5L2OA

Crystal structure of aldh1a1 in complex with buc22
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
494
structure length
494
Chain Sequence
b'DLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Retinal dehydrogenase 1
publication title Inhibition of the Aldehyde Dehydrogenase 1/2 Family by Psoralen and Coumarin Derivatives.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 183
structure length 494
sequence length 494
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.2.1.36: Retinal dehydrogenase.
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00171 Aldedh Aldehyde dehydrogenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.309.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 2 Aldehyde Dehydrogenase; Chain A, domain 2 5l2oA02
3.40.605.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 1 Aldehyde Dehydrogenase; Chain A, domain 1 5l2oA01
3V9LA 2O2RA 5AC0A 4NMJA 2ESDA 4OE5A 2EHUA 3B4WA 5F2CA 3SZ9A 4GHKA 5KLKA 5KLMA 2O2PA 4V37A 5EEBA 1VLUA 4OHTA 4QJEA 4ZVXA 5EUYA 3V9IA 4I3UA 4JZ6A 2QE0A 5KLOA 3QANA 5EKCA 3V9JA 4CAZA 4E4GA 4GO2A 4IHIA 2EJDA 1WNBA 4NEAA 2Y5DA 2ILUA 4L2OA 1O05A 4H73A 4QETA 3IWJA 2O2QA 1QI6A 2WMEC 4GNZA 4LH0A 3K9DA 4I25A 3N83A 4MPYA 1BI9A 3R31A 3EK1A 4OU2A 2VLEA 5KF0A 5J78A 5AC2A 2WMEA 2W8RA 3K2WA 4CBBA 5ABMA 5JRYA 3R64A 1A4ZA 4I3WA 2IY6A 2HG2A 5EK6A 1WNDA 2OPXA 4I8PA 4PXLA 2XDRA 5DIBA 5EZ4A 3V4CA 3INJA 4L1OA 2BHPA 1AD3A 3PQAA 1UXUA 4KWGA 4KNAA 1UXNA 4NMKA 2W8PA 3RHPA 1UXQA 2D4EA 4OE4A 1EUHA 2W8OA 2JG7A 3N82A 1O04A 4IT9A 4O5HA 3RHJA 5A2DC 4WPNA 4ZWLA 4NU9A 4I2RA 1EYYA 1T90A 5DBVA 4FQFA 4LGZA 5J7IA 2W8NA 1O9JA 4C3SA 4X0TA 1NZZA 3TY7A 3N80A 2EJ6A 5A2DA 5A2DD 4F3XA 2VROA 4OE6A 1CW3A 1UXTA 3ROSA 4Q92A 4E3XA 4FR8A 4IYMA 4OUBA 2ONNA 1UXRA 4OE2A 3I44A 2ONOA 4QYJA 3RH9A 3V9GA 1UXPA 4MPBA 5L2MA 4H7NA 4LH2A 5KLLA 4QTOA 4I9BA 1UXVA 4JBEA 4IDSA 4O6RA 4YWUA 4YWEA 3ZQAA 4I8QA 4DNGA 1ZUMA 2BJAA 3EFVA 4QN2A 3PRLA 4X4LA 3RJLA 3RHQA 4ZUKA 1O01A 4LH3A 3RHLA 1UZBA 3MY7A 3SZAA 2EHQA 4ZXUA 1BPWA 4ZULA 3V9HA 5EYUA 4QGKA 2Y52A 3JZ4A 4V3FC 4NS3A 4WP7A 4I3VA 1QI1A 4ITBA 3INLA 5KLNA 3VZ2A 2ONPA 1EZ0A 4ZVWA 2EIIA 2Y53A 4PZ2A 2EITA 3RHMA 3JU8A 4GO0A 4V3FA 3RHRA 3V9KA 3RHHA 5J6BA 1BXSA 4ITAA 5KJ5A 4I26A 4LIHA 4QJEB 4U3WA 3RHDA 1O20A 2J40A 2ONMA 4H80A 2EJLA 3U4JA 4A0MA 5L2NA 1O00A 4I3XA 2J6LA 5FHZA 1O02A 4WJ9A 2WOXA 2BHQA 4DALA 5AC1A 4JDCA 2EIWA 4X0UA 4GO3A 4OGDA 4ZVYA 1AG8A 4LH1A 4I3TA 3VZ1A 2H5GA 4YWVA 2EUHA 2ID2A 2J5NA 3IWKA 4ZZ7A 3VZ3A 4I1WA 4PXNA 4KWFA 4PXLB 1KY8A 4NPIA 2BJKA 5DRUA 2IMPA 1NZWA 4WB9A 4K57A 4QF6A 3VZ0A 4X2QA 4GO4A 3SZBA 1A4SA 4IDMA 2Y51A 4LEMA 3RHOA 3ETFA 5L13A 3N81A 5EXFA 1NZXA 5L2OA 2W8QA
chains in the Genus database with same CATH superfamily
3V9LA 2O2RA 5AC0A 4NMJA 2ESDA 4OE5A 2EHUA 3B4WA 5F2CA 3SZ9A 4GHKA 5KLKA 5KLMA 2O2PA 4V37A 5EEBA 1VLUA 4OHTA 4QJEA 4ZVXA 5EUYA 3V9IA 4I3UA 4JZ6A 2QE0A 5KLOA 3QANA 5EKCA 3V9JA 4CAZA 4E4GA 4GO2A 4IHIA 2EJDA 1WNBA 4NEAA 2Y5DA 2ILUA 4L2OA 1O05A 4H73A 4QETA 3IWJA 2O2QA 1QI6A 2WMEC 4GNZA 4LH0A 3K9DA 4I25A 3N83A 4MPYA 1BI9A 3R31A 3EK1A 4OU2A 2VLEA 5KF0A 5J78A 5AC2A 2WMEA 2W8RA 3K2WA 4CBBA 5ABMA 5JRYA 3R64A 1A4ZA 4I3WA 2IY6A 2HG2A 5EK6A 1WNDA 2OPXA 4I8PA 4PXLA 2XDRA 5DIBA 5EZ4A 3V4CA 3INJA 4L1OA 2BHPA 1AD3A 3PQAA 1UXUA 4KWGA 4KNAA 1UXNA 4NMKA 2W8PA 3RHPA 1UXQA 2D4EA 4OE4A 1EUHA 2W8OA 2JG7A 3N82A 1O04A 4IT9A 4O5HA 3RHJA 5A2DC 4WPNA 4ZWLA 4NU9A 4I2RA 1EYYA 1T90A 5DBVA 4FQFA 4LGZA 5J7IA 2W8NA 1O9JA 4C3SA 4X0TA 1NZZA 3TY7A 3N80A 2EJ6A 5A2DA 5A2DD 4F3XA 2VROA 4OE6A 1CW3A 1UXTA 3ROSA 4Q92A 4E3XA 4FR8A 4IYMA 4OUBA 2ONNA 1UXRA 4OE2A 3I44A 2ONOA 4QYJA 3RH9A 3V9GA 1UXPA 4MPBA 5L2MA 4H7NA 4LH2A 5KLLA 4QTOA 4I9BA 1UXVA 4JBEA 4IDSA 4O6RA 4YWUA 4YWEA 3ZQAA 4I8QA 4DNGA 1ZUMA 2BJAA 3EFVA 4QN2A 3PRLA 4X4LA 3RJLA 3RHQA 4ZUKA 1O01A 4LH3A 3RHLA 1UZBA 3MY7A 3SZAA 2EHQA 4ZXUA 1BPWA 4ZULA 3V9HA 5EYUA 4QGKA 2Y52A 3JZ4A 4V3FC 4NS3A 4WP7A 4I3VA 1QI1A 4ITBA 3INLA 5KLNA 3VZ2A 2ONPA 1EZ0A 4ZVWA 2EIIA 2Y53A 4PZ2A 2EITA 3RHMA 3JU8A 4GO0A 4V3FA 3RHRA 3V9KA 3RHHA 5J6BA 1BXSA 4ITAA 5KJ5A 4I26A 4LIHA 4QJEB 4U3WA 3RHDA 1O20A 2J40A 2ONMA 4H80A 2EJLA 3U4JA 4A0MA 5L2NA 1O00A 4I3XA 2J6LA 5FHZA 1O02A 4WJ9A 2WOXA 2BHQA 4DALA 5AC1A 4JDCA 2EIWA 4X0UA 4GO3A 4OGDA 4ZVYA 1AG8A 4LH1A 4I3TA 3VZ1A 2H5GA 4YWVA 2EUHA 2ID2A 2J5NA 3IWKA 4ZZ7A 3VZ3A 4I1WA 4PXNA 4KWFA 4PXLB 1KY8A 4NPIA 2BJKA 5DRUA 2IMPA 1NZWA 4WB9A 4K57A 4QF6A 3VZ0A 4X2QA 4GO4A 3SZBA 1A4SA 4IDMA 2Y51A 4LEMA 3RHOA 3ETFA 5L13A 3N81A 5EXFA 1NZXA 5L2OA 2W8QA
chains in the Genus database with same CATH topology
3V9LA 2O2RA 5AC0A 4NMJA 2ESDA 4OE5A 2EHUA 3B4WA 5F2CA 3SZ9A 4GHKA 5KLKA 5KLMA 2O2PA 4V37A 5EEBA 1VLUA 4OHTA 4QJEA 4ZVXA 5EUYA 3V9IA 4I3UA 4JZ6A 2QE0A 5KLOA 3QANA 5EKCA 3V9JA 4CAZA 4E4GA 4GO2A 4IHIA 2EJDA 1WNBA 4NEAA 2Y5DA 2ILUA 4L2OA 1O05A 4H73A 4QETA 3IWJA 2O2QA 1QI6A 2WMEC 4GNZA 4LH0A 3K9DA 4I25A 3N83A 4MPYA 1BI9A 3R31A 3EK1A 4OU2A 2VLEA 5KF0A 5J78A 5AC2A 2WMEA 2W8RA 3K2WA 4CBBA 5ABMA 5JRYA 3R64A 1A4ZA 4I3WA 2IY6A 2HG2A 5EK6A 1WNDA 2OPXA 4I8PA 4PXLA 2XDRA 5DIBA 5EZ4A 3V4CA 3INJA 4L1OA 2BHPA 1AD3A 3PQAA 1UXUA 4KWGA 4KNAA 1UXNA 4NMKA 2W8PA 3RHPA 1UXQA 2D4EA 4OE4A 1EUHA 2W8OA 2JG7A 3N82A 1O04A 4IT9A 4O5HA 3RHJA 5A2DC 4WPNA 4ZWLA 4NU9A 4I2RA 1EYYA 1T90A 5DBVA 4FQFA 4LGZA 5J7IA 2W8NA 1O9JA 4C3SA 4X0TA 1NZZA 3TY7A 3N80A 2EJ6A 5A2DA 5A2DD 4F3XA 2VROA 4OE6A 1CW3A 1UXTA 3ROSA 4Q92A 4E3XA 4FR8A 4IYMA 4OUBA 2ONNA 1UXRA 4OE2A 3I44A 2ONOA 4QYJA 3RH9A 3V9GA 1UXPA 4MPBA 5L2MA 4H7NA 4LH2A 5KLLA 4QTOA 4I9BA 1UXVA 4JBEA 4IDSA 4O6RA 4YWUA 4YWEA 3ZQAA 4I8QA 4DNGA 1ZUMA 2BJAA 3EFVA 4QN2A 3PRLA 4X4LA 3RJLA 3RHQA 4ZUKA 1O01A 4LH3A 3RHLA 1UZBA 3MY7A 3SZAA 2EHQA 4ZXUA 1BPWA 4ZULA 3V9HA 5EYUA 4QGKA 2Y52A 3JZ4A 4V3FC 4NS3A 4WP7A 4I3VA 1QI1A 4ITBA 3INLA 5KLNA 3VZ2A 2ONPA 1EZ0A 4ZVWA 2EIIA 2Y53A 4PZ2A 2EITA 3RHMA 3JU8A 4GO0A 4V3FA 3RHRA 3V9KA 3RHHA 5J6BA 1BXSA 4ITAA 5KJ5A 4I26A 4LIHA 4QJEB 4U3WA 3RHDA 1O20A 2J40A 2ONMA 4H80A 2EJLA 3U4JA 4A0MA 5L2NA 1O00A 4I3XA 2J6LA 5FHZA 1O02A 4WJ9A 2WOXA 2BHQA 4DALA 5AC1A 4JDCA 2EIWA 4X0UA 4GO3A 4OGDA 4ZVYA 1AG8A 4LH1A 4I3TA 3VZ1A 2H5GA 4YWVA 2EUHA 2ID2A 2J5NA 3IWKA 4ZZ7A 3VZ3A 4I1WA 4PXNA 4KWFA 4PXLB 1KY8A 4NPIA 2BJKA 5DRUA 2IMPA 1NZWA 4WB9A 4K57A 4QF6A 3VZ0A 4X2QA 4GO4A 3SZBA 1A4SA 4IDMA 2Y51A 4LEMA 3RHOA 3ETFA 5L13A 3N81A 5EXFA 1NZXA 5L2OA 2W8QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V9L A;  2O2R A;  5AC0 A;  4NMJ A;  2ESD A;  4OE5 A;  2EHU A;  3B4W A;  5F2C A;  3SZ9 A;  4GHK A;  5KLK A;  5KLM A;  2O2P A;  4V37 A;  5EEB A;  1VLU A;  4OHT A;  4QJE A;  4ZVX A;  5EUY A;  3V9I A;  4I3U A;  4JZ6 A;  2QE0 A;  5KLO A;  3QAN A;  5EKC A;  3V9J A;  4CAZ A;  4E4G A;  4GO2 A;  4IHI A;  2EJD A;  1WNB A;  4NEA A;  2Y5D A;  2ILU A;  4L2O A;  1O05 A;  4H73 A;  4QET A;  3IWJ A;  2O2Q A;  1QI6 A;  2WME C;  4GNZ A;  4LH0 A;  3K9D A;  4I25 A;  3N83 A;  4MPY A;  1BI9 A;  3R31 A;  3EK1 A;  4OU2 A;  2VLE A;  5KF0 A;  5J78 A;  5AC2 A;  2WME A;  2W8R A;  3K2W A;  4CBB A;  5ABM A;  5JRY A;  3R64 A;  1A4Z A;  4I3W A;  2IY6 A;  2HG2 A;  5EK6 A;  1WND A;  2OPX A;  4I8P A;  4PXL A;  2XDR A;  5DIB A;  5EZ4 A;  3V4C A;  3INJ A;  4L1O A;  2BHP A;  1AD3 A;  3PQA A;  1UXU A;  4KWG A;  4KNA A;  1UXN A;  4NMK A;  2W8P A;  3RHP A;  1UXQ A;  2D4E A;  4OE4 A;  1EUH A;  2W8O A;  2JG7 A;  3N82 A;  1O04 A;  4IT9 A;  4O5H A;  3RHJ A;  5A2D C;  4WPN A;  4ZWL A;  4NU9 A;  4I2R A;  1EYY A;  1T90 A;  5DBV A;  4FQF A;  4LGZ A;  5J7I A;  2W8N A;  1O9J A;  4C3S A;  4X0T A;  1NZZ A;  3TY7 A;  3N80 A;  2EJ6 A;  5A2D A;  5A2D D;  4F3X A;  2VRO A;  4OE6 A;  1CW3 A;  1UXT A;  3ROS A;  4Q92 A;  4E3X A;  4FR8 A;  4IYM A;  4OUB A;  2ONN A;  1UXR A;  4OE2 A;  3I44 A;  2ONO A;  4QYJ A;  3RH9 A;  3V9G A;  1UXP A;  4MPB A;  5L2M A;  4H7N A;  4LH2 A;  5KLL A;  4QTO A;  4I9B A;  1UXV A;  4JBE A;  4IDS A;  4O6R A;  4YWU A;  4YWE A;  3ZQA A;  4I8Q A;  4DNG A;  1ZUM A;  2BJA A;  3EFV A;  4QN2 A;  3PRL A;  4X4L A;  3RJL A;  3RHQ A;  4ZUK A;  1O01 A;  4LH3 A;  3RHL A;  1UZB A;  3MY7 A;  3SZA A;  2EHQ A;  4ZXU A;  1BPW A;  4ZUL A;  3V9H A;  5EYU A;  4QGK A;  2Y52 A;  3JZ4 A;  4V3F C;  4NS3 A;  4WP7 A;  4I3V A;  1QI1 A;  4ITB A;  3INL A;  5KLN A;  3VZ2 A;  2ONP A;  1EZ0 A;  4ZVW A;  2EII A;  2Y53 A;  4PZ2 A;  2EIT A;  3RHM A;  3JU8 A;  4GO0 A;  4V3F A;  3RHR A;  3V9K A;  3RHH A;  5J6B A;  1BXS A;  4ITA A;  5KJ5 A;  4I26 A;  4LIH A;  4QJE B;  4U3W A;  3RHD A;  1O20 A;  2J40 A;  2ONM A;  4H80 A;  2EJL A;  3U4J A;  4A0M A;  5L2N A;  1O00 A;  4I3X A;  2J6L A;  5FHZ A;  1O02 A;  4WJ9 A;  2WOX A;  2BHQ A;  4DAL A;  5AC1 A;  4JDC A;  2EIW A;  4X0U A;  4GO3 A;  4OGD A;  4ZVY A;  1AG8 A;  4LH1 A;  4I3T A;  3VZ1 A;  2H5G A;  4YWV A;  2EUH A;  2ID2 A;  2J5N A;  3IWK A;  4ZZ7 A;  3VZ3 A;  4I1W A;  4PXN A;  4KWF A;  4PXL B;  1KY8 A;  4NPI A;  2BJK A;  5DRU A;  2IMP A;  1NZW A;  4WB9 A;  4K57 A;  4QF6 A;  3VZ0 A;  4X2Q A;  4GO4 A;  3SZB A;  1A4S A;  4IDM A;  2Y51 A;  4LEM A;  3RHO A;  3ETF A;  5L13 A;  3N81 A;  5EXF A;  1NZX A;  5L2O A;  2W8Q A; 
#chains in the Genus database with same CATH topology
 3V9L A;  2O2R A;  5AC0 A;  4NMJ A;  2ESD A;  4OE5 A;  2EHU A;  3B4W A;  5F2C A;  3SZ9 A;  4GHK A;  5KLK A;  5KLM A;  2O2P A;  4V37 A;  5EEB A;  1VLU A;  4OHT A;  4QJE A;  4ZVX A;  5EUY A;  3V9I A;  4I3U A;  4JZ6 A;  2QE0 A;  5KLO A;  3QAN A;  5EKC A;  3V9J A;  4CAZ A;  4E4G A;  4GO2 A;  4IHI A;  2EJD A;  1WNB A;  4NEA A;  2Y5D A;  2ILU A;  4L2O A;  1O05 A;  4H73 A;  4QET A;  3IWJ A;  2O2Q A;  1QI6 A;  2WME C;  4GNZ A;  4LH0 A;  3K9D A;  4I25 A;  3N83 A;  4MPY A;  1BI9 A;  3R31 A;  3EK1 A;  4OU2 A;  2VLE A;  5KF0 A;  5J78 A;  5AC2 A;  2WME A;  2W8R A;  3K2W A;  4CBB A;  5ABM A;  5JRY A;  3R64 A;  1A4Z A;  4I3W A;  2IY6 A;  2HG2 A;  5EK6 A;  1WND A;  2OPX A;  4I8P A;  4PXL A;  2XDR A;  5DIB A;  5EZ4 A;  3V4C A;  3INJ A;  4L1O A;  2BHP A;  1AD3 A;  3PQA A;  1UXU A;  4KWG A;  4KNA A;  1UXN A;  4NMK A;  2W8P A;  3RHP A;  1UXQ A;  2D4E A;  4OE4 A;  1EUH A;  2W8O A;  2JG7 A;  3N82 A;  1O04 A;  4IT9 A;  4O5H A;  3RHJ A;  5A2D C;  4WPN A;  4ZWL A;  4NU9 A;  4I2R A;  1EYY A;  1T90 A;  5DBV A;  4FQF A;  4LGZ A;  5J7I A;  2W8N A;  1O9J A;  4C3S A;  4X0T A;  1NZZ A;  3TY7 A;  3N80 A;  2EJ6 A;  5A2D A;  5A2D D;  4F3X A;  2VRO A;  4OE6 A;  1CW3 A;  1UXT A;  3ROS A;  4Q92 A;  4E3X A;  4FR8 A;  4IYM A;  4OUB A;  2ONN A;  1UXR A;  4OE2 A;  3I44 A;  2ONO A;  4QYJ A;  3RH9 A;  3V9G A;  1UXP A;  4MPB A;  5L2M A;  4H7N A;  4LH2 A;  5KLL A;  4QTO A;  4I9B A;  1UXV A;  4JBE A;  4IDS A;  4O6R A;  4YWU A;  4YWE A;  3ZQA A;  4I8Q A;  4DNG A;  1ZUM A;  2BJA A;  3EFV A;  4QN2 A;  3PRL A;  4X4L A;  3RJL A;  3RHQ A;  4ZUK A;  1O01 A;  4LH3 A;  3RHL A;  1UZB A;  3MY7 A;  3SZA A;  2EHQ A;  4ZXU A;  1BPW A;  4ZUL A;  3V9H A;  5EYU A;  4QGK A;  2Y52 A;  3JZ4 A;  4V3F C;  4NS3 A;  4WP7 A;  4I3V A;  1QI1 A;  4ITB A;  3INL A;  5KLN A;  3VZ2 A;  2ONP A;  1EZ0 A;  4ZVW A;  2EII A;  2Y53 A;  4PZ2 A;  2EIT A;  3RHM A;  3JU8 A;  4GO0 A;  4V3F A;  3RHR A;  3V9K A;  3RHH A;  5J6B A;  1BXS A;  4ITA A;  5KJ5 A;  4I26 A;  4LIH A;  4QJE B;  4U3W A;  3RHD A;  1O20 A;  2J40 A;  2ONM A;  4H80 A;  2EJL A;  3U4J A;  4A0M A;  5L2N A;  1O00 A;  4I3X A;  2J6L A;  5FHZ A;  1O02 A;  4WJ9 A;  2WOX A;  2BHQ A;  4DAL A;  5AC1 A;  4JDC A;  2EIW A;  4X0U A;  4GO3 A;  4OGD A;  4ZVY A;  1AG8 A;  4LH1 A;  4I3T A;  3VZ1 A;  2H5G A;  4YWV A;  2EUH A;  2ID2 A;  2J5N A;  3IWK A;  4ZZ7 A;  3VZ3 A;  4I1W A;  4PXN A;  4KWF A;  4PXL B;  1KY8 A;  4NPI A;  2BJK A;  5DRU A;  2IMP A;  1NZW A;  4WB9 A;  4K57 A;  4QF6 A;  3VZ0 A;  4X2Q A;  4GO4 A;  3SZB A;  1A4S A;  4IDM A;  2Y51 A;  4LEM A;  3RHO A;  3ETF A;  5L13 A;  3N81 A;  5EXF A;  1NZX A;  5L2O A;  2W8Q A; 
#chains in the Genus database with same CATH homology
 3V9L A;  2O2R A;  5AC0 A;  4NMJ A;  2ESD A;  4OE5 A;  2EHU A;  3B4W A;  5F2C A;  3SZ9 A;  4GHK A;  5KLK A;  5KLM A;  2O2P A;  4V37 A;  5EEB A;  1VLU A;  4OHT A;  4QJE A;  4ZVX A;  5EUY A;  3V9I A;  4I3U A;  4JZ6 A;  2QE0 A;  5KLO A;  3QAN A;  5EKC A;  3V9J A;  4CAZ A;  4E4G A;  4GO2 A;  4IHI A;  2EJD A;  1WNB A;  4NEA A;  2Y5D A;  2ILU A;  4L2O A;  1O05 A;  4H73 A;  4QET A;  3IWJ A;  2O2Q A;  1QI6 A;  2WME C;  4GNZ A;  4LH0 A;  3K9D A;  4I25 A;  3N83 A;  4MPY A;  1BI9 A;  3R31 A;  3EK1 A;  4OU2 A;  2VLE A;  5KF0 A;  5J78 A;  5AC2 A;  2WME A;  2W8R A;  3K2W A;  4CBB A;  5ABM A;  5JRY A;  3R64 A;  1A4Z A;  4I3W A;  2IY6 A;  2HG2 A;  5EK6 A;  1WND A;  2OPX A;  4I8P A;  4PXL A;  2XDR A;  5DIB A;  5EZ4 A;  3V4C A;  3INJ A;  4L1O A;  2BHP A;  1AD3 A;  3PQA A;  1UXU A;  4KWG A;  4KNA A;  1UXN A;  4NMK A;  2W8P A;  3RHP A;  1UXQ A;  2D4E A;  4OE4 A;  1EUH A;  2W8O A;  2JG7 A;  3N82 A;  1O04 A;  4IT9 A;  4O5H A;  3RHJ A;  5A2D C;  4WPN A;  4ZWL A;  4NU9 A;  4I2R A;  1EYY A;  1T90 A;  5DBV A;  4FQF A;  4LGZ A;  5J7I A;  2W8N A;  1O9J A;  4C3S A;  4X0T A;  1NZZ A;  3TY7 A;  3N80 A;  2EJ6 A;  5A2D A;  5A2D D;  4F3X A;  2VRO A;  4OE6 A;  1CW3 A;  1UXT A;  3ROS A;  4Q92 A;  4E3X A;  4FR8 A;  4IYM A;  4OUB A;  2ONN A;  1UXR A;  4OE2 A;  3I44 A;  2ONO A;  4QYJ A;  3RH9 A;  3V9G A;  1UXP A;  4MPB A;  5L2M A;  4H7N A;  4LH2 A;  5KLL A;  4QTO A;  4I9B A;  1UXV A;  4JBE A;  4IDS A;  4O6R A;  4YWU A;  4YWE A;  3ZQA A;  4I8Q A;  4DNG A;  1ZUM A;  2BJA A;  3EFV A;  4QN2 A;  3PRL A;  4X4L A;  3RJL A;  3RHQ A;  4ZUK A;  1O01 A;  4LH3 A;  3RHL A;  1UZB A;  3MY7 A;  3SZA A;  2EHQ A;  4ZXU A;  1BPW A;  4ZUL A;  3V9H A;  5EYU A;  4QGK A;  2Y52 A;  3JZ4 A;  4V3F C;  4NS3 A;  4WP7 A;  4I3V A;  1QI1 A;  4ITB A;  3INL A;  5KLN A;  3VZ2 A;  2ONP A;  1EZ0 A;  4ZVW A;  2EII A;  2Y53 A;  4PZ2 A;  2EIT A;  3RHM A;  3JU8 A;  4GO0 A;  4V3F A;  3RHR A;  3V9K A;  3RHH A;  5J6B A;  1BXS A;  4ITA A;  5KJ5 A;  4I26 A;  4LIH A;  4QJE B;  4U3W A;  3RHD A;  1O20 A;  2J40 A;  2ONM A;  4H80 A;  2EJL A;  3U4J A;  4A0M A;  5L2N A;  1O00 A;  4I3X A;  2J6L A;  5FHZ A;  1O02 A;  4WJ9 A;  2WOX A;  2BHQ A;  4DAL A;  5AC1 A;  4JDC A;  2EIW A;  4X0U A;  4GO3 A;  4OGD A;  4ZVY A;  1AG8 A;  4LH1 A;  4I3T A;  3VZ1 A;  2H5G A;  4YWV A;  2EUH A;  2ID2 A;  2J5N A;  3IWK A;  4ZZ7 A;  3VZ3 A;  4I1W A;  4PXN A;  4KWF A;  4PXL B;  1KY8 A;  4NPI A;  2BJK A;  5DRU A;  2IMP A;  1NZW A;  4WB9 A;  4K57 A;  4QF6 A;  3VZ0 A;  4X2Q A;  4GO4 A;  3SZB A;  1A4S A;  4IDM A;  2Y51 A;  4LEM A;  3RHO A;  3ETF A;  5L13 A;  3N81 A;  5EXF A;  1NZX A;  5L2O A;  2W8Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...