The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
33
|
sequence length |
166
|
structure length |
166
|
Chain Sequence |
TPKVFVGYSIYKGKAALTVEPRSPEFSPLDSGAFKLSREGMVMLQFAPAAGVRQYDWSRKQVFSLSVTEIGSIISLGTKDSCEFFHDPNKGRSDEGRVRKVLKVEPLPDGSGHFFNLSVQNKLINLDENIYIPVTKAEFAVLVSAFNFVMPYLLGWHTAVNSFKPE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
A new family of plant transcription factors displays a novel ssDNA-binding surface.
pubmed doi rcsb |
molecule tags |
Dna binding protein
|
source organism |
Solanum tuberosum
|
molecule keywords |
p24: plant transcriptional regulator PBF-2
|
total genus |
33
|
structure length |
166
|
sequence length |
166
|
chains with identical sequence |
B, C, D
|
ec nomenclature | |
pdb deposition date | 2002-02-26 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF08536 | Whirly | Whirly transcription factor |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Roll | Transcriptional Co-activator pc4; Chain A | Transcriptional Coactivator Pc4; Chain A |
#chains in the Genus database with same CATH superfamily 3R9Y A; 4USG A; 3N1L A; 2PHE A; 3N1I A; 3N1J A; 4BG7 A; 3N1H A; 3RA0 A; 2NVN A; 4KOQ A; 4KOO A; 3N1K A; 2IT9 A; 1PCF A; 1L3A A; 2C62 A; 4BHM A; 3R9Z A; 4AGH A; 4KOP A; #chains in the Genus database with same CATH topology 3R9Y A; 2GID A; 4USG A; 3N1L A; 4BOB A; 2PHE A; 3N1I A; 3N1J A; 2M4F A; 2GID B; 4BG7 A; 4J38 A; 3N1H A; 3RA0 A; 2NVN A; 4BXM A; 4KOQ A; 3CM1 A; 4KOO A; 3N1K A; 5FGP A; 2GIA A; 4BOD A; 2GJE A; 2IT9 A; 1PCF A; 4BF3 A; 1L3A A; 2GJE D; 2GIA B; 3OBH A; 2C62 A; 3K44 A; 4BHM A; 3R9Z A; 4AGH A; 4KOP A; 3MTV A; #chains in the Genus database with same CATH homology 3R9Y A; 4USG A; 3N1L A; 2PHE A; 3N1I A; 3N1J A; 4BG7 A; 3N1H A; 3RA0 A; 2NVN A; 4KOQ A; 4KOO A; 3N1K A; 2IT9 A; 1PCF A; 1L3A A; 2C62 A; 4BHM A; 3R9Z A; 4AGH A; 4KOP A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...