5L2NA

Structure of aldh1a1 in complex with buc25
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
494
structure length
493
Chain Sequence
DLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Retinal dehydrogenase 1
publication title Inhibition of the Aldehyde Dehydrogenase 1/2 Family by Psoralen and Coumarin Derivatives.
pubmed doi rcsb
source organism Homo sapiens
total genus 184
structure length 493
sequence length 494
ec nomenclature ec 1.2.1.36: Retinal dehydrogenase.
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00171 Aldedh Aldehyde dehydrogenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.309.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 2 Aldehyde Dehydrogenase; Chain A, domain 2 5l2nA02
3.40.605.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 1 Aldehyde Dehydrogenase; Chain A, domain 1 5l2nA01
2JG7A 4ZZ7A 4QYJA 3PQAA 1EUHA 4OHTA 5A2DA 1NZZA 2Y51A 1UXNA 2H5GA 3ROSA 2W8OA 3INJA 2Y53A 4K57A 4LH0A 4NS3A 5AC2A 2EJLA 2Y5DA 3RHHA 3V9LA 2ONMA 5L13A 3U4JA 2J5NA 4LGZA 5F2CA 4V3FA 2WMEC 4H7NA 4NU9A 4ZVXA 5L2OA 2EHQA 5EK6A 3MY7A 5EXFA 3VZ3A 2W8PA 5AC0A 4U3WA 2QE0A 4IDSA 1T90A 4IT9A 4PXLA 3V9JA 3VZ2A 5KLMA 4LH3A 3TY7A 4LIHA 1A4SA 3V4CA 4L1OA 1UXQA 4O5HA 3RHOA 1KY8A 2ESDA 4GHKA 3N80A 4I1WA 4QJEB 4KNAA 3R64A 3EFVA 4ITAA 4ZWLA 4ZVWA 4F3XA 2IY6A 4LH1A 3K2WA 4WPNA 1O20A 1EYYA 1AG8A 4L2OA 4FR8A 4NEAA 4FQFA 1UZBA 4PZ2A 4DALA 3SZBA 3RH9A 2EUHA 1O05A 5AC1A 3R31A 3PRLA 2ONNA 1UXPA 2EJ6A 5J78A 2VLEA 4KWGA 4E3XA 4GNZA 4WJ9A 5KLLA 3I44A 4C3SA 4I25A 4NMKA 5KLKA 2WOXA 1WNDA 5EYUA 5A2DC 4WB9A 3RHQA 3VZ0A 1A4ZA 4E4GA 1ZUMA 3RHRA 1CW3A 4QF6A 2Y52A 2W8RA 4OE5A 1QI6A 4OE4A 4OUBA 4IDMA 1UXTA 4OU2A 4QJEA 2EITA 3RHDA 3RJLA 4YWVA 3EK1A 4CBBA 3SZ9A 1BPWA 1O00A 3V9HA 4JZ6A 4IHIA 5EEBA 4V3FC 3SZAA 2ID2A 4NPIA 1BXSA 4OE2A 4QGKA 5DBVA 4GO3A 4CAZA 4H80A 5KJ5A 2EJDA 4DNGA 3JZ4A 5L2MA 1NZWA 4JDCA 2J6LA 2VROA 4ZULA 3B4WA 4I3VA 2O2PA 4ZUKA 4I8PA 3V9IA 3ZQAA 3JU8A 3QANA 4MPYA 4ZVYA 3V9GA 1UXRA 5KLOA 3N81A 2W8QA 5J6BA 1WNBA 1VLUA 5DIBA 4I3TA 3RHPA 3N83A 4IYMA 3RHLA 4X0UA 2O2QA 1NZXA 3INLA 2IMPA 4NMJA 5J7IA 4GO4A 2ONOA 2ILUA 4ITBA 3V9KA 5KLNA 2WMEA 2BJKA 3N82A 4PXLB 3RHMA 1O01A 4I2RA 4X0TA 5A2DD 2W8NA 1QI1A 5JRYA 3IWJA 4I8QA 2HG2A 1UXUA 2EIWA 4YWEA 1O02A 2BHPA 3IWKA 5DRUA 4I9BA 5EUYA 4PXNA 2BHQA 1O9JA 4Q92A 3ETFA 5EKCA 3VZ1A 1UXVA 3RHJA 2BJAA 4I3XA 5L2NA 1EZ0A 4ZXUA 1BI9A 4GO2A 4JBEA 4OGDA 2EIIA 4GO0A 5KF0A 2OPXA 4QN2A 4X2QA 2D4EA 2EHUA 4QETA 4KWFA 4H73A 4WP7A 3K9DA 4X4LA 5FHZA 2XDRA 4MPBA 1O04A 4OE6A 2O2RA 4I26A 4LEMA 1AD3A 4I3WA 4YWUA 5EZ4A 5ABMA 4LH2A 2ONPA 2J40A 4A0MA 4O6RA 4I3UA 4V37A 4QTOA
chains in the Genus database with same CATH superfamily
2JG7A 4ZZ7A 4QYJA 3PQAA 1EUHA 4OHTA 5A2DA 1NZZA 2Y51A 1UXNA 2H5GA 3ROSA 2W8OA 3INJA 2Y53A 4K57A 4LH0A 4NS3A 5AC2A 2EJLA 2Y5DA 3RHHA 3V9LA 2ONMA 5L13A 3U4JA 2J5NA 4LGZA 5F2CA 4V3FA 2WMEC 4H7NA 4NU9A 4ZVXA 5L2OA 2EHQA 5EK6A 3MY7A 5EXFA 3VZ3A 2W8PA 5AC0A 4U3WA 2QE0A 4IDSA 1T90A 4IT9A 4PXLA 3V9JA 3VZ2A 5KLMA 4LH3A 3TY7A 4LIHA 1A4SA 3V4CA 4L1OA 1UXQA 4O5HA 3RHOA 1KY8A 2ESDA 4GHKA 3N80A 4I1WA 4QJEB 4KNAA 3R64A 3EFVA 4ITAA 4ZWLA 4ZVWA 4F3XA 2IY6A 4LH1A 3K2WA 4WPNA 1O20A 1EYYA 1AG8A 4L2OA 4FR8A 4NEAA 4FQFA 1UZBA 4PZ2A 4DALA 3SZBA 3RH9A 2EUHA 1O05A 5AC1A 3R31A 3PRLA 2ONNA 1UXPA 2EJ6A 5J78A 2VLEA 4KWGA 4E3XA 4GNZA 4WJ9A 5KLLA 3I44A 4C3SA 4I25A 4NMKA 5KLKA 2WOXA 1WNDA 5EYUA 5A2DC 4WB9A 3RHQA 3VZ0A 1A4ZA 4E4GA 1ZUMA 3RHRA 1CW3A 4QF6A 2Y52A 2W8RA 4OE5A 1QI6A 4OE4A 4OUBA 4IDMA 1UXTA 4OU2A 4QJEA 2EITA 3RHDA 3RJLA 4YWVA 3EK1A 4CBBA 3SZ9A 1BPWA 1O00A 3V9HA 4JZ6A 4IHIA 5EEBA 4V3FC 3SZAA 2ID2A 4NPIA 1BXSA 4OE2A 4QGKA 5DBVA 4GO3A 4CAZA 4H80A 5KJ5A 2EJDA 4DNGA 3JZ4A 5L2MA 1NZWA 4JDCA 2J6LA 2VROA 4ZULA 3B4WA 4I3VA 2O2PA 4ZUKA 4I8PA 3V9IA 3ZQAA 3JU8A 3QANA 4MPYA 4ZVYA 3V9GA 1UXRA 5KLOA 3N81A 2W8QA 5J6BA 1WNBA 1VLUA 5DIBA 4I3TA 3RHPA 3N83A 4IYMA 3RHLA 4X0UA 2O2QA 1NZXA 3INLA 2IMPA 4NMJA 5J7IA 4GO4A 2ONOA 2ILUA 4ITBA 3V9KA 5KLNA 2WMEA 2BJKA 3N82A 4PXLB 3RHMA 1O01A 4I2RA 4X0TA 5A2DD 2W8NA 1QI1A 5JRYA 3IWJA 4I8QA 2HG2A 1UXUA 2EIWA 4YWEA 1O02A 2BHPA 3IWKA 5DRUA 4I9BA 5EUYA 4PXNA 2BHQA 1O9JA 4Q92A 3ETFA 5EKCA 3VZ1A 1UXVA 3RHJA 2BJAA 4I3XA 5L2NA 1EZ0A 4ZXUA 1BI9A 4GO2A 4JBEA 4OGDA 2EIIA 4GO0A 5KF0A 2OPXA 4QN2A 4X2QA 2D4EA 2EHUA 4QETA 4KWFA 4H73A 4WP7A 3K9DA 4X4LA 5FHZA 2XDRA 4MPBA 1O04A 4OE6A 2O2RA 4I26A 4LEMA 1AD3A 4I3WA 4YWUA 5EZ4A 5ABMA 4LH2A 2ONPA 2J40A 4A0MA 4O6RA 4I3UA 4V37A 4QTOA
chains in the Genus database with same CATH topology
2JG7A 4ZZ7A 4QYJA 3PQAA 1EUHA 4OHTA 5A2DA 1NZZA 2Y51A 1UXNA 2H5GA 3ROSA 2W8OA 3INJA 2Y53A 4K57A 4LH0A 4NS3A 5AC2A 2EJLA 2Y5DA 3RHHA 3V9LA 2ONMA 5L13A 3U4JA 2J5NA 4LGZA 5F2CA 4V3FA 2WMEC 4H7NA 4NU9A 4ZVXA 5L2OA 2EHQA 5EK6A 3MY7A 5EXFA 3VZ3A 2W8PA 5AC0A 4U3WA 2QE0A 4IDSA 1T90A 4IT9A 4PXLA 3V9JA 3VZ2A 5KLMA 4LH3A 3TY7A 4LIHA 1A4SA 3V4CA 4L1OA 1UXQA 4O5HA 3RHOA 1KY8A 2ESDA 4GHKA 3N80A 4I1WA 4QJEB 4KNAA 3R64A 3EFVA 4ITAA 4ZWLA 4ZVWA 4F3XA 2IY6A 4LH1A 3K2WA 4WPNA 1O20A 1EYYA 1AG8A 4L2OA 4FR8A 4NEAA 4FQFA 1UZBA 4PZ2A 4DALA 3SZBA 3RH9A 2EUHA 1O05A 5AC1A 3R31A 3PRLA 2ONNA 1UXPA 2EJ6A 5J78A 2VLEA 4KWGA 4E3XA 4GNZA 4WJ9A 5KLLA 3I44A 4C3SA 4I25A 4NMKA 5KLKA 2WOXA 1WNDA 5EYUA 5A2DC 4WB9A 3RHQA 3VZ0A 1A4ZA 4E4GA 1ZUMA 3RHRA 1CW3A 4QF6A 2Y52A 2W8RA 4OE5A 1QI6A 4OE4A 4OUBA 4IDMA 1UXTA 4OU2A 4QJEA 2EITA 3RHDA 3RJLA 4YWVA 3EK1A 4CBBA 3SZ9A 1BPWA 1O00A 3V9HA 4JZ6A 4IHIA 5EEBA 4V3FC 3SZAA 2ID2A 4NPIA 1BXSA 4OE2A 4QGKA 5DBVA 4GO3A 4CAZA 4H80A 5KJ5A 2EJDA 4DNGA 3JZ4A 5L2MA 1NZWA 4JDCA 2J6LA 2VROA 4ZULA 3B4WA 4I3VA 2O2PA 4ZUKA 4I8PA 3V9IA 3ZQAA 3JU8A 3QANA 4MPYA 4ZVYA 3V9GA 1UXRA 5KLOA 3N81A 2W8QA 5J6BA 1WNBA 1VLUA 5DIBA 4I3TA 3RHPA 3N83A 4IYMA 3RHLA 4X0UA 2O2QA 1NZXA 3INLA 2IMPA 4NMJA 5J7IA 4GO4A 2ONOA 2ILUA 4ITBA 3V9KA 5KLNA 2WMEA 2BJKA 3N82A 4PXLB 3RHMA 1O01A 4I2RA 4X0TA 5A2DD 2W8NA 1QI1A 5JRYA 3IWJA 4I8QA 2HG2A 1UXUA 2EIWA 4YWEA 1O02A 2BHPA 3IWKA 5DRUA 4I9BA 5EUYA 4PXNA 2BHQA 1O9JA 4Q92A 3ETFA 5EKCA 3VZ1A 1UXVA 3RHJA 2BJAA 4I3XA 5L2NA 1EZ0A 4ZXUA 1BI9A 4GO2A 4JBEA 4OGDA 2EIIA 4GO0A 5KF0A 2OPXA 4QN2A 4X2QA 2D4EA 2EHUA 4QETA 4KWFA 4H73A 4WP7A 3K9DA 4X4LA 5FHZA 2XDRA 4MPBA 1O04A 4OE6A 2O2RA 4I26A 4LEMA 1AD3A 4I3WA 4YWUA 5EZ4A 5ABMA 4LH2A 2ONPA 2J40A 4A0MA 4O6RA 4I3UA 4V37A 4QTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JG7 A;  4ZZ7 A;  4QYJ A;  3PQA A;  1EUH A;  4OHT A;  5A2D A;  1NZZ A;  2Y51 A;  1UXN A;  2H5G A;  3ROS A;  2W8O A;  3INJ A;  2Y53 A;  4K57 A;  4LH0 A;  4NS3 A;  5AC2 A;  2EJL A;  2Y5D A;  3RHH A;  3V9L A;  2ONM A;  5L13 A;  3U4J A;  2J5N A;  4LGZ A;  5F2C A;  4V3F A;  2WME C;  4H7N A;  4NU9 A;  4ZVX A;  5L2O A;  2EHQ A;  5EK6 A;  3MY7 A;  5EXF A;  3VZ3 A;  2W8P A;  5AC0 A;  4U3W A;  2QE0 A;  4IDS A;  1T90 A;  4IT9 A;  4PXL A;  3V9J A;  3VZ2 A;  5KLM A;  4LH3 A;  3TY7 A;  4LIH A;  1A4S A;  3V4C A;  4L1O A;  1UXQ A;  4O5H A;  3RHO A;  1KY8 A;  2ESD A;  4GHK A;  3N80 A;  4I1W A;  4QJE B;  4KNA A;  3R64 A;  3EFV A;  4ITA A;  4ZWL A;  4ZVW A;  4F3X A;  2IY6 A;  4LH1 A;  3K2W A;  4WPN A;  1O20 A;  1EYY A;  1AG8 A;  4L2O A;  4FR8 A;  4NEA A;  4FQF A;  1UZB A;  4PZ2 A;  4DAL A;  3SZB A;  3RH9 A;  2EUH A;  1O05 A;  5AC1 A;  3R31 A;  3PRL A;  2ONN A;  1UXP A;  2EJ6 A;  5J78 A;  2VLE A;  4KWG A;  4E3X A;  4GNZ A;  4WJ9 A;  5KLL A;  3I44 A;  4C3S A;  4I25 A;  4NMK A;  5KLK A;  2WOX A;  1WND A;  5EYU A;  5A2D C;  4WB9 A;  3RHQ A;  3VZ0 A;  1A4Z A;  4E4G A;  1ZUM A;  3RHR A;  1CW3 A;  4QF6 A;  2Y52 A;  2W8R A;  4OE5 A;  1QI6 A;  4OE4 A;  4OUB A;  4IDM A;  1UXT A;  4OU2 A;  4QJE A;  2EIT A;  3RHD A;  3RJL A;  4YWV A;  3EK1 A;  4CBB A;  3SZ9 A;  1BPW A;  1O00 A;  3V9H A;  4JZ6 A;  4IHI A;  5EEB A;  4V3F C;  3SZA A;  2ID2 A;  4NPI A;  1BXS A;  4OE2 A;  4QGK A;  5DBV A;  4GO3 A;  4CAZ A;  4H80 A;  5KJ5 A;  2EJD A;  4DNG A;  3JZ4 A;  5L2M A;  1NZW A;  4JDC A;  2J6L A;  2VRO A;  4ZUL A;  3B4W A;  4I3V A;  2O2P A;  4ZUK A;  4I8P A;  3V9I A;  3ZQA A;  3JU8 A;  3QAN A;  4MPY A;  4ZVY A;  3V9G A;  1UXR A;  5KLO A;  3N81 A;  2W8Q A;  5J6B A;  1WNB A;  1VLU A;  5DIB A;  4I3T A;  3RHP A;  3N83 A;  4IYM A;  3RHL A;  4X0U A;  2O2Q A;  1NZX A;  3INL A;  2IMP A;  4NMJ A;  5J7I A;  4GO4 A;  2ONO A;  2ILU A;  4ITB A;  3V9K A;  5KLN A;  2WME A;  2BJK A;  3N82 A;  4PXL B;  3RHM A;  1O01 A;  4I2R A;  4X0T A;  5A2D D;  2W8N A;  1QI1 A;  5JRY A;  3IWJ A;  4I8Q A;  2HG2 A;  1UXU A;  2EIW A;  4YWE A;  1O02 A;  2BHP A;  3IWK A;  5DRU A;  4I9B A;  5EUY A;  4PXN A;  2BHQ A;  1O9J A;  4Q92 A;  3ETF A;  5EKC A;  3VZ1 A;  1UXV A;  3RHJ A;  2BJA A;  4I3X A;  5L2N A;  1EZ0 A;  4ZXU A;  1BI9 A;  4GO2 A;  4JBE A;  4OGD A;  2EII A;  4GO0 A;  5KF0 A;  2OPX A;  4QN2 A;  4X2Q A;  2D4E A;  2EHU A;  4QET A;  4KWF A;  4H73 A;  4WP7 A;  3K9D A;  4X4L A;  5FHZ A;  2XDR A;  4MPB A;  1O04 A;  4OE6 A;  2O2R A;  4I26 A;  4LEM A;  1AD3 A;  4I3W A;  4YWU A;  5EZ4 A;  5ABM A;  4LH2 A;  2ONP A;  2J40 A;  4A0M A;  4O6R A;  4I3U A;  4V37 A;  4QTO A; 
#chains in the Genus database with same CATH topology
 2JG7 A;  4ZZ7 A;  4QYJ A;  3PQA A;  1EUH A;  4OHT A;  5A2D A;  1NZZ A;  2Y51 A;  1UXN A;  2H5G A;  3ROS A;  2W8O A;  3INJ A;  2Y53 A;  4K57 A;  4LH0 A;  4NS3 A;  5AC2 A;  2EJL A;  2Y5D A;  3RHH A;  3V9L A;  2ONM A;  5L13 A;  3U4J A;  2J5N A;  4LGZ A;  5F2C A;  4V3F A;  2WME C;  4H7N A;  4NU9 A;  4ZVX A;  5L2O A;  2EHQ A;  5EK6 A;  3MY7 A;  5EXF A;  3VZ3 A;  2W8P A;  5AC0 A;  4U3W A;  2QE0 A;  4IDS A;  1T90 A;  4IT9 A;  4PXL A;  3V9J A;  3VZ2 A;  5KLM A;  4LH3 A;  3TY7 A;  4LIH A;  1A4S A;  3V4C A;  4L1O A;  1UXQ A;  4O5H A;  3RHO A;  1KY8 A;  2ESD A;  4GHK A;  3N80 A;  4I1W A;  4QJE B;  4KNA A;  3R64 A;  3EFV A;  4ITA A;  4ZWL A;  4ZVW A;  4F3X A;  2IY6 A;  4LH1 A;  3K2W A;  4WPN A;  1O20 A;  1EYY A;  1AG8 A;  4L2O A;  4FR8 A;  4NEA A;  4FQF A;  1UZB A;  4PZ2 A;  4DAL A;  3SZB A;  3RH9 A;  2EUH A;  1O05 A;  5AC1 A;  3R31 A;  3PRL A;  2ONN A;  1UXP A;  2EJ6 A;  5J78 A;  2VLE A;  4KWG A;  4E3X A;  4GNZ A;  4WJ9 A;  5KLL A;  3I44 A;  4C3S A;  4I25 A;  4NMK A;  5KLK A;  2WOX A;  1WND A;  5EYU A;  5A2D C;  4WB9 A;  3RHQ A;  3VZ0 A;  1A4Z A;  4E4G A;  1ZUM A;  3RHR A;  1CW3 A;  4QF6 A;  2Y52 A;  2W8R A;  4OE5 A;  1QI6 A;  4OE4 A;  4OUB A;  4IDM A;  1UXT A;  4OU2 A;  4QJE A;  2EIT A;  3RHD A;  3RJL A;  4YWV A;  3EK1 A;  4CBB A;  3SZ9 A;  1BPW A;  1O00 A;  3V9H A;  4JZ6 A;  4IHI A;  5EEB A;  4V3F C;  3SZA A;  2ID2 A;  4NPI A;  1BXS A;  4OE2 A;  4QGK A;  5DBV A;  4GO3 A;  4CAZ A;  4H80 A;  5KJ5 A;  2EJD A;  4DNG A;  3JZ4 A;  5L2M A;  1NZW A;  4JDC A;  2J6L A;  2VRO A;  4ZUL A;  3B4W A;  4I3V A;  2O2P A;  4ZUK A;  4I8P A;  3V9I A;  3ZQA A;  3JU8 A;  3QAN A;  4MPY A;  4ZVY A;  3V9G A;  1UXR A;  5KLO A;  3N81 A;  2W8Q A;  5J6B A;  1WNB A;  1VLU A;  5DIB A;  4I3T A;  3RHP A;  3N83 A;  4IYM A;  3RHL A;  4X0U A;  2O2Q A;  1NZX A;  3INL A;  2IMP A;  4NMJ A;  5J7I A;  4GO4 A;  2ONO A;  2ILU A;  4ITB A;  3V9K A;  5KLN A;  2WME A;  2BJK A;  3N82 A;  4PXL B;  3RHM A;  1O01 A;  4I2R A;  4X0T A;  5A2D D;  2W8N A;  1QI1 A;  5JRY A;  3IWJ A;  4I8Q A;  2HG2 A;  1UXU A;  2EIW A;  4YWE A;  1O02 A;  2BHP A;  3IWK A;  5DRU A;  4I9B A;  5EUY A;  4PXN A;  2BHQ A;  1O9J A;  4Q92 A;  3ETF A;  5EKC A;  3VZ1 A;  1UXV A;  3RHJ A;  2BJA A;  4I3X A;  5L2N A;  1EZ0 A;  4ZXU A;  1BI9 A;  4GO2 A;  4JBE A;  4OGD A;  2EII A;  4GO0 A;  5KF0 A;  2OPX A;  4QN2 A;  4X2Q A;  2D4E A;  2EHU A;  4QET A;  4KWF A;  4H73 A;  4WP7 A;  3K9D A;  4X4L A;  5FHZ A;  2XDR A;  4MPB A;  1O04 A;  4OE6 A;  2O2R A;  4I26 A;  4LEM A;  1AD3 A;  4I3W A;  4YWU A;  5EZ4 A;  5ABM A;  4LH2 A;  2ONP A;  2J40 A;  4A0M A;  4O6R A;  4I3U A;  4V37 A;  4QTO A; 
#chains in the Genus database with same CATH homology
 2JG7 A;  4ZZ7 A;  4QYJ A;  3PQA A;  1EUH A;  4OHT A;  5A2D A;  1NZZ A;  2Y51 A;  1UXN A;  2H5G A;  3ROS A;  2W8O A;  3INJ A;  2Y53 A;  4K57 A;  4LH0 A;  4NS3 A;  5AC2 A;  2EJL A;  2Y5D A;  3RHH A;  3V9L A;  2ONM A;  5L13 A;  3U4J A;  2J5N A;  4LGZ A;  5F2C A;  4V3F A;  2WME C;  4H7N A;  4NU9 A;  4ZVX A;  5L2O A;  2EHQ A;  5EK6 A;  3MY7 A;  5EXF A;  3VZ3 A;  2W8P A;  5AC0 A;  4U3W A;  2QE0 A;  4IDS A;  1T90 A;  4IT9 A;  4PXL A;  3V9J A;  3VZ2 A;  5KLM A;  4LH3 A;  3TY7 A;  4LIH A;  1A4S A;  3V4C A;  4L1O A;  1UXQ A;  4O5H A;  3RHO A;  1KY8 A;  2ESD A;  4GHK A;  3N80 A;  4I1W A;  4QJE B;  4KNA A;  3R64 A;  3EFV A;  4ITA A;  4ZWL A;  4ZVW A;  4F3X A;  2IY6 A;  4LH1 A;  3K2W A;  4WPN A;  1O20 A;  1EYY A;  1AG8 A;  4L2O A;  4FR8 A;  4NEA A;  4FQF A;  1UZB A;  4PZ2 A;  4DAL A;  3SZB A;  3RH9 A;  2EUH A;  1O05 A;  5AC1 A;  3R31 A;  3PRL A;  2ONN A;  1UXP A;  2EJ6 A;  5J78 A;  2VLE A;  4KWG A;  4E3X A;  4GNZ A;  4WJ9 A;  5KLL A;  3I44 A;  4C3S A;  4I25 A;  4NMK A;  5KLK A;  2WOX A;  1WND A;  5EYU A;  5A2D C;  4WB9 A;  3RHQ A;  3VZ0 A;  1A4Z A;  4E4G A;  1ZUM A;  3RHR A;  1CW3 A;  4QF6 A;  2Y52 A;  2W8R A;  4OE5 A;  1QI6 A;  4OE4 A;  4OUB A;  4IDM A;  1UXT A;  4OU2 A;  4QJE A;  2EIT A;  3RHD A;  3RJL A;  4YWV A;  3EK1 A;  4CBB A;  3SZ9 A;  1BPW A;  1O00 A;  3V9H A;  4JZ6 A;  4IHI A;  5EEB A;  4V3F C;  3SZA A;  2ID2 A;  4NPI A;  1BXS A;  4OE2 A;  4QGK A;  5DBV A;  4GO3 A;  4CAZ A;  4H80 A;  5KJ5 A;  2EJD A;  4DNG A;  3JZ4 A;  5L2M A;  1NZW A;  4JDC A;  2J6L A;  2VRO A;  4ZUL A;  3B4W A;  4I3V A;  2O2P A;  4ZUK A;  4I8P A;  3V9I A;  3ZQA A;  3JU8 A;  3QAN A;  4MPY A;  4ZVY A;  3V9G A;  1UXR A;  5KLO A;  3N81 A;  2W8Q A;  5J6B A;  1WNB A;  1VLU A;  5DIB A;  4I3T A;  3RHP A;  3N83 A;  4IYM A;  3RHL A;  4X0U A;  2O2Q A;  1NZX A;  3INL A;  2IMP A;  4NMJ A;  5J7I A;  4GO4 A;  2ONO A;  2ILU A;  4ITB A;  3V9K A;  5KLN A;  2WME A;  2BJK A;  3N82 A;  4PXL B;  3RHM A;  1O01 A;  4I2R A;  4X0T A;  5A2D D;  2W8N A;  1QI1 A;  5JRY A;  3IWJ A;  4I8Q A;  2HG2 A;  1UXU A;  2EIW A;  4YWE A;  1O02 A;  2BHP A;  3IWK A;  5DRU A;  4I9B A;  5EUY A;  4PXN A;  2BHQ A;  1O9J A;  4Q92 A;  3ETF A;  5EKC A;  3VZ1 A;  1UXV A;  3RHJ A;  2BJA A;  4I3X A;  5L2N A;  1EZ0 A;  4ZXU A;  1BI9 A;  4GO2 A;  4JBE A;  4OGD A;  2EII A;  4GO0 A;  5KF0 A;  2OPX A;  4QN2 A;  4X2Q A;  2D4E A;  2EHU A;  4QET A;  4KWF A;  4H73 A;  4WP7 A;  3K9D A;  4X4L A;  5FHZ A;  2XDR A;  4MPB A;  1O04 A;  4OE6 A;  2O2R A;  4I26 A;  4LEM A;  1AD3 A;  4I3W A;  4YWU A;  5EZ4 A;  5ABM A;  4LH2 A;  2ONP A;  2J40 A;  4A0M A;  4O6R A;  4I3U A;  4V37 A;  4QTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...