5KF0A

Crystal structure of an aldedhyde dehydrogenase from burkholderia vietnamiensis
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
480
structure length
480
Chain Sequence
HHHMLKDTYPYYLANEAVYANTDLEVTDKFSGKVATRVALADAQAIDAAIGAAVDAVKPMRELPAYRRQAVLDHCVARFRERFDELAEALCIEAGKPINDSRGEVTRLIDTFRVASEEAVRIDGEVLNLEISARAQGYTGYTRRVPIGPCSFISPFNFPLNLAAHKVAPALAAGCPFVLKPASRTPVGALIIAEVLAETNLPKGAFSVLPAHRDGADLFTTDERFRLLSFTGSPAVGWALKEKAGKKKVVLELGGNAAAIVDADQFEQLDYVVDRLAFGAYYQSGQSCIGVQRILVHASLYDTLRDKLVAKTRSLKMGDPKDPSTFVGPMISESESRRLSGWMDAAVAAGAKIIAGGKVDGAMFEATLLEDVGREQDLYRKEAFGPVAILEKFDRFDDALARVNDSDFGLQAGVFTDSLTHAQRAWDELEVGGVVINDVPSFRVDNMPYGGVKDSGLGREGIRYAIEDMTEPRLMVVRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Aldehyde dehydrogenase
publication title Crystal structure of an Aldedhyde dehydrogenase from Burkholderia vietnamiensis
rcsb
source organism Burkholderia vietnamiensis (strain g4 / lmg 22486)
total genus 177
structure length 480
sequence length 480
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00171 Aldedh Aldehyde dehydrogenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.309.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 2 Aldehyde Dehydrogenase; Chain A, domain 2 5kf0A02
3.40.605.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 1 Aldehyde Dehydrogenase; Chain A, domain 1 5kf0A01
2D4EA 2Y51A 4X0TA 5F2CA 4I3XA 2EIIA 1ZUMA 1NZXA 4GO0A 4ZZ7A 5AC0A 5KLMA 4OE6A 4NMKA 4OGDA 5KLLA 5EEBA 4NMJA 2O2PA 1WNDA 5L2OA 4Q92A 2O2QA 4OE5A 2W8PA 5EXFA 4I8QA 5FHZA 5ABMA 5KJ5A 1O04A 3IWKA 1O05A 2BHQA 2XDRA 1KY8A 2VROA 2Y5DA 4NPIA 3JU8A 2EIWA 3RHMA 4KNAA 3N81A 4GNZA 4I25A 1UXQA 5EK6A 2J5NA 4I9BA 4O5HA 3EFVA 4I3UA 4I3TA 1EZ0A 3RH9A 5JRYA 4MPYA 3B4WA 3SZAA 5L2MA 4PZ2A 4E3XA 5KLKA 2H5GA 5EZ4A 3V9GA 2HG2A 3VZ3A 4I3WA 4QF6A 1T90A 1UXTA 5EKCA 1BXSA 2EUHA 3RHHA 4CBBA 2JG7A 3QANA 4OE4A 4FQFA 1EYYA 2WMEC 3RHPA 1O00A 4IDSA 4I8PA 4ZWLA 4LGZA 2ILUA 3V9JA 4ZVXA 5KLOA 1O20A 4MPBA 4QJEA 3RHJA 2W8RA 1NZZA 4V3FA 2ID2A 3PQAA 1BI9A 1QI1A 4WPNA 4WJ9A 3RHQA 4C3SA 4YWEA 3RHLA 2EJ6A 1AD3A 4QETA 4ZVYA 3V9HA 1UXNA 4X0UA 4I3VA 1UXVA 2J6LA 4H80A 3RHRA 2QE0A 4GHKA 4ZULA 5AC2A 3TY7A 4IYMA 2ONPA 4ZVWA 5A2DA 5A2DD 1NZWA 4I1WA 2ONMA 4I2RA 4JDCA 4NU9A 4NS3A 4ITBA 3VZ0A 5EUYA 4F3XA 3RHOA 4QJEB 3V9KA 2W8NA 1A4SA 2BJAA 4H7NA 4QN2A 2J40A 5J6BA 2BJKA 4OUBA 1CW3A 4LH2A 4GO3A 3ETFA 5J7IA 4OHTA 2ESDA 4WB9A 3EK1A 4JZ6A 4L2OA 4QYJA 2W8QA 2IY6A 4YWUA 4ITAA 2ONNA 3K2WA 4LH0A 3I44A 4X4LA 2EITA 3MY7A 3R64A 4OE2A 3IWJA 4KWFA 2IMPA 1WNBA 4PXLB 4WP7A 4YWVA 1UXPA 3INJA 2W8OA 4V3FC 2EHQA 5J78A 2ONOA 5EYUA 3INLA 2Y52A 1UXRA 4H73A 3R31A 4GO4A 1UZBA 5KLNA 2OPXA 5L2NA 3N83A 3JZ4A 4LEMA 5KF0A 3VZ1A 2BHPA 2VLEA 4IDMA 3V9LA 3SZ9A 5AC1A 1UXUA 2EHUA 4PXLA 1QI6A 2EJLA 4JBEA 2O2RA 4KWGA 4L1OA 1EUHA 4V37A 4ZXUA 4NEAA 3VZ2A 5A2DC 5DRUA 3SZBA 3ROSA 4LH3A 1BPWA 4O6RA 3N80A 4I26A 3RJLA 4QTOA 1O9JA 3RHDA 2Y53A 4QGKA 5L13A 4CAZA 4E4GA 3PRLA 4ZUKA 1VLUA 4DNGA 1O02A 2WOXA 3ZQAA 4K57A 4IT9A 1A4ZA 2EJDA 4GO2A 4DALA 4OU2A 3V9IA 1AG8A 3N82A 4IHIA 4LIHA 4U3WA 4A0MA 3U4JA 4X2QA 5DBVA 1O01A 4FR8A 4LH1A 2WMEA 3K9DA 3V4CA 4PXNA 5DIBA
chains in the Genus database with same CATH superfamily
2D4EA 2Y51A 4X0TA 5F2CA 4I3XA 2EIIA 1ZUMA 1NZXA 4GO0A 4ZZ7A 5AC0A 5KLMA 4OE6A 4NMKA 4OGDA 5KLLA 5EEBA 4NMJA 2O2PA 1WNDA 5L2OA 4Q92A 2O2QA 4OE5A 2W8PA 5EXFA 4I8QA 5FHZA 5ABMA 5KJ5A 1O04A 3IWKA 1O05A 2BHQA 2XDRA 1KY8A 2VROA 2Y5DA 4NPIA 3JU8A 2EIWA 3RHMA 4KNAA 3N81A 4GNZA 4I25A 1UXQA 5EK6A 2J5NA 4I9BA 4O5HA 3EFVA 4I3UA 4I3TA 1EZ0A 3RH9A 5JRYA 4MPYA 3B4WA 3SZAA 5L2MA 4PZ2A 4E3XA 5KLKA 2H5GA 5EZ4A 3V9GA 2HG2A 3VZ3A 4I3WA 4QF6A 1T90A 1UXTA 5EKCA 1BXSA 2EUHA 3RHHA 4CBBA 2JG7A 3QANA 4OE4A 4FQFA 1EYYA 2WMEC 3RHPA 1O00A 4IDSA 4I8PA 4ZWLA 4LGZA 2ILUA 3V9JA 4ZVXA 5KLOA 1O20A 4MPBA 4QJEA 3RHJA 2W8RA 1NZZA 4V3FA 2ID2A 3PQAA 1BI9A 1QI1A 4WPNA 4WJ9A 3RHQA 4C3SA 4YWEA 3RHLA 2EJ6A 1AD3A 4QETA 4ZVYA 3V9HA 1UXNA 4X0UA 4I3VA 1UXVA 2J6LA 4H80A 3RHRA 2QE0A 4GHKA 4ZULA 5AC2A 3TY7A 4IYMA 2ONPA 4ZVWA 5A2DA 5A2DD 1NZWA 4I1WA 2ONMA 4I2RA 4JDCA 4NU9A 4NS3A 4ITBA 3VZ0A 5EUYA 4F3XA 3RHOA 4QJEB 3V9KA 2W8NA 1A4SA 2BJAA 4H7NA 4QN2A 2J40A 5J6BA 2BJKA 4OUBA 1CW3A 4LH2A 4GO3A 3ETFA 5J7IA 4OHTA 2ESDA 4WB9A 3EK1A 4JZ6A 4L2OA 4QYJA 2W8QA 2IY6A 4YWUA 4ITAA 2ONNA 3K2WA 4LH0A 3I44A 4X4LA 2EITA 3MY7A 3R64A 4OE2A 3IWJA 4KWFA 2IMPA 1WNBA 4PXLB 4WP7A 4YWVA 1UXPA 3INJA 2W8OA 4V3FC 2EHQA 5J78A 2ONOA 5EYUA 3INLA 2Y52A 1UXRA 4H73A 3R31A 4GO4A 1UZBA 5KLNA 2OPXA 5L2NA 3N83A 3JZ4A 4LEMA 5KF0A 3VZ1A 2BHPA 2VLEA 4IDMA 3V9LA 3SZ9A 5AC1A 1UXUA 2EHUA 4PXLA 1QI6A 2EJLA 4JBEA 2O2RA 4KWGA 4L1OA 1EUHA 4V37A 4ZXUA 4NEAA 3VZ2A 5A2DC 5DRUA 3SZBA 3ROSA 4LH3A 1BPWA 4O6RA 3N80A 4I26A 3RJLA 4QTOA 1O9JA 3RHDA 2Y53A 4QGKA 5L13A 4CAZA 4E4GA 3PRLA 4ZUKA 1VLUA 4DNGA 1O02A 2WOXA 3ZQAA 4K57A 4IT9A 1A4ZA 2EJDA 4GO2A 4DALA 4OU2A 3V9IA 1AG8A 3N82A 4IHIA 4LIHA 4U3WA 4A0MA 3U4JA 4X2QA 5DBVA 1O01A 4FR8A 4LH1A 2WMEA 3K9DA 3V4CA 4PXNA 5DIBA
chains in the Genus database with same CATH topology
2D4EA 2Y51A 4X0TA 5F2CA 4I3XA 2EIIA 1ZUMA 1NZXA 4GO0A 4ZZ7A 5AC0A 5KLMA 4OE6A 4NMKA 4OGDA 5KLLA 5EEBA 4NMJA 2O2PA 1WNDA 5L2OA 4Q92A 2O2QA 4OE5A 2W8PA 5EXFA 4I8QA 5FHZA 5ABMA 5KJ5A 1O04A 3IWKA 1O05A 2BHQA 2XDRA 1KY8A 2VROA 2Y5DA 4NPIA 3JU8A 2EIWA 3RHMA 4KNAA 3N81A 4GNZA 4I25A 1UXQA 5EK6A 2J5NA 4I9BA 4O5HA 3EFVA 4I3UA 4I3TA 1EZ0A 3RH9A 5JRYA 4MPYA 3B4WA 3SZAA 5L2MA 4PZ2A 4E3XA 5KLKA 2H5GA 5EZ4A 3V9GA 2HG2A 3VZ3A 4I3WA 4QF6A 1T90A 1UXTA 5EKCA 1BXSA 2EUHA 3RHHA 4CBBA 2JG7A 3QANA 4OE4A 4FQFA 1EYYA 2WMEC 3RHPA 1O00A 4IDSA 4I8PA 4ZWLA 4LGZA 2ILUA 3V9JA 4ZVXA 5KLOA 1O20A 4MPBA 4QJEA 3RHJA 2W8RA 1NZZA 4V3FA 2ID2A 3PQAA 1BI9A 1QI1A 4WPNA 4WJ9A 3RHQA 4C3SA 4YWEA 3RHLA 2EJ6A 1AD3A 4QETA 4ZVYA 3V9HA 1UXNA 4X0UA 4I3VA 1UXVA 2J6LA 4H80A 3RHRA 2QE0A 4GHKA 4ZULA 5AC2A 3TY7A 4IYMA 2ONPA 4ZVWA 5A2DA 5A2DD 1NZWA 4I1WA 2ONMA 4I2RA 4JDCA 4NU9A 4NS3A 4ITBA 3VZ0A 5EUYA 4F3XA 3RHOA 4QJEB 3V9KA 2W8NA 1A4SA 2BJAA 4H7NA 4QN2A 2J40A 5J6BA 2BJKA 4OUBA 1CW3A 4LH2A 4GO3A 3ETFA 5J7IA 4OHTA 2ESDA 4WB9A 3EK1A 4JZ6A 4L2OA 4QYJA 2W8QA 2IY6A 4YWUA 4ITAA 2ONNA 3K2WA 4LH0A 3I44A 4X4LA 2EITA 3MY7A 3R64A 4OE2A 3IWJA 4KWFA 2IMPA 1WNBA 4PXLB 4WP7A 4YWVA 1UXPA 3INJA 2W8OA 4V3FC 2EHQA 5J78A 2ONOA 5EYUA 3INLA 2Y52A 1UXRA 4H73A 3R31A 4GO4A 1UZBA 5KLNA 2OPXA 5L2NA 3N83A 3JZ4A 4LEMA 5KF0A 3VZ1A 2BHPA 2VLEA 4IDMA 3V9LA 3SZ9A 5AC1A 1UXUA 2EHUA 4PXLA 1QI6A 2EJLA 4JBEA 2O2RA 4KWGA 4L1OA 1EUHA 4V37A 4ZXUA 4NEAA 3VZ2A 5A2DC 5DRUA 3SZBA 3ROSA 4LH3A 1BPWA 4O6RA 3N80A 4I26A 3RJLA 4QTOA 1O9JA 3RHDA 2Y53A 4QGKA 5L13A 4CAZA 4E4GA 3PRLA 4ZUKA 1VLUA 4DNGA 1O02A 2WOXA 3ZQAA 4K57A 4IT9A 1A4ZA 2EJDA 4GO2A 4DALA 4OU2A 3V9IA 1AG8A 3N82A 4IHIA 4LIHA 4U3WA 4A0MA 3U4JA 4X2QA 5DBVA 1O01A 4FR8A 4LH1A 2WMEA 3K9DA 3V4CA 4PXNA 5DIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D4E A;  2Y51 A;  4X0T A;  5F2C A;  4I3X A;  2EII A;  1ZUM A;  1NZX A;  4GO0 A;  4ZZ7 A;  5AC0 A;  5KLM A;  4OE6 A;  4NMK A;  4OGD A;  5KLL A;  5EEB A;  4NMJ A;  2O2P A;  1WND A;  5L2O A;  4Q92 A;  2O2Q A;  4OE5 A;  2W8P A;  5EXF A;  4I8Q A;  5FHZ A;  5ABM A;  5KJ5 A;  1O04 A;  3IWK A;  1O05 A;  2BHQ A;  2XDR A;  1KY8 A;  2VRO A;  2Y5D A;  4NPI A;  3JU8 A;  2EIW A;  3RHM A;  4KNA A;  3N81 A;  4GNZ A;  4I25 A;  1UXQ A;  5EK6 A;  2J5N A;  4I9B A;  4O5H A;  3EFV A;  4I3U A;  4I3T A;  1EZ0 A;  3RH9 A;  5JRY A;  4MPY A;  3B4W A;  3SZA A;  5L2M A;  4PZ2 A;  4E3X A;  5KLK A;  2H5G A;  5EZ4 A;  3V9G A;  2HG2 A;  3VZ3 A;  4I3W A;  4QF6 A;  1T90 A;  1UXT A;  5EKC A;  1BXS A;  2EUH A;  3RHH A;  4CBB A;  2JG7 A;  3QAN A;  4OE4 A;  4FQF A;  1EYY A;  2WME C;  3RHP A;  1O00 A;  4IDS A;  4I8P A;  4ZWL A;  4LGZ A;  2ILU A;  3V9J A;  4ZVX A;  5KLO A;  1O20 A;  4MPB A;  4QJE A;  3RHJ A;  2W8R A;  1NZZ A;  4V3F A;  2ID2 A;  3PQA A;  1BI9 A;  1QI1 A;  4WPN A;  4WJ9 A;  3RHQ A;  4C3S A;  4YWE A;  3RHL A;  2EJ6 A;  1AD3 A;  4QET A;  4ZVY A;  3V9H A;  1UXN A;  4X0U A;  4I3V A;  1UXV A;  2J6L A;  4H80 A;  3RHR A;  2QE0 A;  4GHK A;  4ZUL A;  5AC2 A;  3TY7 A;  4IYM A;  2ONP A;  4ZVW A;  5A2D A;  5A2D D;  1NZW A;  4I1W A;  2ONM A;  4I2R A;  4JDC A;  4NU9 A;  4NS3 A;  4ITB A;  3VZ0 A;  5EUY A;  4F3X A;  3RHO A;  4QJE B;  3V9K A;  2W8N A;  1A4S A;  2BJA A;  4H7N A;  4QN2 A;  2J40 A;  5J6B A;  2BJK A;  4OUB A;  1CW3 A;  4LH2 A;  4GO3 A;  3ETF A;  5J7I A;  4OHT A;  2ESD A;  4WB9 A;  3EK1 A;  4JZ6 A;  4L2O A;  4QYJ A;  2W8Q A;  2IY6 A;  4YWU A;  4ITA A;  2ONN A;  3K2W A;  4LH0 A;  3I44 A;  4X4L A;  2EIT A;  3MY7 A;  3R64 A;  4OE2 A;  3IWJ A;  4KWF A;  2IMP A;  1WNB A;  4PXL B;  4WP7 A;  4YWV A;  1UXP A;  3INJ A;  2W8O A;  4V3F C;  2EHQ A;  5J78 A;  2ONO A;  5EYU A;  3INL A;  2Y52 A;  1UXR A;  4H73 A;  3R31 A;  4GO4 A;  1UZB A;  5KLN A;  2OPX A;  5L2N A;  3N83 A;  3JZ4 A;  4LEM A;  5KF0 A;  3VZ1 A;  2BHP A;  2VLE A;  4IDM A;  3V9L A;  3SZ9 A;  5AC1 A;  1UXU A;  2EHU A;  4PXL A;  1QI6 A;  2EJL A;  4JBE A;  2O2R A;  4KWG A;  4L1O A;  1EUH A;  4V37 A;  4ZXU A;  4NEA A;  3VZ2 A;  5A2D C;  5DRU A;  3SZB A;  3ROS A;  4LH3 A;  1BPW A;  4O6R A;  3N80 A;  4I26 A;  3RJL A;  4QTO A;  1O9J A;  3RHD A;  2Y53 A;  4QGK A;  5L13 A;  4CAZ A;  4E4G A;  3PRL A;  4ZUK A;  1VLU A;  4DNG A;  1O02 A;  2WOX A;  3ZQA A;  4K57 A;  4IT9 A;  1A4Z A;  2EJD A;  4GO2 A;  4DAL A;  4OU2 A;  3V9I A;  1AG8 A;  3N82 A;  4IHI A;  4LIH A;  4U3W A;  4A0M A;  3U4J A;  4X2Q A;  5DBV A;  1O01 A;  4FR8 A;  4LH1 A;  2WME A;  3K9D A;  3V4C A;  4PXN A;  5DIB A; 
#chains in the Genus database with same CATH topology
 2D4E A;  2Y51 A;  4X0T A;  5F2C A;  4I3X A;  2EII A;  1ZUM A;  1NZX A;  4GO0 A;  4ZZ7 A;  5AC0 A;  5KLM A;  4OE6 A;  4NMK A;  4OGD A;  5KLL A;  5EEB A;  4NMJ A;  2O2P A;  1WND A;  5L2O A;  4Q92 A;  2O2Q A;  4OE5 A;  2W8P A;  5EXF A;  4I8Q A;  5FHZ A;  5ABM A;  5KJ5 A;  1O04 A;  3IWK A;  1O05 A;  2BHQ A;  2XDR A;  1KY8 A;  2VRO A;  2Y5D A;  4NPI A;  3JU8 A;  2EIW A;  3RHM A;  4KNA A;  3N81 A;  4GNZ A;  4I25 A;  1UXQ A;  5EK6 A;  2J5N A;  4I9B A;  4O5H A;  3EFV A;  4I3U A;  4I3T A;  1EZ0 A;  3RH9 A;  5JRY A;  4MPY A;  3B4W A;  3SZA A;  5L2M A;  4PZ2 A;  4E3X A;  5KLK A;  2H5G A;  5EZ4 A;  3V9G A;  2HG2 A;  3VZ3 A;  4I3W A;  4QF6 A;  1T90 A;  1UXT A;  5EKC A;  1BXS A;  2EUH A;  3RHH A;  4CBB A;  2JG7 A;  3QAN A;  4OE4 A;  4FQF A;  1EYY A;  2WME C;  3RHP A;  1O00 A;  4IDS A;  4I8P A;  4ZWL A;  4LGZ A;  2ILU A;  3V9J A;  4ZVX A;  5KLO A;  1O20 A;  4MPB A;  4QJE A;  3RHJ A;  2W8R A;  1NZZ A;  4V3F A;  2ID2 A;  3PQA A;  1BI9 A;  1QI1 A;  4WPN A;  4WJ9 A;  3RHQ A;  4C3S A;  4YWE A;  3RHL A;  2EJ6 A;  1AD3 A;  4QET A;  4ZVY A;  3V9H A;  1UXN A;  4X0U A;  4I3V A;  1UXV A;  2J6L A;  4H80 A;  3RHR A;  2QE0 A;  4GHK A;  4ZUL A;  5AC2 A;  3TY7 A;  4IYM A;  2ONP A;  4ZVW A;  5A2D A;  5A2D D;  1NZW A;  4I1W A;  2ONM A;  4I2R A;  4JDC A;  4NU9 A;  4NS3 A;  4ITB A;  3VZ0 A;  5EUY A;  4F3X A;  3RHO A;  4QJE B;  3V9K A;  2W8N A;  1A4S A;  2BJA A;  4H7N A;  4QN2 A;  2J40 A;  5J6B A;  2BJK A;  4OUB A;  1CW3 A;  4LH2 A;  4GO3 A;  3ETF A;  5J7I A;  4OHT A;  2ESD A;  4WB9 A;  3EK1 A;  4JZ6 A;  4L2O A;  4QYJ A;  2W8Q A;  2IY6 A;  4YWU A;  4ITA A;  2ONN A;  3K2W A;  4LH0 A;  3I44 A;  4X4L A;  2EIT A;  3MY7 A;  3R64 A;  4OE2 A;  3IWJ A;  4KWF A;  2IMP A;  1WNB A;  4PXL B;  4WP7 A;  4YWV A;  1UXP A;  3INJ A;  2W8O A;  4V3F C;  2EHQ A;  5J78 A;  2ONO A;  5EYU A;  3INL A;  2Y52 A;  1UXR A;  4H73 A;  3R31 A;  4GO4 A;  1UZB A;  5KLN A;  2OPX A;  5L2N A;  3N83 A;  3JZ4 A;  4LEM A;  5KF0 A;  3VZ1 A;  2BHP A;  2VLE A;  4IDM A;  3V9L A;  3SZ9 A;  5AC1 A;  1UXU A;  2EHU A;  4PXL A;  1QI6 A;  2EJL A;  4JBE A;  2O2R A;  4KWG A;  4L1O A;  1EUH A;  4V37 A;  4ZXU A;  4NEA A;  3VZ2 A;  5A2D C;  5DRU A;  3SZB A;  3ROS A;  4LH3 A;  1BPW A;  4O6R A;  3N80 A;  4I26 A;  3RJL A;  4QTO A;  1O9J A;  3RHD A;  2Y53 A;  4QGK A;  5L13 A;  4CAZ A;  4E4G A;  3PRL A;  4ZUK A;  1VLU A;  4DNG A;  1O02 A;  2WOX A;  3ZQA A;  4K57 A;  4IT9 A;  1A4Z A;  2EJD A;  4GO2 A;  4DAL A;  4OU2 A;  3V9I A;  1AG8 A;  3N82 A;  4IHI A;  4LIH A;  4U3W A;  4A0M A;  3U4J A;  4X2Q A;  5DBV A;  1O01 A;  4FR8 A;  4LH1 A;  2WME A;  3K9D A;  3V4C A;  4PXN A;  5DIB A; 
#chains in the Genus database with same CATH homology
 2D4E A;  2Y51 A;  4X0T A;  5F2C A;  4I3X A;  2EII A;  1ZUM A;  1NZX A;  4GO0 A;  4ZZ7 A;  5AC0 A;  5KLM A;  4OE6 A;  4NMK A;  4OGD A;  5KLL A;  5EEB A;  4NMJ A;  2O2P A;  1WND A;  5L2O A;  4Q92 A;  2O2Q A;  4OE5 A;  2W8P A;  5EXF A;  4I8Q A;  5FHZ A;  5ABM A;  5KJ5 A;  1O04 A;  3IWK A;  1O05 A;  2BHQ A;  2XDR A;  1KY8 A;  2VRO A;  2Y5D A;  4NPI A;  3JU8 A;  2EIW A;  3RHM A;  4KNA A;  3N81 A;  4GNZ A;  4I25 A;  1UXQ A;  5EK6 A;  2J5N A;  4I9B A;  4O5H A;  3EFV A;  4I3U A;  4I3T A;  1EZ0 A;  3RH9 A;  5JRY A;  4MPY A;  3B4W A;  3SZA A;  5L2M A;  4PZ2 A;  4E3X A;  5KLK A;  2H5G A;  5EZ4 A;  3V9G A;  2HG2 A;  3VZ3 A;  4I3W A;  4QF6 A;  1T90 A;  1UXT A;  5EKC A;  1BXS A;  2EUH A;  3RHH A;  4CBB A;  2JG7 A;  3QAN A;  4OE4 A;  4FQF A;  1EYY A;  2WME C;  3RHP A;  1O00 A;  4IDS A;  4I8P A;  4ZWL A;  4LGZ A;  2ILU A;  3V9J A;  4ZVX A;  5KLO A;  1O20 A;  4MPB A;  4QJE A;  3RHJ A;  2W8R A;  1NZZ A;  4V3F A;  2ID2 A;  3PQA A;  1BI9 A;  1QI1 A;  4WPN A;  4WJ9 A;  3RHQ A;  4C3S A;  4YWE A;  3RHL A;  2EJ6 A;  1AD3 A;  4QET A;  4ZVY A;  3V9H A;  1UXN A;  4X0U A;  4I3V A;  1UXV A;  2J6L A;  4H80 A;  3RHR A;  2QE0 A;  4GHK A;  4ZUL A;  5AC2 A;  3TY7 A;  4IYM A;  2ONP A;  4ZVW A;  5A2D A;  5A2D D;  1NZW A;  4I1W A;  2ONM A;  4I2R A;  4JDC A;  4NU9 A;  4NS3 A;  4ITB A;  3VZ0 A;  5EUY A;  4F3X A;  3RHO A;  4QJE B;  3V9K A;  2W8N A;  1A4S A;  2BJA A;  4H7N A;  4QN2 A;  2J40 A;  5J6B A;  2BJK A;  4OUB A;  1CW3 A;  4LH2 A;  4GO3 A;  3ETF A;  5J7I A;  4OHT A;  2ESD A;  4WB9 A;  3EK1 A;  4JZ6 A;  4L2O A;  4QYJ A;  2W8Q A;  2IY6 A;  4YWU A;  4ITA A;  2ONN A;  3K2W A;  4LH0 A;  3I44 A;  4X4L A;  2EIT A;  3MY7 A;  3R64 A;  4OE2 A;  3IWJ A;  4KWF A;  2IMP A;  1WNB A;  4PXL B;  4WP7 A;  4YWV A;  1UXP A;  3INJ A;  2W8O A;  4V3F C;  2EHQ A;  5J78 A;  2ONO A;  5EYU A;  3INL A;  2Y52 A;  1UXR A;  4H73 A;  3R31 A;  4GO4 A;  1UZB A;  5KLN A;  2OPX A;  5L2N A;  3N83 A;  3JZ4 A;  4LEM A;  5KF0 A;  3VZ1 A;  2BHP A;  2VLE A;  4IDM A;  3V9L A;  3SZ9 A;  5AC1 A;  1UXU A;  2EHU A;  4PXL A;  1QI6 A;  2EJL A;  4JBE A;  2O2R A;  4KWG A;  4L1O A;  1EUH A;  4V37 A;  4ZXU A;  4NEA A;  3VZ2 A;  5A2D C;  5DRU A;  3SZB A;  3ROS A;  4LH3 A;  1BPW A;  4O6R A;  3N80 A;  4I26 A;  3RJL A;  4QTO A;  1O9J A;  3RHD A;  2Y53 A;  4QGK A;  5L13 A;  4CAZ A;  4E4G A;  3PRL A;  4ZUK A;  1VLU A;  4DNG A;  1O02 A;  2WOX A;  3ZQA A;  4K57 A;  4IT9 A;  1A4Z A;  2EJD A;  4GO2 A;  4DAL A;  4OU2 A;  3V9I A;  1AG8 A;  3N82 A;  4IHI A;  4LIH A;  4U3W A;  4A0M A;  3U4J A;  4X2Q A;  5DBV A;  1O01 A;  4FR8 A;  4LH1 A;  2WME A;  3K9D A;  3V4C A;  4PXN A;  5DIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...