5L2MA

Structure of aldh1a1 in complex with buc11
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
494
structure length
493
Chain Sequence
DLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inihbitor
molecule keywords Retinal dehydrogenase 1
publication title Inhibition of the Aldehyde Dehydrogenase 1/2 Family by Psoralen and Coumarin Derivatives.
pubmed doi rcsb
source organism Homo sapiens
total genus 186
structure length 493
sequence length 494
ec nomenclature ec 1.2.1.36: Retinal dehydrogenase.
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00171 Aldedh Aldehyde dehydrogenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.309.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 2 Aldehyde Dehydrogenase; Chain A, domain 2 5l2mA02
3.40.605.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 1 Aldehyde Dehydrogenase; Chain A, domain 1 5l2mA01
2OPXA 3EK1A 4O5HA 1A4ZA 2Y5DA 1EYYA 2ID2A 4I2RA 2O2PA 5JRYA 4LIHA 3SZBA 4KNAA 4I8QA 4YWEA 5KLLA 4IT9A 4QETA 4WB9A 1BXSA 3V9IA 4NS3A 4OUBA 1O01A 3RHLA 3RHJA 4O6RA 2BJAA 5L2OA 4NEAA 5L13A 1O05A 2ONMA 3V9LA 3VZ0A 4DALA 5A2DC 5J7IA 1QI6A 2VROA 4ZVYA 1BPWA 3RHHA 1UZBA 3INLA 2WMEA 5EUYA 4DNGA 5AC1A 4H73A 4GO4A 4LGZA 5J6BA 2J5NA 3IWKA 4FR8A 4IYMA 5EXFA 5EEBA 2EIIA 4GHKA 4QN2A 3V9GA 4U3WA 2JG7A 4E4GA 5KF0A 3SZ9A 2VLEA 2ONNA 4I8PA 4ZULA 4I3UA 3V9JA 4CAZA 2EIWA 2W8NA 3RHOA 4CBBA 4OU2A 4GO3A 1NZWA 1WNDA 4I3VA 4K57A 3V9HA 5A2DA 2HG2A 3PQAA 4WPNA 4I26A 4Q92A 4L1OA 5DBVA 1O9JA 5ABMA 3ETFA 2W8PA 1AD3A 3ZQAA 5A2DD 3RHMA 4QGKA 1UXVA 2J40A 4I25A 3K2WA 1VLUA 4I1WA 5EYUA 2EJDA 5DIBA 5F2CA 1O02A 4LH1A 4V3FC 4ITAA 4PXLB 3V9KA 4OHTA 1QI1A 4QF6A 1AG8A 4LEMA 2W8OA 4FQFA 4X0UA 4NPIA 1UXRA 4V37A 5J78A 4OGDA 4IDMA 4NMKA 4QJEA 3V4CA 4X4LA 1EZ0A 4YWVA 2BHQA 3VZ2A 5EK6A 4X0TA 3ROSA 4JDCA 3VZ3A 5L2NA 2Y53A 2WOXA 2ONPA 4PXNA 4A0MA 4GO0A 4OE6A 4ZXUA 2IY6A 3N83A 4ZUKA 1CW3A 5KLNA 1O00A 5FHZA 3QANA 2EITA 2QE0A 4E3XA 4I9BA 3R31A 4IDSA 3EFVA 1A4SA 2ONOA 4MPBA 3N82A 3RH9A 2BJKA 2IMPA 3B4WA 5KLKA 2ESDA 4ZWLA 3RHDA 4KWGA 4QYJA 1UXNA 4OE2A 3MY7A 1UXQA 3R64A 3K9DA 1KY8A 3JZ4A 4GO2A 5DRUA 4ZZ7A 1T90A 4OE5A 1EUHA 3INJA 1NZXA 2J6LA 5EZ4A 5KJ5A 4NU9A 4ZVWA 2D4EA 2H5GA 1NZZA 2EHQA 1ZUMA 4JBEA 5KLMA 1UXUA 4LH2A 3IWJA 4GNZA 4MPYA 1UXPA 4I3XA 4WJ9A 5EKCA 4IHIA 4LH3A 4F3XA 2ILUA 3SZAA 4H7NA 4KWFA 4H80A 2EJ6A 5L2MA 3N81A 4LH0A 4C3SA 4YWUA 5KLOA 3VZ1A 4OE4A 4WP7A 4NMJA 2EJLA 1BI9A 2W8QA 4QTOA 4X2QA 1O04A 4I3WA 2Y52A 3JU8A 4V3FA 4ZVXA 3RHPA 3RJLA 3TY7A 3N80A 2W8RA 2EUHA 4JZ6A 4I3TA 4L2OA 3I44A 2O2RA 4QJEB 5AC2A 2WMEC 3U4JA 1UXTA 1WNBA 3RHRA 3PRLA 5AC0A 2O2QA 2EHUA 4PXLA 1O20A 2XDRA 3RHQA 2Y51A 4PZ2A 4ITBA 2BHPA
chains in the Genus database with same CATH superfamily
2OPXA 3EK1A 4O5HA 1A4ZA 2Y5DA 1EYYA 2ID2A 4I2RA 2O2PA 5JRYA 4LIHA 3SZBA 4KNAA 4I8QA 4YWEA 5KLLA 4IT9A 4QETA 4WB9A 1BXSA 3V9IA 4NS3A 4OUBA 1O01A 3RHLA 3RHJA 4O6RA 2BJAA 5L2OA 4NEAA 5L13A 1O05A 2ONMA 3V9LA 3VZ0A 4DALA 5A2DC 5J7IA 1QI6A 2VROA 4ZVYA 1BPWA 3RHHA 1UZBA 3INLA 2WMEA 5EUYA 4DNGA 5AC1A 4H73A 4GO4A 4LGZA 5J6BA 2J5NA 3IWKA 4FR8A 4IYMA 5EXFA 5EEBA 2EIIA 4GHKA 4QN2A 3V9GA 4U3WA 2JG7A 4E4GA 5KF0A 3SZ9A 2VLEA 2ONNA 4I8PA 4ZULA 4I3UA 3V9JA 4CAZA 2EIWA 2W8NA 3RHOA 4CBBA 4OU2A 4GO3A 1NZWA 1WNDA 4I3VA 4K57A 3V9HA 5A2DA 2HG2A 3PQAA 4WPNA 4I26A 4Q92A 4L1OA 5DBVA 1O9JA 5ABMA 3ETFA 2W8PA 1AD3A 3ZQAA 5A2DD 3RHMA 4QGKA 1UXVA 2J40A 4I25A 3K2WA 1VLUA 4I1WA 5EYUA 2EJDA 5DIBA 5F2CA 1O02A 4LH1A 4V3FC 4ITAA 4PXLB 3V9KA 4OHTA 1QI1A 4QF6A 1AG8A 4LEMA 2W8OA 4FQFA 4X0UA 4NPIA 1UXRA 4V37A 5J78A 4OGDA 4IDMA 4NMKA 4QJEA 3V4CA 4X4LA 1EZ0A 4YWVA 2BHQA 3VZ2A 5EK6A 4X0TA 3ROSA 4JDCA 3VZ3A 5L2NA 2Y53A 2WOXA 2ONPA 4PXNA 4A0MA 4GO0A 4OE6A 4ZXUA 2IY6A 3N83A 4ZUKA 1CW3A 5KLNA 1O00A 5FHZA 3QANA 2EITA 2QE0A 4E3XA 4I9BA 3R31A 4IDSA 3EFVA 1A4SA 2ONOA 4MPBA 3N82A 3RH9A 2BJKA 2IMPA 3B4WA 5KLKA 2ESDA 4ZWLA 3RHDA 4KWGA 4QYJA 1UXNA 4OE2A 3MY7A 1UXQA 3R64A 3K9DA 1KY8A 3JZ4A 4GO2A 5DRUA 4ZZ7A 1T90A 4OE5A 1EUHA 3INJA 1NZXA 2J6LA 5EZ4A 5KJ5A 4NU9A 4ZVWA 2D4EA 2H5GA 1NZZA 2EHQA 1ZUMA 4JBEA 5KLMA 1UXUA 4LH2A 3IWJA 4GNZA 4MPYA 1UXPA 4I3XA 4WJ9A 5EKCA 4IHIA 4LH3A 4F3XA 2ILUA 3SZAA 4H7NA 4KWFA 4H80A 2EJ6A 5L2MA 3N81A 4LH0A 4C3SA 4YWUA 5KLOA 3VZ1A 4OE4A 4WP7A 4NMJA 2EJLA 1BI9A 2W8QA 4QTOA 4X2QA 1O04A 4I3WA 2Y52A 3JU8A 4V3FA 4ZVXA 3RHPA 3RJLA 3TY7A 3N80A 2W8RA 2EUHA 4JZ6A 4I3TA 4L2OA 3I44A 2O2RA 4QJEB 5AC2A 2WMEC 3U4JA 1UXTA 1WNBA 3RHRA 3PRLA 5AC0A 2O2QA 2EHUA 4PXLA 1O20A 2XDRA 3RHQA 2Y51A 4PZ2A 4ITBA 2BHPA
chains in the Genus database with same CATH topology
2OPXA 3EK1A 4O5HA 1A4ZA 2Y5DA 1EYYA 2ID2A 4I2RA 2O2PA 5JRYA 4LIHA 3SZBA 4KNAA 4I8QA 4YWEA 5KLLA 4IT9A 4QETA 4WB9A 1BXSA 3V9IA 4NS3A 4OUBA 1O01A 3RHLA 3RHJA 4O6RA 2BJAA 5L2OA 4NEAA 5L13A 1O05A 2ONMA 3V9LA 3VZ0A 4DALA 5A2DC 5J7IA 1QI6A 2VROA 4ZVYA 1BPWA 3RHHA 1UZBA 3INLA 2WMEA 5EUYA 4DNGA 5AC1A 4H73A 4GO4A 4LGZA 5J6BA 2J5NA 3IWKA 4FR8A 4IYMA 5EXFA 5EEBA 2EIIA 4GHKA 4QN2A 3V9GA 4U3WA 2JG7A 4E4GA 5KF0A 3SZ9A 2VLEA 2ONNA 4I8PA 4ZULA 4I3UA 3V9JA 4CAZA 2EIWA 2W8NA 3RHOA 4CBBA 4OU2A 4GO3A 1NZWA 1WNDA 4I3VA 4K57A 3V9HA 5A2DA 2HG2A 3PQAA 4WPNA 4I26A 4Q92A 4L1OA 5DBVA 1O9JA 5ABMA 3ETFA 2W8PA 1AD3A 3ZQAA 5A2DD 3RHMA 4QGKA 1UXVA 2J40A 4I25A 3K2WA 1VLUA 4I1WA 5EYUA 2EJDA 5DIBA 5F2CA 1O02A 4LH1A 4V3FC 4ITAA 4PXLB 3V9KA 4OHTA 1QI1A 4QF6A 1AG8A 4LEMA 2W8OA 4FQFA 4X0UA 4NPIA 1UXRA 4V37A 5J78A 4OGDA 4IDMA 4NMKA 4QJEA 3V4CA 4X4LA 1EZ0A 4YWVA 2BHQA 3VZ2A 5EK6A 4X0TA 3ROSA 4JDCA 3VZ3A 5L2NA 2Y53A 2WOXA 2ONPA 4PXNA 4A0MA 4GO0A 4OE6A 4ZXUA 2IY6A 3N83A 4ZUKA 1CW3A 5KLNA 1O00A 5FHZA 3QANA 2EITA 2QE0A 4E3XA 4I9BA 3R31A 4IDSA 3EFVA 1A4SA 2ONOA 4MPBA 3N82A 3RH9A 2BJKA 2IMPA 3B4WA 5KLKA 2ESDA 4ZWLA 3RHDA 4KWGA 4QYJA 1UXNA 4OE2A 3MY7A 1UXQA 3R64A 3K9DA 1KY8A 3JZ4A 4GO2A 5DRUA 4ZZ7A 1T90A 4OE5A 1EUHA 3INJA 1NZXA 2J6LA 5EZ4A 5KJ5A 4NU9A 4ZVWA 2D4EA 2H5GA 1NZZA 2EHQA 1ZUMA 4JBEA 5KLMA 1UXUA 4LH2A 3IWJA 4GNZA 4MPYA 1UXPA 4I3XA 4WJ9A 5EKCA 4IHIA 4LH3A 4F3XA 2ILUA 3SZAA 4H7NA 4KWFA 4H80A 2EJ6A 5L2MA 3N81A 4LH0A 4C3SA 4YWUA 5KLOA 3VZ1A 4OE4A 4WP7A 4NMJA 2EJLA 1BI9A 2W8QA 4QTOA 4X2QA 1O04A 4I3WA 2Y52A 3JU8A 4V3FA 4ZVXA 3RHPA 3RJLA 3TY7A 3N80A 2W8RA 2EUHA 4JZ6A 4I3TA 4L2OA 3I44A 2O2RA 4QJEB 5AC2A 2WMEC 3U4JA 1UXTA 1WNBA 3RHRA 3PRLA 5AC0A 2O2QA 2EHUA 4PXLA 1O20A 2XDRA 3RHQA 2Y51A 4PZ2A 4ITBA 2BHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPX A;  3EK1 A;  4O5H A;  1A4Z A;  2Y5D A;  1EYY A;  2ID2 A;  4I2R A;  2O2P A;  5JRY A;  4LIH A;  3SZB A;  4KNA A;  4I8Q A;  4YWE A;  5KLL A;  4IT9 A;  4QET A;  4WB9 A;  1BXS A;  3V9I A;  4NS3 A;  4OUB A;  1O01 A;  3RHL A;  3RHJ A;  4O6R A;  2BJA A;  5L2O A;  4NEA A;  5L13 A;  1O05 A;  2ONM A;  3V9L A;  3VZ0 A;  4DAL A;  5A2D C;  5J7I A;  1QI6 A;  2VRO A;  4ZVY A;  1BPW A;  3RHH A;  1UZB A;  3INL A;  2WME A;  5EUY A;  4DNG A;  5AC1 A;  4H73 A;  4GO4 A;  4LGZ A;  5J6B A;  2J5N A;  3IWK A;  4FR8 A;  4IYM A;  5EXF A;  5EEB A;  2EII A;  4GHK A;  4QN2 A;  3V9G A;  4U3W A;  2JG7 A;  4E4G A;  5KF0 A;  3SZ9 A;  2VLE A;  2ONN A;  4I8P A;  4ZUL A;  4I3U A;  3V9J A;  4CAZ A;  2EIW A;  2W8N A;  3RHO A;  4CBB A;  4OU2 A;  4GO3 A;  1NZW A;  1WND A;  4I3V A;  4K57 A;  3V9H A;  5A2D A;  2HG2 A;  3PQA A;  4WPN A;  4I26 A;  4Q92 A;  4L1O A;  5DBV A;  1O9J A;  5ABM A;  3ETF A;  2W8P A;  1AD3 A;  3ZQA A;  5A2D D;  3RHM A;  4QGK A;  1UXV A;  2J40 A;  4I25 A;  3K2W A;  1VLU A;  4I1W A;  5EYU A;  2EJD A;  5DIB A;  5F2C A;  1O02 A;  4LH1 A;  4V3F C;  4ITA A;  4PXL B;  3V9K A;  4OHT A;  1QI1 A;  4QF6 A;  1AG8 A;  4LEM A;  2W8O A;  4FQF A;  4X0U A;  4NPI A;  1UXR A;  4V37 A;  5J78 A;  4OGD A;  4IDM A;  4NMK A;  4QJE A;  3V4C A;  4X4L A;  1EZ0 A;  4YWV A;  2BHQ A;  3VZ2 A;  5EK6 A;  4X0T A;  3ROS A;  4JDC A;  3VZ3 A;  5L2N A;  2Y53 A;  2WOX A;  2ONP A;  4PXN A;  4A0M A;  4GO0 A;  4OE6 A;  4ZXU A;  2IY6 A;  3N83 A;  4ZUK A;  1CW3 A;  5KLN A;  1O00 A;  5FHZ A;  3QAN A;  2EIT A;  2QE0 A;  4E3X A;  4I9B A;  3R31 A;  4IDS A;  3EFV A;  1A4S A;  2ONO A;  4MPB A;  3N82 A;  3RH9 A;  2BJK A;  2IMP A;  3B4W A;  5KLK A;  2ESD A;  4ZWL A;  3RHD A;  4KWG A;  4QYJ A;  1UXN A;  4OE2 A;  3MY7 A;  1UXQ A;  3R64 A;  3K9D A;  1KY8 A;  3JZ4 A;  4GO2 A;  5DRU A;  4ZZ7 A;  1T90 A;  4OE5 A;  1EUH A;  3INJ A;  1NZX A;  2J6L A;  5EZ4 A;  5KJ5 A;  4NU9 A;  4ZVW A;  2D4E A;  2H5G A;  1NZZ A;  2EHQ A;  1ZUM A;  4JBE A;  5KLM A;  1UXU A;  4LH2 A;  3IWJ A;  4GNZ A;  4MPY A;  1UXP A;  4I3X A;  4WJ9 A;  5EKC A;  4IHI A;  4LH3 A;  4F3X A;  2ILU A;  3SZA A;  4H7N A;  4KWF A;  4H80 A;  2EJ6 A;  5L2M A;  3N81 A;  4LH0 A;  4C3S A;  4YWU A;  5KLO A;  3VZ1 A;  4OE4 A;  4WP7 A;  4NMJ A;  2EJL A;  1BI9 A;  2W8Q A;  4QTO A;  4X2Q A;  1O04 A;  4I3W A;  2Y52 A;  3JU8 A;  4V3F A;  4ZVX A;  3RHP A;  3RJL A;  3TY7 A;  3N80 A;  2W8R A;  2EUH A;  4JZ6 A;  4I3T A;  4L2O A;  3I44 A;  2O2R A;  4QJE B;  5AC2 A;  2WME C;  3U4J A;  1UXT A;  1WNB A;  3RHR A;  3PRL A;  5AC0 A;  2O2Q A;  2EHU A;  4PXL A;  1O20 A;  2XDR A;  3RHQ A;  2Y51 A;  4PZ2 A;  4ITB A;  2BHP A; 
#chains in the Genus database with same CATH topology
 2OPX A;  3EK1 A;  4O5H A;  1A4Z A;  2Y5D A;  1EYY A;  2ID2 A;  4I2R A;  2O2P A;  5JRY A;  4LIH A;  3SZB A;  4KNA A;  4I8Q A;  4YWE A;  5KLL A;  4IT9 A;  4QET A;  4WB9 A;  1BXS A;  3V9I A;  4NS3 A;  4OUB A;  1O01 A;  3RHL A;  3RHJ A;  4O6R A;  2BJA A;  5L2O A;  4NEA A;  5L13 A;  1O05 A;  2ONM A;  3V9L A;  3VZ0 A;  4DAL A;  5A2D C;  5J7I A;  1QI6 A;  2VRO A;  4ZVY A;  1BPW A;  3RHH A;  1UZB A;  3INL A;  2WME A;  5EUY A;  4DNG A;  5AC1 A;  4H73 A;  4GO4 A;  4LGZ A;  5J6B A;  2J5N A;  3IWK A;  4FR8 A;  4IYM A;  5EXF A;  5EEB A;  2EII A;  4GHK A;  4QN2 A;  3V9G A;  4U3W A;  2JG7 A;  4E4G A;  5KF0 A;  3SZ9 A;  2VLE A;  2ONN A;  4I8P A;  4ZUL A;  4I3U A;  3V9J A;  4CAZ A;  2EIW A;  2W8N A;  3RHO A;  4CBB A;  4OU2 A;  4GO3 A;  1NZW A;  1WND A;  4I3V A;  4K57 A;  3V9H A;  5A2D A;  2HG2 A;  3PQA A;  4WPN A;  4I26 A;  4Q92 A;  4L1O A;  5DBV A;  1O9J A;  5ABM A;  3ETF A;  2W8P A;  1AD3 A;  3ZQA A;  5A2D D;  3RHM A;  4QGK A;  1UXV A;  2J40 A;  4I25 A;  3K2W A;  1VLU A;  4I1W A;  5EYU A;  2EJD A;  5DIB A;  5F2C A;  1O02 A;  4LH1 A;  4V3F C;  4ITA A;  4PXL B;  3V9K A;  4OHT A;  1QI1 A;  4QF6 A;  1AG8 A;  4LEM A;  2W8O A;  4FQF A;  4X0U A;  4NPI A;  1UXR A;  4V37 A;  5J78 A;  4OGD A;  4IDM A;  4NMK A;  4QJE A;  3V4C A;  4X4L A;  1EZ0 A;  4YWV A;  2BHQ A;  3VZ2 A;  5EK6 A;  4X0T A;  3ROS A;  4JDC A;  3VZ3 A;  5L2N A;  2Y53 A;  2WOX A;  2ONP A;  4PXN A;  4A0M A;  4GO0 A;  4OE6 A;  4ZXU A;  2IY6 A;  3N83 A;  4ZUK A;  1CW3 A;  5KLN A;  1O00 A;  5FHZ A;  3QAN A;  2EIT A;  2QE0 A;  4E3X A;  4I9B A;  3R31 A;  4IDS A;  3EFV A;  1A4S A;  2ONO A;  4MPB A;  3N82 A;  3RH9 A;  2BJK A;  2IMP A;  3B4W A;  5KLK A;  2ESD A;  4ZWL A;  3RHD A;  4KWG A;  4QYJ A;  1UXN A;  4OE2 A;  3MY7 A;  1UXQ A;  3R64 A;  3K9D A;  1KY8 A;  3JZ4 A;  4GO2 A;  5DRU A;  4ZZ7 A;  1T90 A;  4OE5 A;  1EUH A;  3INJ A;  1NZX A;  2J6L A;  5EZ4 A;  5KJ5 A;  4NU9 A;  4ZVW A;  2D4E A;  2H5G A;  1NZZ A;  2EHQ A;  1ZUM A;  4JBE A;  5KLM A;  1UXU A;  4LH2 A;  3IWJ A;  4GNZ A;  4MPY A;  1UXP A;  4I3X A;  4WJ9 A;  5EKC A;  4IHI A;  4LH3 A;  4F3X A;  2ILU A;  3SZA A;  4H7N A;  4KWF A;  4H80 A;  2EJ6 A;  5L2M A;  3N81 A;  4LH0 A;  4C3S A;  4YWU A;  5KLO A;  3VZ1 A;  4OE4 A;  4WP7 A;  4NMJ A;  2EJL A;  1BI9 A;  2W8Q A;  4QTO A;  4X2Q A;  1O04 A;  4I3W A;  2Y52 A;  3JU8 A;  4V3F A;  4ZVX A;  3RHP A;  3RJL A;  3TY7 A;  3N80 A;  2W8R A;  2EUH A;  4JZ6 A;  4I3T A;  4L2O A;  3I44 A;  2O2R A;  4QJE B;  5AC2 A;  2WME C;  3U4J A;  1UXT A;  1WNB A;  3RHR A;  3PRL A;  5AC0 A;  2O2Q A;  2EHU A;  4PXL A;  1O20 A;  2XDR A;  3RHQ A;  2Y51 A;  4PZ2 A;  4ITB A;  2BHP A; 
#chains in the Genus database with same CATH homology
 2OPX A;  3EK1 A;  4O5H A;  1A4Z A;  2Y5D A;  1EYY A;  2ID2 A;  4I2R A;  2O2P A;  5JRY A;  4LIH A;  3SZB A;  4KNA A;  4I8Q A;  4YWE A;  5KLL A;  4IT9 A;  4QET A;  4WB9 A;  1BXS A;  3V9I A;  4NS3 A;  4OUB A;  1O01 A;  3RHL A;  3RHJ A;  4O6R A;  2BJA A;  5L2O A;  4NEA A;  5L13 A;  1O05 A;  2ONM A;  3V9L A;  3VZ0 A;  4DAL A;  5A2D C;  5J7I A;  1QI6 A;  2VRO A;  4ZVY A;  1BPW A;  3RHH A;  1UZB A;  3INL A;  2WME A;  5EUY A;  4DNG A;  5AC1 A;  4H73 A;  4GO4 A;  4LGZ A;  5J6B A;  2J5N A;  3IWK A;  4FR8 A;  4IYM A;  5EXF A;  5EEB A;  2EII A;  4GHK A;  4QN2 A;  3V9G A;  4U3W A;  2JG7 A;  4E4G A;  5KF0 A;  3SZ9 A;  2VLE A;  2ONN A;  4I8P A;  4ZUL A;  4I3U A;  3V9J A;  4CAZ A;  2EIW A;  2W8N A;  3RHO A;  4CBB A;  4OU2 A;  4GO3 A;  1NZW A;  1WND A;  4I3V A;  4K57 A;  3V9H A;  5A2D A;  2HG2 A;  3PQA A;  4WPN A;  4I26 A;  4Q92 A;  4L1O A;  5DBV A;  1O9J A;  5ABM A;  3ETF A;  2W8P A;  1AD3 A;  3ZQA A;  5A2D D;  3RHM A;  4QGK A;  1UXV A;  2J40 A;  4I25 A;  3K2W A;  1VLU A;  4I1W A;  5EYU A;  2EJD A;  5DIB A;  5F2C A;  1O02 A;  4LH1 A;  4V3F C;  4ITA A;  4PXL B;  3V9K A;  4OHT A;  1QI1 A;  4QF6 A;  1AG8 A;  4LEM A;  2W8O A;  4FQF A;  4X0U A;  4NPI A;  1UXR A;  4V37 A;  5J78 A;  4OGD A;  4IDM A;  4NMK A;  4QJE A;  3V4C A;  4X4L A;  1EZ0 A;  4YWV A;  2BHQ A;  3VZ2 A;  5EK6 A;  4X0T A;  3ROS A;  4JDC A;  3VZ3 A;  5L2N A;  2Y53 A;  2WOX A;  2ONP A;  4PXN A;  4A0M A;  4GO0 A;  4OE6 A;  4ZXU A;  2IY6 A;  3N83 A;  4ZUK A;  1CW3 A;  5KLN A;  1O00 A;  5FHZ A;  3QAN A;  2EIT A;  2QE0 A;  4E3X A;  4I9B A;  3R31 A;  4IDS A;  3EFV A;  1A4S A;  2ONO A;  4MPB A;  3N82 A;  3RH9 A;  2BJK A;  2IMP A;  3B4W A;  5KLK A;  2ESD A;  4ZWL A;  3RHD A;  4KWG A;  4QYJ A;  1UXN A;  4OE2 A;  3MY7 A;  1UXQ A;  3R64 A;  3K9D A;  1KY8 A;  3JZ4 A;  4GO2 A;  5DRU A;  4ZZ7 A;  1T90 A;  4OE5 A;  1EUH A;  3INJ A;  1NZX A;  2J6L A;  5EZ4 A;  5KJ5 A;  4NU9 A;  4ZVW A;  2D4E A;  2H5G A;  1NZZ A;  2EHQ A;  1ZUM A;  4JBE A;  5KLM A;  1UXU A;  4LH2 A;  3IWJ A;  4GNZ A;  4MPY A;  1UXP A;  4I3X A;  4WJ9 A;  5EKC A;  4IHI A;  4LH3 A;  4F3X A;  2ILU A;  3SZA A;  4H7N A;  4KWF A;  4H80 A;  2EJ6 A;  5L2M A;  3N81 A;  4LH0 A;  4C3S A;  4YWU A;  5KLO A;  3VZ1 A;  4OE4 A;  4WP7 A;  4NMJ A;  2EJL A;  1BI9 A;  2W8Q A;  4QTO A;  4X2Q A;  1O04 A;  4I3W A;  2Y52 A;  3JU8 A;  4V3F A;  4ZVX A;  3RHP A;  3RJL A;  3TY7 A;  3N80 A;  2W8R A;  2EUH A;  4JZ6 A;  4I3T A;  4L2O A;  3I44 A;  2O2R A;  4QJE B;  5AC2 A;  2WME C;  3U4J A;  1UXT A;  1WNB A;  3RHR A;  3PRL A;  5AC0 A;  2O2Q A;  2EHU A;  4PXL A;  1O20 A;  2XDR A;  3RHQ A;  2Y51 A;  4PZ2 A;  4ITB A;  2BHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...