5L2OA

Crystal structure of aldh1a1 in complex with buc22
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
494
structure length
494
Chain Sequence
DLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Retinal dehydrogenase 1
publication title Inhibition of the Aldehyde Dehydrogenase 1/2 Family by Psoralen and Coumarin Derivatives.
pubmed doi rcsb
source organism Homo sapiens
total genus 183
structure length 494
sequence length 494
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.2.1.36: Retinal dehydrogenase.
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00171 Aldedh Aldehyde dehydrogenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.309.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 2 Aldehyde Dehydrogenase; Chain A, domain 2 5l2oA02
3.40.605.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 1 Aldehyde Dehydrogenase; Chain A, domain 1 5l2oA01
3RHJA 2W8PA 4KNAA 3V9HA 2BHPA 4QN2A 4X0UA 2WMEA 4MPBA 5J78A 4IDMA 1EYYA 5L2OA 5DBVA 4C3SA 4ZVYA 4JZ6A 5DIBA 3EK1A 3PRLA 2ONPA 5KLKA 1A4ZA 4I8PA 5FHZA 4FQFA 3RHDA 1O02A 1T90A 1UXPA 4PXLB 4LGZA 5J6BA 2IY6A 2XDRA 4YWEA 2ESDA 4QJEB 4V3FC 4Q92A 2OPXA 2BJKA 2EJDA 4OE5A 4ZVXA 2J5NA 3RHLA 4CBBA 2W8QA 5JRYA 5KF0A 4ITAA 2ILUA 4CAZA 5EYUA 2QE0A 2ONOA 3R31A 1O20A 5KLNA 4H80A 4LH0A 4E4GA 4NU9A 3RJLA 5ABMA 1UXQA 2W8RA 4V37A 3V9GA 2J40A 4ZXUA 4LH3A 3V9KA 4OE6A 1QI1A 3N81A 5EKCA 4L1OA 1NZZA 4GO0A 1A4SA 1O01A 2O2QA 4I3WA 2BHQA 2Y5DA 4DALA 3K9DA 3EFVA 2Y52A 3N83A 4OU2A 4WJ9A 4NPIA 5A2DA 1UXVA 2O2RA 3VZ0A 5AC1A 5A2DD 3RHHA 1CW3A 1QI6A 4LH1A 4IYMA 5EEBA 4I2RA 5AC2A 3RHRA 3SZBA 1WNDA 4PXLA 5DRUA 1VLUA 2EJLA 5KLMA 4LH2A 1UXTA 3I44A 4QJEA 4OE2A 4GHKA 3TY7A 2Y51A 3MY7A 4DNGA 4JDCA 4KWGA 2EITA 5AC0A 2ONMA 4I3UA 3SZAA 1O04A 2JG7A 2IMPA 3JZ4A 4H7NA 3VZ3A 1BXSA 1O9JA 4WPNA 4L2OA 4V3FA 4ZWLA 4GO3A 2O2PA 4GNZA 4KWFA 3ETFA 4GO2A 2W8NA 4O5HA 4FR8A 4ZUKA 2ID2A 4ZVWA 1BI9A 4NS3A 4QF6A 4F3XA 1UXNA 4LEMA 1NZXA 3R64A 4OHTA 2Y53A 3IWJA 5KJ5A 4I25A 4WP7A 3V4CA 1O05A 2WMEC 3INJA 5KLOA 4I26A 1O00A 4NMJA 3RHMA 4YWVA 4ZZ7A 2EJ6A 1UXRA 1EZ0A 4H73A 5J7IA 2VLEA 2BJAA 4PXNA 4ITBA 4O6RA 4X4LA 4MPYA 5KLLA 4WB9A 5F2CA 1NZWA 4I9BA 4NEAA 4OE4A 3VZ1A 3VZ2A 1UZBA 2D4EA 4X0TA 1AG8A 3INLA 4I3TA 5EUYA 5L13A 5L2MA 3PQAA 2J6LA 3U4JA 3RHOA 3JU8A 4ZULA 4IHIA 4IT9A 3RHQA 2ONNA 5EXFA 4IDSA 3QANA 4OUBA 4I1WA 4QTOA 3RH9A 3V9LA 1AD3A 2WOXA 3ZQAA 1ZUMA 2EUHA 4GO4A 2EHUA 4OGDA 2W8OA 3RHPA 3SZ9A 1UXUA 4E3XA 2VROA 2EHQA 4QGKA 4QYJA 1EUHA 1KY8A 4I8QA 5EZ4A 4QETA 3ROSA 3N82A 4I3XA 1WNBA 4I3VA 4X2QA 4NMKA 4LIHA 3V9JA 3IWKA 3B4WA 4K57A 5L2NA 2H5GA 2EIIA 4JBEA 5EK6A 3V9IA 4YWUA 3K2WA 3N80A 5A2DC 2HG2A 4A0MA 4PZ2A 1BPWA 4U3WA 2EIWA
chains in the Genus database with same CATH superfamily
3RHJA 2W8PA 4KNAA 3V9HA 2BHPA 4QN2A 4X0UA 2WMEA 4MPBA 5J78A 4IDMA 1EYYA 5L2OA 5DBVA 4C3SA 4ZVYA 4JZ6A 5DIBA 3EK1A 3PRLA 2ONPA 5KLKA 1A4ZA 4I8PA 5FHZA 4FQFA 3RHDA 1O02A 1T90A 1UXPA 4PXLB 4LGZA 5J6BA 2IY6A 2XDRA 4YWEA 2ESDA 4QJEB 4V3FC 4Q92A 2OPXA 2BJKA 2EJDA 4OE5A 4ZVXA 2J5NA 3RHLA 4CBBA 2W8QA 5JRYA 5KF0A 4ITAA 2ILUA 4CAZA 5EYUA 2QE0A 2ONOA 3R31A 1O20A 5KLNA 4H80A 4LH0A 4E4GA 4NU9A 3RJLA 5ABMA 1UXQA 2W8RA 4V37A 3V9GA 2J40A 4ZXUA 4LH3A 3V9KA 4OE6A 1QI1A 3N81A 5EKCA 4L1OA 1NZZA 4GO0A 1A4SA 1O01A 2O2QA 4I3WA 2BHQA 2Y5DA 4DALA 3K9DA 3EFVA 2Y52A 3N83A 4OU2A 4WJ9A 4NPIA 5A2DA 1UXVA 2O2RA 3VZ0A 5AC1A 5A2DD 3RHHA 1CW3A 1QI6A 4LH1A 4IYMA 5EEBA 4I2RA 5AC2A 3RHRA 3SZBA 1WNDA 4PXLA 5DRUA 1VLUA 2EJLA 5KLMA 4LH2A 1UXTA 3I44A 4QJEA 4OE2A 4GHKA 3TY7A 2Y51A 3MY7A 4DNGA 4JDCA 4KWGA 2EITA 5AC0A 2ONMA 4I3UA 3SZAA 1O04A 2JG7A 2IMPA 3JZ4A 4H7NA 3VZ3A 1BXSA 1O9JA 4WPNA 4L2OA 4V3FA 4ZWLA 4GO3A 2O2PA 4GNZA 4KWFA 3ETFA 4GO2A 2W8NA 4O5HA 4FR8A 4ZUKA 2ID2A 4ZVWA 1BI9A 4NS3A 4QF6A 4F3XA 1UXNA 4LEMA 1NZXA 3R64A 4OHTA 2Y53A 3IWJA 5KJ5A 4I25A 4WP7A 3V4CA 1O05A 2WMEC 3INJA 5KLOA 4I26A 1O00A 4NMJA 3RHMA 4YWVA 4ZZ7A 2EJ6A 1UXRA 1EZ0A 4H73A 5J7IA 2VLEA 2BJAA 4PXNA 4ITBA 4O6RA 4X4LA 4MPYA 5KLLA 4WB9A 5F2CA 1NZWA 4I9BA 4NEAA 4OE4A 3VZ1A 3VZ2A 1UZBA 2D4EA 4X0TA 1AG8A 3INLA 4I3TA 5EUYA 5L13A 5L2MA 3PQAA 2J6LA 3U4JA 3RHOA 3JU8A 4ZULA 4IHIA 4IT9A 3RHQA 2ONNA 5EXFA 4IDSA 3QANA 4OUBA 4I1WA 4QTOA 3RH9A 3V9LA 1AD3A 2WOXA 3ZQAA 1ZUMA 2EUHA 4GO4A 2EHUA 4OGDA 2W8OA 3RHPA 3SZ9A 1UXUA 4E3XA 2VROA 2EHQA 4QGKA 4QYJA 1EUHA 1KY8A 4I8QA 5EZ4A 4QETA 3ROSA 3N82A 4I3XA 1WNBA 4I3VA 4X2QA 4NMKA 4LIHA 3V9JA 3IWKA 3B4WA 4K57A 5L2NA 2H5GA 2EIIA 4JBEA 5EK6A 3V9IA 4YWUA 3K2WA 3N80A 5A2DC 2HG2A 4A0MA 4PZ2A 1BPWA 4U3WA 2EIWA
chains in the Genus database with same CATH topology
3RHJA 2W8PA 4KNAA 3V9HA 2BHPA 4QN2A 4X0UA 2WMEA 4MPBA 5J78A 4IDMA 1EYYA 5L2OA 5DBVA 4C3SA 4ZVYA 4JZ6A 5DIBA 3EK1A 3PRLA 2ONPA 5KLKA 1A4ZA 4I8PA 5FHZA 4FQFA 3RHDA 1O02A 1T90A 1UXPA 4PXLB 4LGZA 5J6BA 2IY6A 2XDRA 4YWEA 2ESDA 4QJEB 4V3FC 4Q92A 2OPXA 2BJKA 2EJDA 4OE5A 4ZVXA 2J5NA 3RHLA 4CBBA 2W8QA 5JRYA 5KF0A 4ITAA 2ILUA 4CAZA 5EYUA 2QE0A 2ONOA 3R31A 1O20A 5KLNA 4H80A 4LH0A 4E4GA 4NU9A 3RJLA 5ABMA 1UXQA 2W8RA 4V37A 3V9GA 2J40A 4ZXUA 4LH3A 3V9KA 4OE6A 1QI1A 3N81A 5EKCA 4L1OA 1NZZA 4GO0A 1A4SA 1O01A 2O2QA 4I3WA 2BHQA 2Y5DA 4DALA 3K9DA 3EFVA 2Y52A 3N83A 4OU2A 4WJ9A 4NPIA 5A2DA 1UXVA 2O2RA 3VZ0A 5AC1A 5A2DD 3RHHA 1CW3A 1QI6A 4LH1A 4IYMA 5EEBA 4I2RA 5AC2A 3RHRA 3SZBA 1WNDA 4PXLA 5DRUA 1VLUA 2EJLA 5KLMA 4LH2A 1UXTA 3I44A 4QJEA 4OE2A 4GHKA 3TY7A 2Y51A 3MY7A 4DNGA 4JDCA 4KWGA 2EITA 5AC0A 2ONMA 4I3UA 3SZAA 1O04A 2JG7A 2IMPA 3JZ4A 4H7NA 3VZ3A 1BXSA 1O9JA 4WPNA 4L2OA 4V3FA 4ZWLA 4GO3A 2O2PA 4GNZA 4KWFA 3ETFA 4GO2A 2W8NA 4O5HA 4FR8A 4ZUKA 2ID2A 4ZVWA 1BI9A 4NS3A 4QF6A 4F3XA 1UXNA 4LEMA 1NZXA 3R64A 4OHTA 2Y53A 3IWJA 5KJ5A 4I25A 4WP7A 3V4CA 1O05A 2WMEC 3INJA 5KLOA 4I26A 1O00A 4NMJA 3RHMA 4YWVA 4ZZ7A 2EJ6A 1UXRA 1EZ0A 4H73A 5J7IA 2VLEA 2BJAA 4PXNA 4ITBA 4O6RA 4X4LA 4MPYA 5KLLA 4WB9A 5F2CA 1NZWA 4I9BA 4NEAA 4OE4A 3VZ1A 3VZ2A 1UZBA 2D4EA 4X0TA 1AG8A 3INLA 4I3TA 5EUYA 5L13A 5L2MA 3PQAA 2J6LA 3U4JA 3RHOA 3JU8A 4ZULA 4IHIA 4IT9A 3RHQA 2ONNA 5EXFA 4IDSA 3QANA 4OUBA 4I1WA 4QTOA 3RH9A 3V9LA 1AD3A 2WOXA 3ZQAA 1ZUMA 2EUHA 4GO4A 2EHUA 4OGDA 2W8OA 3RHPA 3SZ9A 1UXUA 4E3XA 2VROA 2EHQA 4QGKA 4QYJA 1EUHA 1KY8A 4I8QA 5EZ4A 4QETA 3ROSA 3N82A 4I3XA 1WNBA 4I3VA 4X2QA 4NMKA 4LIHA 3V9JA 3IWKA 3B4WA 4K57A 5L2NA 2H5GA 2EIIA 4JBEA 5EK6A 3V9IA 4YWUA 3K2WA 3N80A 5A2DC 2HG2A 4A0MA 4PZ2A 1BPWA 4U3WA 2EIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RHJ A;  2W8P A;  4KNA A;  3V9H A;  2BHP A;  4QN2 A;  4X0U A;  2WME A;  4MPB A;  5J78 A;  4IDM A;  1EYY A;  5L2O A;  5DBV A;  4C3S A;  4ZVY A;  4JZ6 A;  5DIB A;  3EK1 A;  3PRL A;  2ONP A;  5KLK A;  1A4Z A;  4I8P A;  5FHZ A;  4FQF A;  3RHD A;  1O02 A;  1T90 A;  1UXP A;  4PXL B;  4LGZ A;  5J6B A;  2IY6 A;  2XDR A;  4YWE A;  2ESD A;  4QJE B;  4V3F C;  4Q92 A;  2OPX A;  2BJK A;  2EJD A;  4OE5 A;  4ZVX A;  2J5N A;  3RHL A;  4CBB A;  2W8Q A;  5JRY A;  5KF0 A;  4ITA A;  2ILU A;  4CAZ A;  5EYU A;  2QE0 A;  2ONO A;  3R31 A;  1O20 A;  5KLN A;  4H80 A;  4LH0 A;  4E4G A;  4NU9 A;  3RJL A;  5ABM A;  1UXQ A;  2W8R A;  4V37 A;  3V9G A;  2J40 A;  4ZXU A;  4LH3 A;  3V9K A;  4OE6 A;  1QI1 A;  3N81 A;  5EKC A;  4L1O A;  1NZZ A;  4GO0 A;  1A4S A;  1O01 A;  2O2Q A;  4I3W A;  2BHQ A;  2Y5D A;  4DAL A;  3K9D A;  3EFV A;  2Y52 A;  3N83 A;  4OU2 A;  4WJ9 A;  4NPI A;  5A2D A;  1UXV A;  2O2R A;  3VZ0 A;  5AC1 A;  5A2D D;  3RHH A;  1CW3 A;  1QI6 A;  4LH1 A;  4IYM A;  5EEB A;  4I2R A;  5AC2 A;  3RHR A;  3SZB A;  1WND A;  4PXL A;  5DRU A;  1VLU A;  2EJL A;  5KLM A;  4LH2 A;  1UXT A;  3I44 A;  4QJE A;  4OE2 A;  4GHK A;  3TY7 A;  2Y51 A;  3MY7 A;  4DNG A;  4JDC A;  4KWG A;  2EIT A;  5AC0 A;  2ONM A;  4I3U A;  3SZA A;  1O04 A;  2JG7 A;  2IMP A;  3JZ4 A;  4H7N A;  3VZ3 A;  1BXS A;  1O9J A;  4WPN A;  4L2O A;  4V3F A;  4ZWL A;  4GO3 A;  2O2P A;  4GNZ A;  4KWF A;  3ETF A;  4GO2 A;  2W8N A;  4O5H A;  4FR8 A;  4ZUK A;  2ID2 A;  4ZVW A;  1BI9 A;  4NS3 A;  4QF6 A;  4F3X A;  1UXN A;  4LEM A;  1NZX A;  3R64 A;  4OHT A;  2Y53 A;  3IWJ A;  5KJ5 A;  4I25 A;  4WP7 A;  3V4C A;  1O05 A;  2WME C;  3INJ A;  5KLO A;  4I26 A;  1O00 A;  4NMJ A;  3RHM A;  4YWV A;  4ZZ7 A;  2EJ6 A;  1UXR A;  1EZ0 A;  4H73 A;  5J7I A;  2VLE A;  2BJA A;  4PXN A;  4ITB A;  4O6R A;  4X4L A;  4MPY A;  5KLL A;  4WB9 A;  5F2C A;  1NZW A;  4I9B A;  4NEA A;  4OE4 A;  3VZ1 A;  3VZ2 A;  1UZB A;  2D4E A;  4X0T A;  1AG8 A;  3INL A;  4I3T A;  5EUY A;  5L13 A;  5L2M A;  3PQA A;  2J6L A;  3U4J A;  3RHO A;  3JU8 A;  4ZUL A;  4IHI A;  4IT9 A;  3RHQ A;  2ONN A;  5EXF A;  4IDS A;  3QAN A;  4OUB A;  4I1W A;  4QTO A;  3RH9 A;  3V9L A;  1AD3 A;  2WOX A;  3ZQA A;  1ZUM A;  2EUH A;  4GO4 A;  2EHU A;  4OGD A;  2W8O A;  3RHP A;  3SZ9 A;  1UXU A;  4E3X A;  2VRO A;  2EHQ A;  4QGK A;  4QYJ A;  1EUH A;  1KY8 A;  4I8Q A;  5EZ4 A;  4QET A;  3ROS A;  3N82 A;  4I3X A;  1WNB A;  4I3V A;  4X2Q A;  4NMK A;  4LIH A;  3V9J A;  3IWK A;  3B4W A;  4K57 A;  5L2N A;  2H5G A;  2EII A;  4JBE A;  5EK6 A;  3V9I A;  4YWU A;  3K2W A;  3N80 A;  5A2D C;  2HG2 A;  4A0M A;  4PZ2 A;  1BPW A;  4U3W A;  2EIW A; 
#chains in the Genus database with same CATH topology
 3RHJ A;  2W8P A;  4KNA A;  3V9H A;  2BHP A;  4QN2 A;  4X0U A;  2WME A;  4MPB A;  5J78 A;  4IDM A;  1EYY A;  5L2O A;  5DBV A;  4C3S A;  4ZVY A;  4JZ6 A;  5DIB A;  3EK1 A;  3PRL A;  2ONP A;  5KLK A;  1A4Z A;  4I8P A;  5FHZ A;  4FQF A;  3RHD A;  1O02 A;  1T90 A;  1UXP A;  4PXL B;  4LGZ A;  5J6B A;  2IY6 A;  2XDR A;  4YWE A;  2ESD A;  4QJE B;  4V3F C;  4Q92 A;  2OPX A;  2BJK A;  2EJD A;  4OE5 A;  4ZVX A;  2J5N A;  3RHL A;  4CBB A;  2W8Q A;  5JRY A;  5KF0 A;  4ITA A;  2ILU A;  4CAZ A;  5EYU A;  2QE0 A;  2ONO A;  3R31 A;  1O20 A;  5KLN A;  4H80 A;  4LH0 A;  4E4G A;  4NU9 A;  3RJL A;  5ABM A;  1UXQ A;  2W8R A;  4V37 A;  3V9G A;  2J40 A;  4ZXU A;  4LH3 A;  3V9K A;  4OE6 A;  1QI1 A;  3N81 A;  5EKC A;  4L1O A;  1NZZ A;  4GO0 A;  1A4S A;  1O01 A;  2O2Q A;  4I3W A;  2BHQ A;  2Y5D A;  4DAL A;  3K9D A;  3EFV A;  2Y52 A;  3N83 A;  4OU2 A;  4WJ9 A;  4NPI A;  5A2D A;  1UXV A;  2O2R A;  3VZ0 A;  5AC1 A;  5A2D D;  3RHH A;  1CW3 A;  1QI6 A;  4LH1 A;  4IYM A;  5EEB A;  4I2R A;  5AC2 A;  3RHR A;  3SZB A;  1WND A;  4PXL A;  5DRU A;  1VLU A;  2EJL A;  5KLM A;  4LH2 A;  1UXT A;  3I44 A;  4QJE A;  4OE2 A;  4GHK A;  3TY7 A;  2Y51 A;  3MY7 A;  4DNG A;  4JDC A;  4KWG A;  2EIT A;  5AC0 A;  2ONM A;  4I3U A;  3SZA A;  1O04 A;  2JG7 A;  2IMP A;  3JZ4 A;  4H7N A;  3VZ3 A;  1BXS A;  1O9J A;  4WPN A;  4L2O A;  4V3F A;  4ZWL A;  4GO3 A;  2O2P A;  4GNZ A;  4KWF A;  3ETF A;  4GO2 A;  2W8N A;  4O5H A;  4FR8 A;  4ZUK A;  2ID2 A;  4ZVW A;  1BI9 A;  4NS3 A;  4QF6 A;  4F3X A;  1UXN A;  4LEM A;  1NZX A;  3R64 A;  4OHT A;  2Y53 A;  3IWJ A;  5KJ5 A;  4I25 A;  4WP7 A;  3V4C A;  1O05 A;  2WME C;  3INJ A;  5KLO A;  4I26 A;  1O00 A;  4NMJ A;  3RHM A;  4YWV A;  4ZZ7 A;  2EJ6 A;  1UXR A;  1EZ0 A;  4H73 A;  5J7I A;  2VLE A;  2BJA A;  4PXN A;  4ITB A;  4O6R A;  4X4L A;  4MPY A;  5KLL A;  4WB9 A;  5F2C A;  1NZW A;  4I9B A;  4NEA A;  4OE4 A;  3VZ1 A;  3VZ2 A;  1UZB A;  2D4E A;  4X0T A;  1AG8 A;  3INL A;  4I3T A;  5EUY A;  5L13 A;  5L2M A;  3PQA A;  2J6L A;  3U4J A;  3RHO A;  3JU8 A;  4ZUL A;  4IHI A;  4IT9 A;  3RHQ A;  2ONN A;  5EXF A;  4IDS A;  3QAN A;  4OUB A;  4I1W A;  4QTO A;  3RH9 A;  3V9L A;  1AD3 A;  2WOX A;  3ZQA A;  1ZUM A;  2EUH A;  4GO4 A;  2EHU A;  4OGD A;  2W8O A;  3RHP A;  3SZ9 A;  1UXU A;  4E3X A;  2VRO A;  2EHQ A;  4QGK A;  4QYJ A;  1EUH A;  1KY8 A;  4I8Q A;  5EZ4 A;  4QET A;  3ROS A;  3N82 A;  4I3X A;  1WNB A;  4I3V A;  4X2Q A;  4NMK A;  4LIH A;  3V9J A;  3IWK A;  3B4W A;  4K57 A;  5L2N A;  2H5G A;  2EII A;  4JBE A;  5EK6 A;  3V9I A;  4YWU A;  3K2W A;  3N80 A;  5A2D C;  2HG2 A;  4A0M A;  4PZ2 A;  1BPW A;  4U3W A;  2EIW A; 
#chains in the Genus database with same CATH homology
 3RHJ A;  2W8P A;  4KNA A;  3V9H A;  2BHP A;  4QN2 A;  4X0U A;  2WME A;  4MPB A;  5J78 A;  4IDM A;  1EYY A;  5L2O A;  5DBV A;  4C3S A;  4ZVY A;  4JZ6 A;  5DIB A;  3EK1 A;  3PRL A;  2ONP A;  5KLK A;  1A4Z A;  4I8P A;  5FHZ A;  4FQF A;  3RHD A;  1O02 A;  1T90 A;  1UXP A;  4PXL B;  4LGZ A;  5J6B A;  2IY6 A;  2XDR A;  4YWE A;  2ESD A;  4QJE B;  4V3F C;  4Q92 A;  2OPX A;  2BJK A;  2EJD A;  4OE5 A;  4ZVX A;  2J5N A;  3RHL A;  4CBB A;  2W8Q A;  5JRY A;  5KF0 A;  4ITA A;  2ILU A;  4CAZ A;  5EYU A;  2QE0 A;  2ONO A;  3R31 A;  1O20 A;  5KLN A;  4H80 A;  4LH0 A;  4E4G A;  4NU9 A;  3RJL A;  5ABM A;  1UXQ A;  2W8R A;  4V37 A;  3V9G A;  2J40 A;  4ZXU A;  4LH3 A;  3V9K A;  4OE6 A;  1QI1 A;  3N81 A;  5EKC A;  4L1O A;  1NZZ A;  4GO0 A;  1A4S A;  1O01 A;  2O2Q A;  4I3W A;  2BHQ A;  2Y5D A;  4DAL A;  3K9D A;  3EFV A;  2Y52 A;  3N83 A;  4OU2 A;  4WJ9 A;  4NPI A;  5A2D A;  1UXV A;  2O2R A;  3VZ0 A;  5AC1 A;  5A2D D;  3RHH A;  1CW3 A;  1QI6 A;  4LH1 A;  4IYM A;  5EEB A;  4I2R A;  5AC2 A;  3RHR A;  3SZB A;  1WND A;  4PXL A;  5DRU A;  1VLU A;  2EJL A;  5KLM A;  4LH2 A;  1UXT A;  3I44 A;  4QJE A;  4OE2 A;  4GHK A;  3TY7 A;  2Y51 A;  3MY7 A;  4DNG A;  4JDC A;  4KWG A;  2EIT A;  5AC0 A;  2ONM A;  4I3U A;  3SZA A;  1O04 A;  2JG7 A;  2IMP A;  3JZ4 A;  4H7N A;  3VZ3 A;  1BXS A;  1O9J A;  4WPN A;  4L2O A;  4V3F A;  4ZWL A;  4GO3 A;  2O2P A;  4GNZ A;  4KWF A;  3ETF A;  4GO2 A;  2W8N A;  4O5H A;  4FR8 A;  4ZUK A;  2ID2 A;  4ZVW A;  1BI9 A;  4NS3 A;  4QF6 A;  4F3X A;  1UXN A;  4LEM A;  1NZX A;  3R64 A;  4OHT A;  2Y53 A;  3IWJ A;  5KJ5 A;  4I25 A;  4WP7 A;  3V4C A;  1O05 A;  2WME C;  3INJ A;  5KLO A;  4I26 A;  1O00 A;  4NMJ A;  3RHM A;  4YWV A;  4ZZ7 A;  2EJ6 A;  1UXR A;  1EZ0 A;  4H73 A;  5J7I A;  2VLE A;  2BJA A;  4PXN A;  4ITB A;  4O6R A;  4X4L A;  4MPY A;  5KLL A;  4WB9 A;  5F2C A;  1NZW A;  4I9B A;  4NEA A;  4OE4 A;  3VZ1 A;  3VZ2 A;  1UZB A;  2D4E A;  4X0T A;  1AG8 A;  3INL A;  4I3T A;  5EUY A;  5L13 A;  5L2M A;  3PQA A;  2J6L A;  3U4J A;  3RHO A;  3JU8 A;  4ZUL A;  4IHI A;  4IT9 A;  3RHQ A;  2ONN A;  5EXF A;  4IDS A;  3QAN A;  4OUB A;  4I1W A;  4QTO A;  3RH9 A;  3V9L A;  1AD3 A;  2WOX A;  3ZQA A;  1ZUM A;  2EUH A;  4GO4 A;  2EHU A;  4OGD A;  2W8O A;  3RHP A;  3SZ9 A;  1UXU A;  4E3X A;  2VRO A;  2EHQ A;  4QGK A;  4QYJ A;  1EUH A;  1KY8 A;  4I8Q A;  5EZ4 A;  4QET A;  3ROS A;  3N82 A;  4I3X A;  1WNB A;  4I3V A;  4X2Q A;  4NMK A;  4LIH A;  3V9J A;  3IWK A;  3B4W A;  4K57 A;  5L2N A;  2H5G A;  2EII A;  4JBE A;  5EK6 A;  3V9I A;  4YWU A;  3K2W A;  3N80 A;  5A2D C;  2HG2 A;  4A0M A;  4PZ2 A;  1BPW A;  4U3W A;  2EIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...