP7A 2EJLA 4GO3A 2H5GA 2WOXA 4YWUA 1NZWA 4O5HA 2ESDA 2W8NA 4WPNA 4FR8A 3V9HA 4DALA 5J7IA 2EITA 4GHKA 4QGKA 5AC1A 4V37A 4YWVA 3RHHA 2O2PA 4QF6A 4YWEA 1WNDA 4ZWLA 4QYJA 4ITAA 5AC2A 5EZ4A 1T90A 4ZULA 4I3WA 5KLNA 1O02A 1O05A 4LH1A 3JU8A 3RHJA 3TY7A 4I1WA 2EHUA 4PXLB 4NMKA 2EUHA 3R64A 4IDMA 4ZZ7A 3VZ0A 5J6BA 4OE5A 1BPWA 2ONMA 2Y51A 2VLEA 1EZ0A 2D4EA 5KF0A 2J5NA 2Y52A 4Q92A 4ZUKA 1UXTA 2BHQA 2QE0A 4ITBA 4QN2A 3RHDA 1O20A 3PRLA 3ROSA 3SZBA 3ZQAA 5KJ5A 5L2OA 3RHLA 5EKCA 3ETFA 3U4JA 2J6LA 4OE6A 2ONOA 4FQFA 5DRUA 1NZXA 5KLMA 3K9DA 4PXNA 4X0TA 1O04A 2EJ6A 3R31A 3B4WA 3K2WA 2WMEC 4ZXUA 4IYMA 4NU9A 4QJEA 1AG8A 3I44A 3INJA 3RHQA 4X2QA 1WNBA 1EUHA 4LH3A 3VZ1A 4LEMA 4IDSA 1UZBA 2O2RA 4C3SA 3RH9A 3V9JA 4X4LA 4LIHA 4IHIA 3V9GA 1UXRA 4QTOA 4QJEB 2ONPA 4V3FA 4ZVXA 5L13A 4KNAA 3V9IA 4JZ6A 2EJDA 2W8RA 4I8QA 2HG2A 4I2RA 5DBVA 4DNGA 1UXUA 4OHTA 5A2DA 2W8PA 3RHMA 5L2MA 2XDRA 4H7NA 4O6RA 4IT9A 4LH2A 4H73A 5FHZA 4OE4A 5AC0A 4NS3A 1O01A 4ZVYA 5L2NA 3IWKA 2IY6A 3MY7A 4JBEA 4I3UA 3SZAA 3VZ3A 1O9JA 2BHPA 4QETA 4MPBA 4I3VA 5ABMA 4I9BA 4NEAA 5KLKA 5JRYA 5KLOA 3RHOA 4JDCA 1BXSA 1A4ZA 1O00A 1BI9A 2EIIA 3JZ4A 5EEBA 3EK1A 2EHQA 4KWFA 4I3XA 2ONNA 4ZVWA 1UXNA 3N81A 4F3XA 1KY8A 4I8PA 4OE2A 5EK6A 4I3TA 1VLUA 4E3XA 3QANA 2Y5DA 4OU2A 2JG7A 4U3WA 4OGDA 4I25A 5EYUA 5J78A 2BJKA 1UXVA 4PZ2A 3RJLA 3V4CA 4E4GA 4WJ9A 2IMPA 3V9LA 3RHPA 4WB9A 1UXQA 3N80A
chains in the Genus database with same CATH superfamily
1AD3A 4GO0A 4I26A 4NMJA 4GO4A 5EUYA 4PXLA 1UXPA 4MPYA 2J40A 5KLLA 1CW3A 2EIWA 2OPXA 4LH0A 3N83A 2WMEA 2VROA 3IWJA 5EXFA 2W8QA 4L2OA 1NZZA 4GNZA 3VZ2A 1A4SA 4V3FC 3V9KA 3EFVA 4GO2A 2O2QA 4NPIA 5F2CA 4A0MA 4H80A 1ZUMA 3SZ9A 3N82A 4X0UA 5A2DD 4L1OA 1QI1A 4OUBA 5DIBA 5A2DC 3PQAA 4LGZA 2Y53A 3RHRA 3INLA 1EYYA 1QI6A 4CBBA 2ID2A 4K57A 2ILUA 4CAZA 2BJAA 2W8OA 4KWGA 4WP7A 2EJLA 4GO3A 2H5GA 2WOXA 4YWUA 1NZWA 4O5HA 2ESDA 2W8NA 4WPNA 4FR8A 3V9HA 4DALA 5J7IA 2EITA 4GHKA 4QGKA 5AC1A 4V37A 4YWVA 3RHHA 2O2PA 4QF6A 4YWEA 1WNDA 4ZWLA 4QYJA 4ITAA 5AC2A 5EZ4A 1T90A 4ZULA 4I3WA 5KLNA 1O02A 1O05A 4LH1A 3JU8A 3RHJA 3TY7A 4I1WA 2EHUA 4PXLB 4NMKA 2EUHA 3R64A 4IDMA 4ZZ7A 3VZ0A 5J6BA 4OE5A 1BPWA 2ONMA 2Y51A 2VLEA 1EZ0A 2D4EA 5KF0A 2J5NA 2Y52A 4Q92A 4ZUKA 1UXTA 2BHQA 2QE0A 4ITBA 4QN2A 3RHDA 1O20A 3PRLA 3ROSA 3SZBA 3ZQAA 5KJ5A 5L2OA 3RHLA 5EKCA 3ETFA 3U4JA 2J6LA 4OE6A 2ONOA 4FQFA 5DRUA 1NZXA 5KLMA 3K9DA 4PXNA 4X0TA 1O04A 2EJ6A 3R31A 3B4WA 3K2WA 2WMEC 4ZXUA 4IYMA 4NU9A 4QJEA 1AG8A 3I44A 3INJA 3RHQA 4X2QA 1WNBA 1EUHA 4LH3A 3VZ1A 4LEMA 4IDSA 1UZBA 2O2RA 4C3SA 3RH9A 3V9JA 4X4LA 4LIHA 4IHIA 3V9GA 1UXRA 4QTOA 4QJEB 2ONPA 4V3FA 4ZVXA 5L13A 4KNAA 3V9IA 4JZ6A 2EJDA 2W8RA 4I8QA 2HG2A 4I2RA 5DBVA 4DNGA 1UXUA 4OHTA 5A2DA 2W8PA 3RHMA 5L2MA 2XDRA 4H7NA 4O6RA 4IT9A 4LH2A 4H73A 5FHZA 4OE4A 5AC0A 4NS3A 1O01A 4ZVYA 5L2NA 3IWKA 2IY6A 3MY7A 4JBEA 4I3UA 3SZAA 3VZ3A 1O9JA 2BHPA 4QETA 4MPBA 4I3VA 5ABMA 4I9BA 4NEAA 5KLKA 5JRYA 5KLOA 3RHOA 4JDCA 1BXSA 1A4ZA 1O00A 1BI9A 2EIIA 3JZ4A 5EEBA 3EK1A 2EHQA 4KWFA 4I3XA 2ONNA 4ZVWA 1UXNA 3N81A 4F3XA 1KY8A 4I8PA 4OE2A 5EK6A 4I3TA 1VLUA 4E3XA 3QANA 2Y5DA 4OU2A 2JG7A 4U3WA 4OGDA 4I25A 5EYUA 5J78A 2BJKA 1UXVA 4PZ2A 3RJLA 3V4CA 4E4GA 4WJ9A 2IMPA 3V9LA 3RHPA 4WB9A 1UXQA 3N80A
chains in the Genus database with same CATH topology
1AD3A 4GO0A 4I26A 4NMJA 4GO4A 5EUYA 4PXLA 1UXPA 4MPYA 2J40A 5KLLA 1CW3A 2EIWA 2OPXA 4LH0A 3N83A 2WMEA 2VROA 3IWJA 5EXFA 2W8QA 4L2OA 1NZZA 4GNZA 3VZ2A 1A4SA 4V3FC 3V9KA 3EFVA 4GO2A 2O2QA 4NPIA 5F2CA 4A0MA 4H80A 1ZUMA 3SZ9A 3N82A 4X0UA 5A2DD 4L1OA 1QI1A 4OUBA 5DIBA 5A2DC 3PQAA 4LGZA 2Y53A 3RHRA 3INLA 1EYYA 1QI6A 4CBBA 2ID2A 4K57A 2ILUA 4CAZA 2BJAA 2W8OA 4KWGA 4WP7A 2EJLA 4GO3A 2H5GA 2WOXA 4YWUA 1NZWA 4O5HA 2ESDA 2W8NA 4WPNA 4FR8A 3V9HA 4DALA 5J7IA 2EITA 4GHKA 4QGKA 5AC1A 4V37A 4YWVA 3RHHA 2O2PA 4QF6A 4YWEA 1WNDA 4ZWLA 4QYJA 4ITAA 5AC2A 5EZ4A 1T90A 4ZULA 4I3WA 5KLNA 1O02A 1O05A 4LH1A 3JU8A 3RHJA 3TY7A 4I1WA 2EHUA 4PXLB 4NMKA 2EUHA 3R64A 4IDMA 4ZZ7A 3VZ0A 5J6BA 4OE5A 1BPWA 2ONMA 2Y51A 2VLEA 1EZ0A 2D4EA 5KF0A 2J5NA 2Y52A 4Q92A 4ZUKA 1UXTA 2BHQA 2QE0A 4ITBA 4QN2A 3RHDA 1O20A 3PRLA 3ROSA 3SZBA 3ZQAA 5KJ5A 5L2OA 3RHLA 5EKCA 3ETFA 3U4JA 2J6LA 4OE6A 2ONOA 4FQFA 5DRUA 1NZXA 5KLMA 3K9DA 4PXNA 4X0TA 1O04A 2EJ6A 3R31A 3B4WA 3K2WA 2WMEC 4ZXUA 4IYMA 4NU9A 4QJEA 1AG8A 3I44A 3INJA 3RHQA 4X2QA 1WNBA 1EUHA 4LH3A 3VZ1A 4LEMA 4IDSA 1UZBA 2O2RA 4C3SA 3RH9A 3V9JA 4X4LA 4LIHA 4IHIA 3V9GA 1UXRA 4QTOA 4QJEB 2ONPA 4V3FA 4ZVXA 5L13A 4KNAA 3V9IA 4JZ6A 2EJDA 2W8RA 4I8QA 2HG2A 4I2RA 5DBVA 4DNGA 1UXUA 4OHTA 5A2DA 2W8PA 3RHMA 5L2MA 2XDRA 4H7NA 4O6RA 4IT9A 4LH2A 4H73A 5FHZA 4OE4A 5AC0A 4NS3A 1O01A 4ZVYA 5L2NA 3IWKA 2IY6A 3MY7A 4JBEA 4I3UA 3SZAA 3VZ3A 1O9JA 2BHPA 4QETA 4MPBA 4I3VA 5ABMA 4I9BA 4NEAA 5KLKA 5JRYA 5KLOA 3RHOA 4JDCA 1BXSA 1A4ZA 1O00A 1BI9A 2EIIA 3JZ4A 5EEBA 3EK1A 2EHQA 4KWFA 4I3XA 2ONNA 4ZVWA 1UXNA 3N81A 4F3XA 1KY8A 4I8PA 4OE2A 5EK6A 4I3TA 1VLUA 4E3XA 3QANA 2Y5DA 4OU2A 2JG7A 4U3WA 4OGDA 4I25A 5EYUA 5J78A 2BJKA 1UXVA 4PZ2A 3RJLA 3V4CA 4E4GA 4WJ9A 2IMPA 3V9LA 3RHPA 4WB9A 1UXQA 3N80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AD3 A;  4GO0 A;  4I26 A;  4NMJ A;  4GO4 A;  5EUY A;  4PXL A;  1UXP A;  4MPY A;  2J40 A;  5KLL A;  1CW3 A;  2EIW A;  2OPX A;  4LH0 A;  3N83 A;  2WME A;  2VRO A;  3IWJ A;  5EXF A;  2W8Q A;  4L2O A;  1NZZ A;  4GNZ A;  3VZ2 A;  1A4S A;  4V3F C;  3V9K A;  3EFV A;  4GO2 A;  2O2Q A;  4NPI A;  5F2C A;  4A0M A;  4H80 A;  1ZUM A;  3SZ9 A;  3N82 A;  4X0U A;  5A2D D;  4L1O A;  1QI1 A;  4OUB A;  5DIB A;  5A2D C;  3PQA A;  4LGZ A;  2Y53 A;  3RHR A;  3INL A;  1EYY A;  1QI6 A;  4CBB A;  2ID2 A;  4K57 A;  2ILU A;  4CAZ A;  2BJA A;  2W8O A;  4KWG A;  4WP7 A;  2EJL A;  4GO3 A;  2H5G A;  2WOX A;  4YWU A;  1NZW A;  4O5H A;  2ESD A;  2W8N A;  4WPN A;  4FR8 A;  3V9H A;  4DAL A;  5J7I A;  2EIT A;  4GHK A;  4QGK A;  5AC1 A;  4V37 A;  4YWV A;  3RHH A;  2O2P A;  4QF6 A;  4YWE A;  1WND A;  4ZWL A;  4QYJ A;  4ITA A;  5AC2 A;  5EZ4 A;  1T90 A;  4ZUL A;  4I3W A;  5KLN A;  1O02 A;  1O05 A;  4LH1 A;  3JU8 A;  3RHJ A;  3TY7 A;  4I1W A;  2EHU A;  4PXL B;  4NMK A;  2EUH A;  3R64 A;  4IDM A;  4ZZ7 A;  3VZ0 A;  5J6B A;  4OE5 A;  1BPW A;  2ONM A;  2Y51 A;  2VLE A;  1EZ0 A;  2D4E A;  5KF0 A;  2J5N A;  2Y52 A;  4Q92 A;  4ZUK A;  1UXT A;  2BHQ A;  2QE0 A;  4ITB A;  4QN2 A;  3RHD A;  1O20 A;  3PRL A;  3ROS A;  3SZB A;  3ZQA A;  5KJ5 A;  5L2O A;  3RHL A;  5EKC A;  3ETF A;  3U4J A;  2J6L A;  4OE6 A;  2ONO A;  4FQF A;  5DRU A;  1NZX A;  5KLM A;  3K9D A;  4PXN A;  4X0T A;  1O04 A;  2EJ6 A;  3R31 A;  3B4W A;  3K2W A;  2WME C;  4ZXU A;  4IYM A;  4NU9 A;  4QJE A;  1AG8 A;  3I44 A;  3INJ A;  3RHQ A;  4X2Q A;  1WNB A;  1EUH A;  4LH3 A;  3VZ1 A;  4LEM A;  4IDS A;  1UZB A;  2O2R A;  4C3S A;  3RH9 A;  3V9J A;  4X4L A;  4LIH A;  4IHI A;  3V9G A;  1UXR A;  4QTO A;  4QJE B;  2ONP A;  4V3F A;  4ZVX A;  5L13 A;  4KNA A;  3V9I A;  4JZ6 A;  2EJD A;  2W8R A;  4I8Q A;  2HG2 A;  4I2R A;  5DBV A;  4DNG A;  1UXU A;  4OHT A;  5A2D A;  2W8P A;  3RHM A;  5L2M A;  2XDR A;  4H7N A;  4O6R A;  4IT9 A;  4LH2 A;  4H73 A;  5FHZ A;  4OE4 A;  5AC0 A;  4NS3 A;  1O01 A;  4ZVY A;  5L2N A;  3IWK A;  2IY6 A;  3MY7 A;  4JBE A;  4I3U A;  3SZA A;  3VZ3 A;  1O9J A;  2BHP A;  4QET A;  4MPB A;  4I3V A;  5ABM A;  4I9B A;  4NEA A;  5KLK A;  5JRY A;  5KLO A;  3RHO A;  4JDC A;  1BXS A;  1A4Z A;  1O00 A;  1BI9 A;  2EII A;  3JZ4 A;  5EEB A;  3EK1 A;  2EHQ A;  4KWF A;  4I3X A;  2ONN A;  4ZVW A;  1UXN A;  3N81 A;  4F3X A;  1KY8 A;  4I8P A;  4OE2 A;  5EK6 A;  4I3T A;  1VLU A;  4E3X A;  3QAN A;  2Y5D A;  4OU2 A;  2JG7 A;  4U3W A;  4OGD A;  4I25 A;  5EYU A;  5J78 A;  2BJK A;  1UXV A;  4PZ2 A;  3RJL A;  3V4C A;  4E4G A;  4WJ9 A;  2IMP A;  3V9L A;  3RHP A;  4WB9 A;  1UXQ A;  3N80 A; 
#chains in the Genus database with same CATH topology
 1AD3 A;  4GO0 A;  4I26 A;  4NMJ A;  4GO4 A;  5EUY A;  4PXL A;  1UXP A;  4MPY A;  2J40 A;  5KLL A;  1CW3 A;  2EIW A;  2OPX A;  4LH0 A;  3N83 A;  2WME A;  2VRO A;  3IWJ A;  5EXF A;  2W8Q A;  4L2O A;  1NZZ A;  4GNZ A;  3VZ2 A;  1A4S A;  4V3F C;  3V9K A;  3EFV A;  4GO2 A;  2O2Q A;  4NPI A;  5F2C A;  4A0M A;  4H80 A;  1ZUM A;  3SZ9 A;  3N82 A;  4X0U A;  5A2D D;  4L1O A;  1QI1 A;  4OUB A;  5DIB A;  5A2D C;  3PQA A;  4LGZ A;  2Y53 A;  3RHR A;  3INL A;  1EYY A;  1QI6 A;  4CBB A;  2ID2 A;  4K57 A;  2ILU A;  4CAZ A;  2BJA A;  2W8O A;  4KWG A;  4WP7 A;  2EJL A;  4GO3 A;  2H5G A;  2WOX A;  4YWU A;  1NZW A;  4O5H A;  2ESD A;  2W8N A;  4WPN A;  4FR8 A;  3V9H A;  4DAL A;  5J7I A;  2EIT A;  4GHK A;  4QGK A;  5AC1 A;  4V37 A;  4YWV A;  3RHH A;  2O2P A;  4QF6 A;  4YWE A;  1WND A;  4ZWL A;  4QYJ A;  4ITA A;  5AC2 A;  5EZ4 A;  1T90 A;  4ZUL A;  4I3W A;  5KLN A;  1O02 A;  1O05 A;  4LH1 A;  3JU8 A;  3RHJ A;  3TY7 A;  4I1W A;  2EHU A;  4PXL B;  4NMK A;  2EUH A;  3R64 A;  4IDM A;  4ZZ7 A;  3VZ0 A;  5J6B A;  4OE5 A;  1BPW A;  2ONM A;  2Y51 A;  2VLE A;  1EZ0 A;  2D4E A;  5KF0 A;  2J5N A;  2Y52 A;  4Q92 A;  4ZUK A;  1UXT A;  2BHQ A;  2QE0 A;  4ITB A;  4QN2 A;  3RHD A;  1O20 A;  3PRL A;  3ROS A;  3SZB A;  3ZQA A;  5KJ5 A;  5L2O A;  3RHL A;  5EKC A;  3ETF A;  3U4J A;  2J6L A;  4OE6 A;  2ONO A;  4FQF A;  5DRU A;  1NZX A;  5KLM A;  3K9D A;  4PXN A;  4X0T A;  1O04 A;  2EJ6 A;  3R31 A;  3B4W A;  3K2W A;  2WME C;  4ZXU A;  4IYM A;  4NU9 A;  4QJE A;  1AG8 A;  3I44 A;  3INJ A;  3RHQ A;  4X2Q A;  1WNB A;  1EUH A;  4LH3 A;  3VZ1 A;  4LEM A;  4IDS A;  1UZB A;  2O2R A;  4C3S A;  3RH9 A;  3V9J A;  4X4L A;  4LIH A;  4IHI A;  3V9G A;  1UXR A;  4QTO A;  4QJE B;  2ONP A;  4V3F A;  4ZVX A;  5L13 A;  4KNA A;  3V9I A;  4JZ6 A;  2EJD A;  2W8R A;  4I8Q A;  2HG2 A;  4I2R A;  5DBV A;  4DNG A;  1UXU A;  4OHT A;  5A2D A;  2W8P A;  3RHM A;  5L2M A;  2XDR A;  4H7N A;  4O6R A;  4IT9 A;  4LH2 A;  4H73 A;  5FHZ A;  4OE4 A;  5AC0 A;  4NS3 A;  1O01 A;  4ZVY A;  5L2N A;  3IWK A;  2IY6 A;  3MY7 A;  4JBE A;  4I3U A;  3SZA A;  3VZ3 A;  1O9J A;  2BHP A;  4QET A;  4MPB A;  4I3V A;  5ABM A;  4I9B A;  4NEA A;  5KLK A;  5JRY A;  5KLO A;  3RHO A;  4JDC A;  1BXS A;  1A4Z A;  1O00 A;  1BI9 A;  2EII A;  3JZ4 A;  5EEB A;  3EK1 A;  2EHQ A;  4KWF A;  4I3X A;  2ONN A;  4ZVW A;  1UXN A;  3N81 A;  4F3X A;  1KY8 A;  4I8P A;  4OE2 A;  5EK6 A;  4I3T A;  1VLU A;  4E3X A;  3QAN A;  2Y5D A;  4OU2 A;  2JG7 A;  4U3W A;  4OGD A;  4I25 A;  5EYU A;  5J78 A;  2BJK A;  1UXV A;  4PZ2 A;  3RJL A;  3V4C A;  4E4G A;  4WJ9 A;  2IMP A;  3V9L A;  3RHP A;  4WB9 A;  1UXQ A;  3N80 A; 
#chains in the Genus database with same CATH homology
 1AD3 A;  4GO0 A;  4I26 A;  4NMJ A;  4GO4 A;  5EUY A;  4PXL A;  1UXP A;  4MPY A;  2J40 A;  5KLL A;  1CW3 A;  2EIW A;  2OPX A;  4LH0 A;  3N83 A;  2WME A;  2VRO A;  3IWJ A;  5EXF A;  2W8Q A;  4L2O A;  1NZZ A;  4GNZ A;  3VZ2 A;  1A4S A;  4V3F C;  3V9K A;  3EFV A;  4GO2 A;  2O2Q A;  4NPI A;  5F2C A;  4A0M A;  4H80 A;  1ZUM A;  3SZ9 A;  3N82 A;  4X0U A;  5A2D D;  4L1O A;  1QI1 A;  4OUB A;  5DIB A;  5A2D C;  3PQA A;  4LGZ A;  2Y53 A;  3RHR A;  3INL A;  1EYY A;  1QI6 A;  4CBB A;  2ID2 A;  4K57 A;  2ILU A;  4CAZ A;  2BJA A;  2W8O A;  4KWG A;  4WP7 A;  2EJL A;  4GO3 A;  2H5G A;  2WOX A;  4YWU A;  1NZW A;  4O5H A;  2ESD A;  2W8N A;  4WPN A;  4FR8 A;  3V9H A;  4DAL A;  5J7I A;  2EIT A;  4GHK A;  4QGK A;  5AC1 A;  4V37 A;  4YWV A;  3RHH A;  2O2P A;  4QF6 A;  4YWE A;  1WND A;  4ZWL A;  4QYJ A;  4ITA A;  5AC2 A;  5EZ4 A;  1T90 A;  4ZUL A;  4I3W A;  5KLN A;  1O02 A;  1O05 A;  4LH1 A;  3JU8 A;  3RHJ A;  3TY7 A;  4I1W A;  2EHU A;  4PXL B;  4NMK A;  2EUH A;  3R64 A;  4IDM A;  4ZZ7 A;  3VZ0 A;  5J6B A;  4OE5 A;  1BPW A;  2ONM A;  2Y51 A;  2VLE A;  1EZ0 A;  2D4E A;  5KF0 A;  2J5N A;  2Y52 A;  4Q92 A;  4ZUK A;  1UXT A;  2BHQ A;  2QE0 A;  4ITB A;  4QN2 A;  3RHD A;  1O20 A;  3PRL A;  3ROS A;  3SZB A;  3ZQA A;  5KJ5 A;  5L2O A;  3RHL A;  5EKC A;  3ETF A;  3U4J A;  2J6L A;  4OE6 A;  2ONO A;  4FQF A;  5DRU A;  1NZX A;  5KLM A;  3K9D A;  4PXN A;  4X0T A;  1O04 A;  2EJ6 A;  3R31 A;  3B4W A;  3K2W A;  2WME C;  4ZXU A;  4IYM A;  4NU9 A;  4QJE A;  1AG8 A;  3I44 A;  3INJ A;  3RHQ A;  4X2Q A;  1WNB A;  1EUH A;  4LH3 A;  3VZ1 A;  4LEM A;  4IDS A;  1UZB A;  2O2R A;  4C3S A;  3RH9 A;  3V9J A;  4X4L A;  4LIH A;  4IHI A;  3V9G A;  1UXR A;  4QTO A;  4QJE B;  2ONP A;  4V3F A;  4ZVX A;  5L13 A;  4KNA A;  3V9I A;  4JZ6 A;  2EJD A;  2W8R A;  4I8Q A;  2HG2 A;  4I2R A;  5DBV A;  4DNG A;  1UXU A;  4OHT A;  5A2D A;  2W8P A;  3RHM A;  5L2M A;  2XDR A;  4H7N A;  4O6R A;  4IT9 A;  4LH2 A;  4H73 A;  5FHZ A;  4OE4 A;  5AC0 A;  4NS3 A;  1O01 A;  4ZVY A;  5L2N A;  3IWK A;  2IY6 A;  3MY7 A;  4JBE A;  4I3U A;  3SZA A;  3VZ3 A;  1O9J A;  2BHP A;  4QET A;  4MPB A;  4I3V A;  5ABM A;  4I9B A;  4NEA A;  5KLK A;  5JRY A;  5KLO A;  3RHO A;  4JDC A;  1BXS A;  1A4Z A;  1O00 A;  1BI9 A;  2EII A;  3JZ4 A;  5EEB A;  3EK1 A;  2EHQ A;  4KWF A;  4I3X A;  2ONN A;  4ZVW A;  1UXN A;  3N81 A;  4F3X A;  1KY8 A;  4I8P A;  4OE2 A;  5EK6 A;  4I3T A;  1VLU A;  4E3X A;  3QAN A;  2Y5D A;  4OU2 A;  2JG7 A;  4U3W A;  4OGD A;  4I25 A;  5EYU A;  5J78 A;  2BJK A;  1UXV A;  4PZ2 A;  3RJL A;  3V4C A;  4E4G A;  4WJ9 A;  2IMP A;  3V9L A;  3RHP A;  4WB9 A;  1UXQ A;  3N80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...