5L2MA

Structure of aldh1a1 in complex with buc11
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
494
structure length
493
Chain Sequence
b'DLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Retinal dehydrogenase 1
publication title Inhibition of the Aldehyde Dehydrogenase 1/2 Family by Psoralen and Coumarin Derivatives.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inihbitor
total genus 186
structure length 493
sequence length 494
ec nomenclature ec 1.2.1.36: Retinal dehydrogenase.
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00171 Aldedh Aldehyde dehydrogenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.309.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 2 Aldehyde Dehydrogenase; Chain A, domain 2 5l2mA02
3.40.605.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 1 Aldehyde Dehydrogenase; Chain A, domain 1 5l2mA01
2ONPA 4IHIA 2Y53A 3RH9A 4GO4A 4WB9A 1AG8A 1UXRA 4JDCA 4NMJA 4X2QA 4ZVYA 4MPBA 1NZWA 2ONOA 2WOXA 3R31A 4QGKA 4I3WA 3RHRA 5J7IA 1O00A 4K57A 4KWFA 1CW3A 4PXLA 3RHJA 3K9DA 4H73A 3EK1A 4I8QA 4WPNA 4CAZA 5DRUA 3JU8A 1WNBA 4LIHA 1T90A 2XDRA 2W8NA 4IDSA 5DBVA 5A2DD 4OGDA 2W8PA 3V9KA 2IMPA 1UXTA 5EZ4A 3TY7A 3VZ1A 4F3XA 4NU9A 4PXLB 3R64A 5EXFA 4I3VA 4O6RA 4ZZ7A 3JZ4A 4QYJA 2ID2A 1AD3A 4OE6A 3RHMA 4X4LA 1O04A 1UXNA 2EUHA 4I3UA 5EK6A 4PZ2A 3RHHA 3V9HA 4X0TA 5AC1A 2J5NA 3K2WA 4IYMA 2BJKA 3N81A 3SZAA 1O9JA 2Y5DA 4LH3A 4Q92A 3V4CA 3RHOA 4ZULA 4ZVXA 3V9LA 2EIWA 4DNGA 4GNZA 4KWGA 4GO2A 1O02A 1UXUA 2W8RA 4L1OA 4QN2A 4QTOA 5EYUA 4QJEA 3RHLA 4H7NA 3ZQAA 4YWUA 5AC2A 5ABMA 1EYYA 1BPWA 3RJLA 4ZXUA 4YWEA 4OE2A 4OUBA 4JZ6A 3U4JA 5F2CA 4I9BA 4LH2A 2J6LA 3ROSA 3VZ2A 1UXVA 4I3TA 1O05A 3MY7A 4OHTA 1UXQA 2OPXA 5A2DC 5EKCA 4QJEB 3V9GA 5KLLA 1UXPA 5KLOA 1NZXA 2EHUA 3RHDA 4E4GA 2H5GA 2Y51A 4I26A 4QETA 4NPIA 4ZVWA 4A0MA 1EZ0A 4DALA 2BJAA 2J40A 4I1WA 4GO3A 2D4EA 1O01A 4NMKA 1UZBA 2EJDA 2ONNA 5A2DA 4L2OA 2WMEC 1BXSA 3V9JA 3INLA 5AC0A 5L2MA 2Y52A 5KLNA 1BI9A 2EHQA 3PQAA 2W8QA 1VLUA 4QF6A 5DIBA 2ONMA 3PRLA 4ITBA 1A4ZA 4LGZA 4ZWLA 5L13A 5KLKA 5KLMA 4FQFA 3EFVA 5L2OA 4OE5A 4KNAA 4PXNA 2EIIA 2WMEA 5EUYA 1WNDA 5L2NA 3RHQA 2O2RA 1QI6A 3RHPA 4LH1A 4E3XA 3VZ0A 3ETFA 4ITAA 2ILUA 2O2QA 4LEMA 4NS3A 4YWVA 5KF0A 2W8OA 4V3FC 2EJLA 4OE4A 2QE0A 5JRYA 5J6BA 2JG7A 4X0UA 4CBBA 4U3WA 2IY6A 4IT9A 4OU2A 4GHKA 4MPYA 4WP7A 3IWJA 3SZBA 4I25A 4C3SA 1QI1A 4NEAA 5FHZA 3B4WA 4ZUKA 2BHPA 3I44A 5EEBA 4I8PA 1ZUMA 3IWKA 4JBEA 4H80A 2VLEA 3V9IA 4I2RA 4GO0A 3N80A 5J78A 1NZZA 3VZ3A 2HG2A 4V37A 4IDMA 2BHQA 4V3FA 3N82A 1O20A 4O5HA 4FR8A 3QANA 1KY8A 3N83A 2EITA 2EJ6A 2O2PA 2VROA 3SZ9A 4LH0A 1EUHA 5KJ5A 1A4SA 4I3XA 4WJ9A 3INJA 2ESDA
chains in the Genus database with same CATH superfamily
2ONPA 4IHIA 2Y53A 3RH9A 4GO4A 4WB9A 1AG8A 1UXRA 4JDCA 4NMJA 4X2QA 4ZVYA 4MPBA 1NZWA 2ONOA 2WOXA 3R31A 4QGKA 4I3WA 3RHRA 5J7IA 1O00A 4K57A 4KWFA 1CW3A 4PXLA 3RHJA 3K9DA 4H73A 3EK1A 4I8QA 4WPNA 4CAZA 5DRUA 3JU8A 1WNBA 4LIHA 1T90A 2XDRA 2W8NA 4IDSA 5DBVA 5A2DD 4OGDA 2W8PA 3V9KA 2IMPA 1UXTA 5EZ4A 3TY7A 3VZ1A 4F3XA 4NU9A 4PXLB 3R64A 5EXFA 4I3VA 4O6RA 4ZZ7A 3JZ4A 4QYJA 2ID2A 1AD3A 4OE6A 3RHMA 4X4LA 1O04A 1UXNA 2EUHA 4I3UA 5EK6A 4PZ2A 3RHHA 3V9HA 4X0TA 5AC1A 2J5NA 3K2WA 4IYMA 2BJKA 3N81A 3SZAA 1O9JA 2Y5DA 4LH3A 4Q92A 3V4CA 3RHOA 4ZULA 4ZVXA 3V9LA 2EIWA 4DNGA 4GNZA 4KWGA 4GO2A 1O02A 1UXUA 2W8RA 4L1OA 4QN2A 4QTOA 5EYUA 4QJEA 3RHLA 4H7NA 3ZQAA 4YWUA 5AC2A 5ABMA 1EYYA 1BPWA 3RJLA 4ZXUA 4YWEA 4OE2A 4OUBA 4JZ6A 3U4JA 5F2CA 4I9BA 4LH2A 2J6LA 3ROSA 3VZ2A 1UXVA 4I3TA 1O05A 3MY7A 4OHTA 1UXQA 2OPXA 5A2DC 5EKCA 4QJEB 3V9GA 5KLLA 1UXPA 5KLOA 1NZXA 2EHUA 3RHDA 4E4GA 2H5GA 2Y51A 4I26A 4QETA 4NPIA 4ZVWA 4A0MA 1EZ0A 4DALA 2BJAA 2J40A 4I1WA 4GO3A 2D4EA 1O01A 4NMKA 1UZBA 2EJDA 2ONNA 5A2DA 4L2OA 2WMEC 1BXSA 3V9JA 3INLA 5AC0A 5L2MA 2Y52A 5KLNA 1BI9A 2EHQA 3PQAA 2W8QA 1VLUA 4QF6A 5DIBA 2ONMA 3PRLA 4ITBA 1A4ZA 4LGZA 4ZWLA 5L13A 5KLKA 5KLMA 4FQFA 3EFVA 5L2OA 4OE5A 4KNAA 4PXNA 2EIIA 2WMEA 5EUYA 1WNDA 5L2NA 3RHQA 2O2RA 1QI6A 3RHPA 4LH1A 4E3XA 3VZ0A 3ETFA 4ITAA 2ILUA 2O2QA 4LEMA 4NS3A 4YWVA 5KF0A 2W8OA 4V3FC 2EJLA 4OE4A 2QE0A 5JRYA 5J6BA 2JG7A 4X0UA 4CBBA 4U3WA 2IY6A 4IT9A 4OU2A 4GHKA 4MPYA 4WP7A 3IWJA 3SZBA 4I25A 4C3SA 1QI1A 4NEAA 5FHZA 3B4WA 4ZUKA 2BHPA 3I44A 5EEBA 4I8PA 1ZUMA 3IWKA 4JBEA 4H80A 2VLEA 3V9IA 4I2RA 4GO0A 3N80A 5J78A 1NZZA 3VZ3A 2HG2A 4V37A 4IDMA 2BHQA 4V3FA 3N82A 1O20A 4O5HA 4FR8A 3QANA 1KY8A 3N83A 2EITA 2EJ6A 2O2PA 2VROA 3SZ9A 4LH0A 1EUHA 5KJ5A 1A4SA 4I3XA 4WJ9A 3INJA 2ESDA
chains in the Genus database with same CATH topology
2ONPA 4IHIA 2Y53A 3RH9A 4GO4A 4WB9A 1AG8A 1UXRA 4JDCA 4NMJA 4X2QA 4ZVYA 4MPBA 1NZWA 2ONOA 2WOXA 3R31A 4QGKA 4I3WA 3RHRA 5J7IA 1O00A 4K57A 4KWFA 1CW3A 4PXLA 3RHJA 3K9DA 4H73A 3EK1A 4I8QA 4WPNA 4CAZA 5DRUA 3JU8A 1WNBA 4LIHA 1T90A 2XDRA 2W8NA 4IDSA 5DBVA 5A2DD 4OGDA 2W8PA 3V9KA 2IMPA 1UXTA 5EZ4A 3TY7A 3VZ1A 4F3XA 4NU9A 4PXLB 3R64A 5EXFA 4I3VA 4O6RA 4ZZ7A 3JZ4A 4QYJA 2ID2A 1AD3A 4OE6A 3RHMA 4X4LA 1O04A 1UXNA 2EUHA 4I3UA 5EK6A 4PZ2A 3RHHA 3V9HA 4X0TA 5AC1A 2J5NA 3K2WA 4IYMA 2BJKA 3N81A 3SZAA 1O9JA 2Y5DA 4LH3A 4Q92A 3V4CA 3RHOA 4ZULA 4ZVXA 3V9LA 2EIWA 4DNGA 4GNZA 4KWGA 4GO2A 1O02A 1UXUA 2W8RA 4L1OA 4QN2A 4QTOA 5EYUA 4QJEA 3RHLA 4H7NA 3ZQAA 4YWUA 5AC2A 5ABMA 1EYYA 1BPWA 3RJLA 4ZXUA 4YWEA 4OE2A 4OUBA 4JZ6A 3U4JA 5F2CA 4I9BA 4LH2A 2J6LA 3ROSA 3VZ2A 1UXVA 4I3TA 1O05A 3MY7A 4OHTA 1UXQA 2OPXA 5A2DC 5EKCA 4QJEB 3V9GA 5KLLA 1UXPA 5KLOA 1NZXA 2EHUA 3RHDA 4E4GA 2H5GA 2Y51A 4I26A 4QETA 4NPIA 4ZVWA 4A0MA 1EZ0A 4DALA 2BJAA 2J40A 4I1WA 4GO3A 2D4EA 1O01A 4NMKA 1UZBA 2EJDA 2ONNA 5A2DA 4L2OA 2WMEC 1BXSA 3V9JA 3INLA 5AC0A 5L2MA 2Y52A 5KLNA 1BI9A 2EHQA 3PQAA 2W8QA 1VLUA 4QF6A 5DIBA 2ONMA 3PRLA 4ITBA 1A4ZA 4LGZA 4ZWLA 5L13A 5KLKA 5KLMA 4FQFA 3EFVA 5L2OA 4OE5A 4KNAA 4PXNA 2EIIA 2WMEA 5EUYA 1WNDA 5L2NA 3RHQA 2O2RA 1QI6A 3RHPA 4LH1A 4E3XA 3VZ0A 3ETFA 4ITAA 2ILUA 2O2QA 4LEMA 4NS3A 4YWVA 5KF0A 2W8OA 4V3FC 2EJLA 4OE4A 2QE0A 5JRYA 5J6BA 2JG7A 4X0UA 4CBBA 4U3WA 2IY6A 4IT9A 4OU2A 4GHKA 4MPYA 4WP7A 3IWJA 3SZBA 4I25A 4C3SA 1QI1A 4NEAA 5FHZA 3B4WA 4ZUKA 2BHPA 3I44A 5EEBA 4I8PA 1ZUMA 3IWKA 4JBEA 4H80A 2VLEA 3V9IA 4I2RA 4GO0A 3N80A 5J78A 1NZZA 3VZ3A 2HG2A 4V37A 4IDMA 2BHQA 4V3FA 3N82A 1O20A 4O5HA 4FR8A 3QANA 1KY8A 3N83A 2EITA 2EJ6A 2O2PA 2VROA 3SZ9A 4LH0A 1EUHA 5KJ5A 1A4SA 4I3XA 4WJ9A 3INJA 2ESDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ONP A;  4IHI A;  2Y53 A;  3RH9 A;  4GO4 A;  4WB9 A;  1AG8 A;  1UXR A;  4JDC A;  4NMJ A;  4X2Q A;  4ZVY A;  4MPB A;  1NZW A;  2ONO A;  2WOX A;  3R31 A;  4QGK A;  4I3W A;  3RHR A;  5J7I A;  1O00 A;  4K57 A;  4KWF A;  1CW3 A;  4PXL A;  3RHJ A;  3K9D A;  4H73 A;  3EK1 A;  4I8Q A;  4WPN A;  4CAZ A;  5DRU A;  3JU8 A;  1WNB A;  4LIH A;  1T90 A;  2XDR A;  2W8N A;  4IDS A;  5DBV A;  5A2D D;  4OGD A;  2W8P A;  3V9K A;  2IMP A;  1UXT A;  5EZ4 A;  3TY7 A;  3VZ1 A;  4F3X A;  4NU9 A;  4PXL B;  3R64 A;  5EXF A;  4I3V A;  4O6R A;  4ZZ7 A;  3JZ4 A;  4QYJ A;  2ID2 A;  1AD3 A;  4OE6 A;  3RHM A;  4X4L A;  1O04 A;  1UXN A;  2EUH A;  4I3U A;  5EK6 A;  4PZ2 A;  3RHH A;  3V9H A;  4X0T A;  5AC1 A;  2J5N A;  3K2W A;  4IYM A;  2BJK A;  3N81 A;  3SZA A;  1O9J A;  2Y5D A;  4LH3 A;  4Q92 A;  3V4C A;  3RHO A;  4ZUL A;  4ZVX A;  3V9L A;  2EIW A;  4DNG A;  4GNZ A;  4KWG A;  4GO2 A;  1O02 A;  1UXU A;  2W8R A;  4L1O A;  4QN2 A;  4QTO A;  5EYU A;  4QJE A;  3RHL A;  4H7N A;  3ZQA A;  4YWU A;  5AC2 A;  5ABM A;  1EYY A;  1BPW A;  3RJL A;  4ZXU A;  4YWE A;  4OE2 A;  4OUB A;  4JZ6 A;  3U4J A;  5F2C A;  4I9B A;  4LH2 A;  2J6L A;  3ROS A;  3VZ2 A;  1UXV A;  4I3T A;  1O05 A;  3MY7 A;  4OHT A;  1UXQ A;  2OPX A;  5A2D C;  5EKC A;  4QJE B;  3V9G A;  5KLL A;  1UXP A;  5KLO A;  1NZX A;  2EHU A;  3RHD A;  4E4G A;  2H5G A;  2Y51 A;  4I26 A;  4QET A;  4NPI A;  4ZVW A;  4A0M A;  1EZ0 A;  4DAL A;  2BJA A;  2J40 A;  4I1W A;  4GO3 A;  2D4E A;  1O01 A;  4NMK A;  1UZB A;  2EJD A;  2ONN A;  5A2D A;  4L2O A;  2WME C;  1BXS A;  3V9J A;  3INL A;  5AC0 A;  5L2M A;  2Y52 A;  5KLN A;  1BI9 A;  2EHQ A;  3PQA A;  2W8Q A;  1VLU A;  4QF6 A;  5DIB A;  2ONM A;  3PRL A;  4ITB A;  1A4Z A;  4LGZ A;  4ZWL A;  5L13 A;  5KLK A;  5KLM A;  4FQF A;  3EFV A;  5L2O A;  4OE5 A;  4KNA A;  4PXN A;  2EII A;  2WME A;  5EUY A;  1WND A;  5L2N A;  3RHQ A;  2O2R A;  1QI6 A;  3RHP A;  4LH1 A;  4E3X A;  3VZ0 A;  3ETF A;  4ITA A;  2ILU A;  2O2Q A;  4LEM A;  4NS3 A;  4YWV A;  5KF0 A;  2W8O A;  4V3F C;  2EJL A;  4OE4 A;  2QE0 A;  5JRY A;  5J6B A;  2JG7 A;  4X0U A;  4CBB A;  4U3W A;  2IY6 A;  4IT9 A;  4OU2 A;  4GHK A;  4MPY A;  4WP7 A;  3IWJ A;  3SZB A;  4I25 A;  4C3S A;  1QI1 A;  4NEA A;  5FHZ A;  3B4W A;  4ZUK A;  2BHP A;  3I44 A;  5EEB A;  4I8P A;  1ZUM A;  3IWK A;  4JBE A;  4H80 A;  2VLE A;  3V9I A;  4I2R A;  4GO0 A;  3N80 A;  5J78 A;  1NZZ A;  3VZ3 A;  2HG2 A;  4V37 A;  4IDM A;  2BHQ A;  4V3F A;  3N82 A;  1O20 A;  4O5H A;  4FR8 A;  3QAN A;  1KY8 A;  3N83 A;  2EIT A;  2EJ6 A;  2O2P A;  2VRO A;  3SZ9 A;  4LH0 A;  1EUH A;  5KJ5 A;  1A4S A;  4I3X A;  4WJ9 A;  3INJ A;  2ESD A; 
#chains in the Genus database with same CATH topology
 2ONP A;  4IHI A;  2Y53 A;  3RH9 A;  4GO4 A;  4WB9 A;  1AG8 A;  1UXR A;  4JDC A;  4NMJ A;  4X2Q A;  4ZVY A;  4MPB A;  1NZW A;  2ONO A;  2WOX A;  3R31 A;  4QGK A;  4I3W A;  3RHR A;  5J7I A;  1O00 A;  4K57 A;  4KWF A;  1CW3 A;  4PXL A;  3RHJ A;  3K9D A;  4H73 A;  3EK1 A;  4I8Q A;  4WPN A;  4CAZ A;  5DRU A;  3JU8 A;  1WNB A;  4LIH A;  1T90 A;  2XDR A;  2W8N A;  4IDS A;  5DBV A;  5A2D D;  4OGD A;  2W8P A;  3V9K A;  2IMP A;  1UXT A;  5EZ4 A;  3TY7 A;  3VZ1 A;  4F3X A;  4NU9 A;  4PXL B;  3R64 A;  5EXF A;  4I3V A;  4O6R A;  4ZZ7 A;  3JZ4 A;  4QYJ A;  2ID2 A;  1AD3 A;  4OE6 A;  3RHM A;  4X4L A;  1O04 A;  1UXN A;  2EUH A;  4I3U A;  5EK6 A;  4PZ2 A;  3RHH A;  3V9H A;  4X0T A;  5AC1 A;  2J5N A;  3K2W A;  4IYM A;  2BJK A;  3N81 A;  3SZA A;  1O9J A;  2Y5D A;  4LH3 A;  4Q92 A;  3V4C A;  3RHO A;  4ZUL A;  4ZVX A;  3V9L A;  2EIW A;  4DNG A;  4GNZ A;  4KWG A;  4GO2 A;  1O02 A;  1UXU A;  2W8R A;  4L1O A;  4QN2 A;  4QTO A;  5EYU A;  4QJE A;  3RHL A;  4H7N A;  3ZQA A;  4YWU A;  5AC2 A;  5ABM A;  1EYY A;  1BPW A;  3RJL A;  4ZXU A;  4YWE A;  4OE2 A;  4OUB A;  4JZ6 A;  3U4J A;  5F2C A;  4I9B A;  4LH2 A;  2J6L A;  3ROS A;  3VZ2 A;  1UXV A;  4I3T A;  1O05 A;  3MY7 A;  4OHT A;  1UXQ A;  2OPX A;  5A2D C;  5EKC A;  4QJE B;  3V9G A;  5KLL A;  1UXP A;  5KLO A;  1NZX A;  2EHU A;  3RHD A;  4E4G A;  2H5G A;  2Y51 A;  4I26 A;  4QET A;  4NPI A;  4ZVW A;  4A0M A;  1EZ0 A;  4DAL A;  2BJA A;  2J40 A;  4I1W A;  4GO3 A;  2D4E A;  1O01 A;  4NMK A;  1UZB A;  2EJD A;  2ONN A;  5A2D A;  4L2O A;  2WME C;  1BXS A;  3V9J A;  3INL A;  5AC0 A;  5L2M A;  2Y52 A;  5KLN A;  1BI9 A;  2EHQ A;  3PQA A;  2W8Q A;  1VLU A;  4QF6 A;  5DIB A;  2ONM A;  3PRL A;  4ITB A;  1A4Z A;  4LGZ A;  4ZWL A;  5L13 A;  5KLK A;  5KLM A;  4FQF A;  3EFV A;  5L2O A;  4OE5 A;  4KNA A;  4PXN A;  2EII A;  2WME A;  5EUY A;  1WND A;  5L2N A;  3RHQ A;  2O2R A;  1QI6 A;  3RHP A;  4LH1 A;  4E3X A;  3VZ0 A;  3ETF A;  4ITA A;  2ILU A;  2O2Q A;  4LEM A;  4NS3 A;  4YWV A;  5KF0 A;  2W8O A;  4V3F C;  2EJL A;  4OE4 A;  2QE0 A;  5JRY A;  5J6B A;  2JG7 A;  4X0U A;  4CBB A;  4U3W A;  2IY6 A;  4IT9 A;  4OU2 A;  4GHK A;  4MPY A;  4WP7 A;  3IWJ A;  3SZB A;  4I25 A;  4C3S A;  1QI1 A;  4NEA A;  5FHZ A;  3B4W A;  4ZUK A;  2BHP A;  3I44 A;  5EEB A;  4I8P A;  1ZUM A;  3IWK A;  4JBE A;  4H80 A;  2VLE A;  3V9I A;  4I2R A;  4GO0 A;  3N80 A;  5J78 A;  1NZZ A;  3VZ3 A;  2HG2 A;  4V37 A;  4IDM A;  2BHQ A;  4V3F A;  3N82 A;  1O20 A;  4O5H A;  4FR8 A;  3QAN A;  1KY8 A;  3N83 A;  2EIT A;  2EJ6 A;  2O2P A;  2VRO A;  3SZ9 A;  4LH0 A;  1EUH A;  5KJ5 A;  1A4S A;  4I3X A;  4WJ9 A;  3INJ A;  2ESD A; 
#chains in the Genus database with same CATH homology
 2ONP A;  4IHI A;  2Y53 A;  3RH9 A;  4GO4 A;  4WB9 A;  1AG8 A;  1UXR A;  4JDC A;  4NMJ A;  4X2Q A;  4ZVY A;  4MPB A;  1NZW A;  2ONO A;  2WOX A;  3R31 A;  4QGK A;  4I3W A;  3RHR A;  5J7I A;  1O00 A;  4K57 A;  4KWF A;  1CW3 A;  4PXL A;  3RHJ A;  3K9D A;  4H73 A;  3EK1 A;  4I8Q A;  4WPN A;  4CAZ A;  5DRU A;  3JU8 A;  1WNB A;  4LIH A;  1T90 A;  2XDR A;  2W8N A;  4IDS A;  5DBV A;  5A2D D;  4OGD A;  2W8P A;  3V9K A;  2IMP A;  1UXT A;  5EZ4 A;  3TY7 A;  3VZ1 A;  4F3X A;  4NU9 A;  4PXL B;  3R64 A;  5EXF A;  4I3V A;  4O6R A;  4ZZ7 A;  3JZ4 A;  4QYJ A;  2ID2 A;  1AD3 A;  4OE6 A;  3RHM A;  4X4L A;  1O04 A;  1UXN A;  2EUH A;  4I3U A;  5EK6 A;  4PZ2 A;  3RHH A;  3V9H A;  4X0T A;  5AC1 A;  2J5N A;  3K2W A;  4IYM A;  2BJK A;  3N81 A;  3SZA A;  1O9J A;  2Y5D A;  4LH3 A;  4Q92 A;  3V4C A;  3RHO A;  4ZUL A;  4ZVX A;  3V9L A;  2EIW A;  4DNG A;  4GNZ A;  4KWG A;  4GO2 A;  1O02 A;  1UXU A;  2W8R A;  4L1O A;  4QN2 A;  4QTO A;  5EYU A;  4QJE A;  3RHL A;  4H7N A;  3ZQA A;  4YWU A;  5AC2 A;  5ABM A;  1EYY A;  1BPW A;  3RJL A;  4ZXU A;  4YWE A;  4OE2 A;  4OUB A;  4JZ6 A;  3U4J A;  5F2C A;  4I9B A;  4LH2 A;  2J6L A;  3ROS A;  3VZ2 A;  1UXV A;  4I3T A;  1O05 A;  3MY7 A;  4OHT A;  1UXQ A;  2OPX A;  5A2D C;  5EKC A;  4QJE B;  3V9G A;  5KLL A;  1UXP A;  5KLO A;  1NZX A;  2EHU A;  3RHD A;  4E4G A;  2H5G A;  2Y51 A;  4I26 A;  4QET A;  4NPI A;  4ZVW A;  4A0M A;  1EZ0 A;  4DAL A;  2BJA A;  2J40 A;  4I1W A;  4GO3 A;  2D4E A;  1O01 A;  4NMK A;  1UZB A;  2EJD A;  2ONN A;  5A2D A;  4L2O A;  2WME C;  1BXS A;  3V9J A;  3INL A;  5AC0 A;  5L2M A;  2Y52 A;  5KLN A;  1BI9 A;  2EHQ A;  3PQA A;  2W8Q A;  1VLU A;  4QF6 A;  5DIB A;  2ONM A;  3PRL A;  4ITB A;  1A4Z A;  4LGZ A;  4ZWL A;  5L13 A;  5KLK A;  5KLM A;  4FQF A;  3EFV A;  5L2O A;  4OE5 A;  4KNA A;  4PXN A;  2EII A;  2WME A;  5EUY A;  1WND A;  5L2N A;  3RHQ A;  2O2R A;  1QI6 A;  3RHP A;  4LH1 A;  4E3X A;  3VZ0 A;  3ETF A;  4ITA A;  2ILU A;  2O2Q A;  4LEM A;  4NS3 A;  4YWV A;  5KF0 A;  2W8O A;  4V3F C;  2EJL A;  4OE4 A;  2QE0 A;  5JRY A;  5J6B A;  2JG7 A;  4X0U A;  4CBB A;  4U3W A;  2IY6 A;  4IT9 A;  4OU2 A;  4GHK A;  4MPY A;  4WP7 A;  3IWJ A;  3SZB A;  4I25 A;  4C3S A;  1QI1 A;  4NEA A;  5FHZ A;  3B4W A;  4ZUK A;  2BHP A;  3I44 A;  5EEB A;  4I8P A;  1ZUM A;  3IWK A;  4JBE A;  4H80 A;  2VLE A;  3V9I A;  4I2R A;  4GO0 A;  3N80 A;  5J78 A;  1NZZ A;  3VZ3 A;  2HG2 A;  4V37 A;  4IDM A;  2BHQ A;  4V3F A;  3N82 A;  1O20 A;  4O5H A;  4FR8 A;  3QAN A;  1KY8 A;  3N83 A;  2EIT A;  2EJ6 A;  2O2P A;  2VRO A;  3SZ9 A;  4LH0 A;  1EUH A;  5KJ5 A;  1A4S A;  4I3X A;  4WJ9 A;  3INJ A;  2ESD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...