3MTVA

The crystal structure of the prrsv nonstructural protein nsp1
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
203
structure length
203
Chain Sequence
ADVYDIGRGAVMYVAGGKVSWAPRGGNEVKFEPVPKELKLVANRLHTSFPPHHVVDMSKFTFITPGSGVSMRVEYQYGCLPADTVPEGNCWWRLLDSLPPEVQYKEIRHANQFGYQTKHGVPGKYLQRRLQVNGLRAVTDTHGPIVIQYFSVKESWIRHLKLVEEPSLPGFEDLLRIRVEPNTSPLAGKDEKIFRFGSHKWYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Papain-like cysteine protease
publication title The crystal structure of porcine reproductive and respiratory syndrome virus nonstructural protein Nsp1beta reveals a novel metal-dependent nuclease
pubmed doi rcsb
source organism Porcine reproductive and respiratory syndrome virus
molecule tags Hydrolase
total genus 42
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2010-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05411 Peptidase_C32 Equine arteritis virus putative proteinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.31.30 Mainly Beta Roll Transcriptional Co-activator pc4; Chain A Transcriptional Co-activator pc4; Chain A 3mtvA01
3.90.70.70 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3mtvA02
3MTVA
chains in the Genus database with same CATH superfamily
1PPDA 3F75A 3K8UA 2R9OA 5F02A 1AIMA 2B1MA 2FYEA 4WA6A 3CBJA 2PHEA 1Q6KA 2HD5A 1NQCA 3HD3A 3TRKA 2YJBA 1PCIA 2Z84A 1NLJA 1TU6A 1BP4A 4PP2E 4XUIA 1YK7A 4N79A 4PP1A 1KHPA 4KLBA 4HWYA 1HUCB 4MM3B 1MS6A 3R9YA 4ZTBA 1GCBA 4I04A 3C9EA 3BC3A 1PPOA 4CDFB 3H7DA 3WXEA 5JH3A 3P5VA 4RF1A 3PSEA 2DOSA 3CBKA 3N4CA 4IP3A 2PBHA 1TL9A 3CH3X 5EZSA 3ZUAA 2C62A 3QJ3A 3RVWA 4R3DA 1NB5A 1BGOA 1CS8A 5K16A 1CJLA 2F7DA 1KHQA 4BXMA 2UZJA 1AECA 1PCFA 1JQPA 3N1LA 3RVVA 4RNAA 4BF3A 3C0RA 4OVZA 4USGA 4RKXA 4OELA 2GIAA 2R9MA 2JRIA 4BG7A 4YYWA 3RNVA 1SNKA 2PADA 4P16A 3PHWA 1NPZA 4KOQA 4D8IA 3N1IA 4CDEB 2G8EA 2OULA 2AUZA 1A6RA 3PHXA 2XU4A 4RY2A 1MHWA 2G6DA 5CVNB 2BDLA 3DF0A 1F2BA 4BSQA 3MHHA 3S3QA 1ME3A 3GCBA 4I05A 4M0WA 1AYVA 4RF0A 3PT2A 1PVJA 2PNSA 1KXRA 1MEMA 2C0YA 3MHSA 5CHVA 3BPFA 1K3BB 3LXSA 2G8JA 3ERVA 2Y6EA 4IUMA 3IMAA 4W5BA 4FK5A 2H7JA 2O6XA 3OVZA 1PPNA 2GHUA 1U9WA 2FT2A 1PIPA 2R9FA 2BTWB 3HWNA 2Y5BA 3PRPA 3PW3A 1F29A 3PBHA 4W4UA 2DC8A 3F5VA 3IFUA 5CVMA 4MSXA 1AU4A 1ZIVA 2AGAA 3IHPA 3QSDA 3BOWA 4MZSA 3OVXA 2NQAA 3P5WA 3P5UA 4D8EA 3BWKA 1CSBB 4P6GA 1ICFA 2JTCA 4G54A 1F2CA 1PADA 3IOQA 4YYUA 1EWPA 3KKUA 2GJED 4N4ZA 3ZNHA 5A24A 1QMYA 3TMPA 2ACTA 3B21A 4J38A 3PNRA 2JQGR 1CV8A 2AUXA 1VJVA 4QBBA 3MP2A 3IEJA 3TNXA 2GIDB 4Q8HA 2ARYA 1CVZA 1EWMA 2DCAA 2AIMA 3BPMA 3BY4A 4FIPA 4XZXA 5JA7A 4BOBA 2CB5A 1ATKA 5CVOB 2R6NA 4BOUA 2YJ9A 2G7YA 4Q8GA 3HHIA 5FGPA 4MI7A 1PXVA 1QXPA 2E03A 2FE8A 2FQ9A 4X6IA 3KWBX 1Y4HA 1CQDA 1EF7A 1Y08A 3H8CA 3M99A 1GECE 1PE6A 3KX1A 2HHNA 2WBFX 3E1ZB 4YYSA 1O0EA 3S3RA 2BDZA 4BHMA 2NQDB 1KFXL 2YJ2A 2CIOA 1YK8A 3QT4A 1ME4A 2FRQA 2HWKA 2AYOA 3CH2X 1IWDA 4REZA 3H89A 4OVZB 3RVXA 1DF0A 2R9NA 3IUTA 2GIAB 3OISA 3P5XA 1QDQA 2DCBA 1THEA 4PI3A 3OF8A 2R9CA 1TLOA 3D6SA 3W30A 4YV8A 4X6HA 3N1HA 1YVBA 4HXDB 4BPVA 6PADA 5E6JA 3U8EA 4K7CA 1F2AA 3N1JA 2HH5A 4P6EA 5J94A 2DZZA 3BB7A 3K9MA 1XKGA 3BCNA 4PT5A 1L3AA 2NVNA 4BOSA 1PBHA 4CDDB 3O0UA 4OW0A 4D8BA 2FO5A 9PAPA 4QRXA 4W5CA 2FRAA 2IBIA 1AYWA 3B79A 3E9SA 1AU3A 4YYRA 3MTVA 2VHSA 1ZCMA 3CM1A 4BQVA 2DCDA 1M6DA 3K24A 4WURA 4BS6A 1U9QX 4CZWA 4GUAA 4AXLA 1X9YA 3V6CA 4KOPA 3WXFA 4BOZA 5JZEA 2F1GA 4N8WA 1U9VA 3O1GA 3I3TA 1S4VA 2E00A 2AU1A 3NHEA 2YJ8A 2FUDA 5EGWA 1CPJA 2GIDA 3WXGA 1YALA 2XU5A 3PDFA 1U9XA 2OZ2A 1POPA 1NL6A 2NQIA 4BODA 2HXZA 3V6EA 2OP3A 1MEGA 2XU3A 3OQCA 1GLOA 2DJGB 2J7QC 4AXMA 2GFOA 3BBAA 3PHUA 2E02A 2AYNA 2DZYA 1EWOA 2P0RA 3OF9A 1GMYA 2DC6A 3RA0A 1BY8A 4YYVA 2VHFA 7PCKA 2DCCA 1MDWA 4QRVA 1UKFA 2BU3A 1MIRA 1VSNA 3USVA 2IT9A 1AU0A 1FH0A 2DC9A 3O65A 4DMXA 4ZUXU 3N3KA 2FTDA 4YYQA 1AU2A 2J7QA 2PREA 1STFE 2P7UA 5EF4A 2IPPB 3MTNA 5PADA 2AS8A 4A5UA 4I07A 2M4FA 1AYUA 3R9ZA 3W31A 1PPPA 2P86A 3KW9A 1QOLA 5FPWA 5EZQA 4CDCB 3H6SA 4QRGA 4XR7A 1BQIA 1YT7A 2DJFB 4MZOA 1CTEA 2GJEA 4YVAA 1KFUL 2AVWA 2E01A 2DC7A 4PADA 8PCHA 3MORA 2YJCA 4OEMA 3OBHA 2BTWA 4BS5A 3PRMA 3H8BA 4X6JA 2B1NA 1DKIA 1EWLA 3KWZA 1U5IA 4BOQA 4AGHA 3N3GA 4BOPA 2ATOA 4KOOA 3I06A 5CHTA 3K44A 5KO3A 3AI8A 3KFQA 1SP4B 4QH6A 1CB5A 2JQFR 3N1KA 2NQGA 3KSEA 4DMYA 4FJCA 1NB3A 1ITOA 1YZBA 3IV2A 3HHAA 1DEUA 3MJ5A 2XU1A 3LFYA
chains in the Genus database with same CATH topology
4IUMA 3TRKA 1UKFA 2BU3A 2Z84A 2HWKA 4REZA 2BTWB 3O65A 4OVZB 2GIAB 4MM3B 3PRPA 4ZTBA 2J7QA 3IFUA 2AGAA 3W30A 4RF1A 4HXDB 3PSEA 2DOSA 4A5UA 4D8EA 2M4FA 4IP3A 5E6JA 3W31A 2JTCA 3BB7A 5EZSA 4PT5A 5EZQA 2GJED 4R3DA 3ZNHA 4BOSA 2GJEA 4OW0A 4D8BA 3TMPA 3B21A 4J38A 4BXMA 2UZJA 3E9SA 3MP2A 4RNAA 3MTVA 4BF3A 3OBHA 3CM1A 2BTWA 3C0RA 3PRMA 2GIDB 4OVZA 4RKXA 4WURA 2GIAA 2JRIA 1DKIA 4XZXA 3BY4A 3RNVA 4BOQA 4GUAA 4BOPA 4P16A 4BOBA 3PHWA 4BOZA 5JZEA 4D8IA 3K44A 3PHXA 5KO3A 4BOUA 2GIDA 5FGPA 4MI7A 2FE8A 1YZBA 4BODA 4M0WA 4RF0A 3PT2A 3OQCA 1PVJA 2J7QC 3BBAA 3MJ5A 3PHUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MTV A; 
#chains in the Genus database with same CATH topology
 1PPD A;  3F75 A;  3K8U A;  2R9O A;  5F02 A;  1AIM A;  2B1M A;  2FYE A;  4WA6 A;  3CBJ A;  2PHE A;  1Q6K A;  2HD5 A;  1NQC A;  3HD3 A;  3TRK A;  2YJB A;  1PCI A;  2Z84 A;  1NLJ A;  1TU6 A;  1BP4 A;  4PP2 E;  4XUI A;  1YK7 A;  4N79 A;  4PP1 A;  1KHP A;  4KLB A;  4HWY A;  1HUC B;  4MM3 B;  1MS6 A;  3R9Y A;  4ZTB A;  1GCB A;  4I04 A;  3C9E A;  3BC3 A;  1PPO A;  4CDF B;  3H7D A;  3WXE A;  5JH3 A;  3P5V A;  4RF1 A;  3PSE A;  2DOS A;  3CBK A;  3N4C A;  4IP3 A;  2PBH A;  1TL9 A;  3CH3 X;  5EZS A;  3ZUA A;  2C62 A;  3QJ3 A;  3RVW A;  4R3D A;  1NB5 A;  1BGO A;  1CS8 A;  5K16 A;  1CJL A;  2F7D A;  1KHQ A;  4BXM A;  2UZJ A;  1AEC A;  1PCF A;  1JQP A;  3N1L A;  3RVV A;  4RNA A;  4BF3 A;  3C0R A;  4OVZ A;  4USG A;  4RKX A;  4OEL A;  2GIA A;  2R9M A;  2JRI A;  4BG7 A;  4YYW A;  3RNV A;  1SNK A;  2PAD A;  4P16 A;  3PHW A;  1NPZ A;  4KOQ A;  4D8I A;  3N1I A;  4CDE B;  2G8E A;  2OUL A;  2AUZ A;  1A6R A;  3PHX A;  2XU4 A;  4RY2 A;  1MHW A;  2G6D A;  5CVN B;  2BDL A;  3DF0 A;  1F2B A;  4BSQ A;  3MHH A;  3S3Q A;  1ME3 A;  3GCB A;  4I05 A;  4M0W A;  1AYV A;  4RF0 A;  3PT2 A;  1PVJ A;  2PNS A;  1KXR A;  1MEM A;  2C0Y A;  3MHS A;  5CHV A;  3BPF A;  1K3B B;  3LXS A;  2G8J A;  3ERV A;  2Y6E A;  4IUM A;  3IMA A;  4W5B A;  4FK5 A;  2H7J A;  2O6X A;  3OVZ A;  1PPN A;  2GHU A;  1U9W A;  2FT2 A;  1PIP A;  2R9F A;  2BTW B;  3HWN A;  2Y5B A;  3PRP A;  3PW3 A;  1F29 A;  3PBH A;  4W4U A;  2DC8 A;  3F5V A;  3IFU A;  5CVM A;  4MSX A;  1AU4 A;  1ZIV A;  2AGA A;  3IHP A;  3QSD A;  3BOW A;  4MZS A;  3OVX A;  2NQA A;  3P5W A;  3P5U A;  4D8E A;  3BWK A;  1CSB B;  4P6G A;  1ICF A;  2JTC A;  4G54 A;  1F2C A;  1PAD A;  3IOQ A;  4YYU A;  1EWP A;  3KKU A;  2GJE D;  4N4Z A;  3ZNH A;  5A24 A;  1QMY A;  3TMP A;  2ACT A;  3B21 A;  4J38 A;  3PNR A;  2JQG R;  1CV8 A;  2AUX A;  1VJV A;  4QBB A;  3MP2 A;  3IEJ A;  3TNX A;  2GID B;  4Q8H A;  2ARY A;  1CVZ A;  1EWM A;  2DCA A;  2AIM A;  3BPM A;  3BY4 A;  4FIP A;  4XZX A;  5JA7 A;  4BOB A;  2CB5 A;  1ATK A;  5CVO B;  2R6N A;  4BOU A;  2YJ9 A;  2G7Y A;  4Q8G A;  3HHI A;  5FGP A;  4MI7 A;  1PXV A;  1QXP A;  2E03 A;  2FE8 A;  2FQ9 A;  4X6I A;  3KWB X;  1Y4H A;  1CQD A;  1EF7 A;  1Y08 A;  3H8C A;  3M99 A;  1GEC E;  1PE6 A;  3KX1 A;  2HHN A;  2WBF X;  3E1Z B;  4YYS A;  1O0E A;  3S3R A;  2BDZ A;  4BHM A;  2NQD B;  1KFX L;  2YJ2 A;  2CIO A;  1YK8 A;  3QT4 A;  1ME4 A;  2FRQ A;  2HWK A;  2AYO A;  3CH2 X;  1IWD A;  4REZ A;  3H89 A;  4OVZ B;  3RVX A;  1DF0 A;  2R9N A;  3IUT A;  2GIA B;  3OIS A;  3P5X A;  1QDQ A;  2DCB A;  1THE A;  4PI3 A;  3OF8 A;  2R9C A;  1TLO A;  3D6S A;  3W30 A;  4YV8 A;  4X6H A;  3N1H A;  1YVB A;  4HXD B;  4BPV A;  6PAD A;  5E6J A;  3U8E A;  4K7C A;  1F2A A;  3N1J A;  2HH5 A;  4P6E A;  5J94 A;  2DZZ A;  3BB7 A;  3K9M A;  1XKG A;  3BCN A;  4PT5 A;  1L3A A;  2NVN A;  4BOS A;  1PBH A;  4CDD B;  3O0U A;  4OW0 A;  4D8B A;  2FO5 A;  9PAP A;  4QRX A;  4W5C A;  2FRA A;  2IBI A;  1AYW A;  3B79 A;  3E9S A;  1AU3 A;  4YYR A;  3MTV A;  2VHS A;  1ZCM A;  3CM1 A;  4BQV A;  2DCD A;  1M6D A;  3K24 A;  4WUR A;  4BS6 A;  1U9Q X;  4CZW A;  4GUA A;  4AXL A;  1X9Y A;  3V6C A;  4KOP A;  3WXF A;  4BOZ A;  5JZE A;  2F1G A;  4N8W A;  1U9V A;  3O1G A;  3I3T A;  1S4V A;  2E00 A;  2AU1 A;  3NHE A;  2YJ8 A;  2FUD A;  5EGW A;  1CPJ A;  2GID A;  3WXG A;  1YAL A;  2XU5 A;  3PDF A;  1U9X A;  2OZ2 A;  1POP A;  1NL6 A;  2NQI A;  4BOD A;  2HXZ A;  3V6E A;  2OP3 A;  1MEG A;  2XU3 A;  3OQC A;  1GLO A;  2DJG B;  2J7Q C;  4AXM A;  2GFO A;  3BBA A;  3PHU A;  2E02 A;  2AYN A;  2DZY A;  1EWO A;  2P0R A;  3OF9 A;  1GMY A;  2DC6 A;  3RA0 A;  1BY8 A;  4YYV A;  2VHF A;  7PCK A;  2DCC A;  1MDW A;  4QRV A;  1UKF A;  2BU3 A;  1MIR A;  1VSN A;  3USV A;  2IT9 A;  1AU0 A;  1FH0 A;  2DC9 A;  3O65 A;  4DMX A;  4ZUX U;  3N3K A;  2FTD A;  4YYQ A;  1AU2 A;  2J7Q A;  2PRE A;  1STF E;  2P7U A;  5EF4 A;  2IPP B;  3MTN A;  5PAD A;  2AS8 A;  4A5U A;  4I07 A;  2M4F A;  1AYU A;  3R9Z A;  3W31 A;  1PPP A;  2P86 A;  3KW9 A;  1QOL A;  5FPW A;  5EZQ A;  4CDC B;  3H6S A;  4QRG A;  4XR7 A;  1BQI A;  1YT7 A;  2DJF B;  4MZO A;  1CTE A;  2GJE A;  4YVA A;  1KFU L;  2AVW A;  2E01 A;  2DC7 A;  4PAD A;  8PCH A;  3MOR A;  2YJC A;  4OEM A;  3OBH A;  2BTW A;  4BS5 A;  3PRM A;  3H8B A;  4X6J A;  2B1N A;  1DKI A;  1EWL A;  3KWZ A;  1U5I A;  4BOQ A;  4AGH A;  3N3G A;  4BOP A;  2ATO A;  4KOO A;  3I06 A;  5CHT A;  3K44 A;  5KO3 A;  3AI8 A;  3KFQ A;  1SP4 B;  4QH6 A;  1CB5 A;  2JQF R;  3N1K A;  2NQG A;  3KSE A;  4DMY A;  4FJC A;  1NB3 A;  1ITO A;  1YZB A;  3IV2 A;  3HHA A;  1DEU A;  3MJ5 A;  2XU1 A;  3LFY A; 
#chains in the Genus database with same CATH homology
 4IUM A;  3TRK A;  1UKF A;  2BU3 A;  2Z84 A;  2HWK A;  4REZ A;  2BTW B;  3O65 A;  4OVZ B;  2GIA B;  4MM3 B;  3PRP A;  4ZTB A;  2J7Q A;  3IFU A;  2AGA A;  3W30 A;  4RF1 A;  4HXD B;  3PSE A;  2DOS A;  4A5U A;  4D8E A;  2M4F A;  4IP3 A;  5E6J A;  3W31 A;  2JTC A;  3BB7 A;  5EZS A;  4PT5 A;  5EZQ A;  2GJE D;  4R3D A;  3ZNH A;  4BOS A;  2GJE A;  4OW0 A;  4D8B A;  3TMP A;  3B21 A;  4J38 A;  4BXM A;  2UZJ A;  3E9S A;  3MP2 A;  4RNA A;  3MTV A;  4BF3 A;  3OBH A;  3CM1 A;  2BTW A;  3C0R A;  3PRM A;  2GID B;  4OVZ A;  4RKX A;  4WUR A;  2GIA A;  2JRI A;  1DKI A;  4XZX A;  3BY4 A;  3RNV A;  4BOQ A;  4GUA A;  4BOP A;  4P16 A;  4BOB A;  3PHW A;  4BOZ A;  5JZE A;  4D8I A;  3K44 A;  3PHX A;  5KO3 A;  4BOU A;  2GID A;  5FGP A;  4MI7 A;  2FE8 A;  1YZB A;  4BOD A;  4M0W A;  4RF0 A;  3PT2 A;  3OQC A;  1PVJ A;  2J7Q C;  3BBA A;  3MJ5 A;  3PHU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...