3MTVA

The crystal structure of the prrsv nonstructural protein nsp1
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
203
structure length
203
Chain Sequence
ADVYDIGRGAVMYVAGGKVSWAPRGGNEVKFEPVPKELKLVANRLHTSFPPHHVVDMSKFTFITPGSGVSMRVEYQYGCLPADTVPEGNCWWRLLDSLPPEVQYKEIRHANQFGYQTKHGVPGKYLQRRLQVNGLRAVTDTHGPIVIQYFSVKESWIRHLKLVEEPSLPGFEDLLRIRVEPNTSPLAGKDEKIFRFGSHKWYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Papain-like cysteine protease
publication title The crystal structure of porcine reproductive and respiratory syndrome virus nonstructural protein Nsp1beta reveals a novel metal-dependent nuclease
pubmed doi rcsb
source organism Porcine reproductive and respiratory syndrome virus
total genus 42
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2010-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05411 Peptidase_C32 Equine arteritis virus putative proteinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.31.30 Mainly Beta Roll Transcriptional Co-activator pc4; Chain A Transcriptional Co-activator pc4; Chain A 3mtvA01
3.90.70.70 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3mtvA02
3MTVA
chains in the Genus database with same CATH superfamily
2P86A 2DCAA 3RVVA 3TNXA 4BOUA 2G7YA 3BPMA 4YYVA 1PE6A 3KFQA 2BDLA 4W4UA 1PXVA 1ME4A 2DZZA 2HWKA 4RF1A 4IUMA 3IMAA 3CH3X 4G54A 4YV8A 1PVJA 2FTDA 1AU4A 4MZOA 4CZWA 4BPVA 2B1NA 3PT2A 1CB5A 2R9FA 1U9QX 2AU1A 1QMYA 1AU0A 3OVZA 2M4FA 3D6SA 3N3KA 3TMPA 1YK7A 5FPWA 1CPJA 2BTWA 1QOLA 2HH5A 1PPDA 3ERVA 4W5CA 4XR7A 3C9EA 1ICFA 1CJLA 4BS5A 2HHNA 3ZNHA 4ZUXU 1U9VA 3OF8A 4YYQA 3RNVA 2XU5A 1QDQA 1IWDA 3BOWA 1PCFA 3PBHA 2JQFR 3TRKA 1AECA 3W31A 4HXDB 4ZTBA 9PAPA 1YALA 1Y4HA 5CVNB 1DKIA 2FO5A 4RNAA 4RY2A 4R3DA 4KOQA 2E01A 3H89A 1EWPA 2OP3A 4BSQA 2J7QC 2XU1A 1GCBA 3IV2A 2E03A 1AYVA 1EWMA 1THEA 2PADA 2O6XA 2JQGR 1GMYA 1MHWA 1AU3A 5CVMA 2F7DA 3V6EA 3K24A 5K16A 4REZA 1YT7A 1L3AA 4CDDB 1S4VA 2F1GA 3OF9A 4BG7A 3KKUA 4RF0A 2AS8A 3RA0A 4IP3A 2R9NA 4I07A 5CHVA 5F02A 2AVWA 3HHIA 3IUTA 3K44A 3MTVA 1EF7A 1GLOA 3B21A 1F2CA 1NLJA 5PADA 2FRQA 4X6JA 2GIDA 3MP2A 3WXFA 2JRIA 2PHEA 5FGPA 1KFXL 3IHPA 3BPFA 3K9MA 3HD3A 4KLBA 4OW0A 3BC3A 4GUAA 3S3RA 4YYRA 3U8EA 3N1IA 2R9CA 3OISA 4N79A 1PPNA 2FT2A 3RVWA 1MIRA 1MEGA 1XKGA 4AGHA 5KO3A 2OULA 3PW3A 3KWBX 4X6IA 1HUCB 5J94A 2BTWB 2YJCA 4MZSA 1PBHA 4WURA 2AYNA 2AIMA 1PADA 1A6RA 3IFUA 1ZIVA 1MDWA 4MSXA 2NVNA 3N3GA 4QBBA 2PBHA 2OZ2A 2ACTA 4OELA 1TL9A 2DCDA 2FYEA 2DJGB 2Z84A 5EZSA 1U9XA 4J38A 4BOBA 4MI7A 2FQ9A 5EF4A 2XU3A 2R9OA 3K8UA 3QJ3A 1CVZA 3KWZA 3GCBA 3N1KA 2WBFX 2NQDB 1PIPA 2BDZA 3N4CA 1CSBB 2H7JA 4FJCA 5JZEA 3PRPA 2GHUA 3R9ZA 4WA6A 3AI8A 1VJVA 3MHSA 7PCKA 2VHFA 1UKFA 2G6DA 1PPOA 2GFOA 1FH0A 1F29A 3MHHA 1AIMA 3W30A 4Q8HA 2AYOA 2GIAA 3F75A 3USVA 1JQPA 1BGOA 1MEMA 2PNSA 2GJED 2XU4A 2E02A 3PRMA 1ATKA 3HHAA 4CDCB 3H7DA 2CIOA 3PHXA 4P6GA 2DC7A 4QH6A 4BOQA 4KOOA 1KHPA 2DJFB 4BOPA 2DC9A 2BU3A 2YJ8A 2R9MA 4P16A 2CB5A 1NPZA 3NHEA 3V6CA 2GIDB 3BY4A 4MM3B 3KSEA 1TU6A 4BODA 1ME3A 4I04A 1BY8A 2DCBA 4FIPA 3E9SA 2G8JA 3N1JA 5E6JA 4BF3A 4PT5A 2Y6EA 4AXMA 1PCIA 3OQCA 3MJ5A 5A24A 1STFE 2HD5A 1BP4A 1DF0A 1AYUA 1DEUA 1VSNA 3P5UA 4PADA 4XZXA 1KHQA 2FRAA 2IPPB 4FK5A 3M99A 3MORA 3S3QA 3QT4A 3O0UA 3PHUA 4YYSA 2DOSA 4N4ZA 3BCNA 3E1ZB 3PDFA 4PP2E 2DCCA 3PHWA 4PI3A 3OVXA 1U5IA 4CDEB 4I05A 3HWNA 2YJ2A 2GJEA 4OVZA 1AU2A 2AUXA 3PNRA 1Q6KA 4HWYA 4KOPA 5CHTA 2DC6A 5EZQA 3IEJA 1BQIA 2ARYA 2FE8A 4BHMA 4K7CA 4D8BA 1KFUL 4W5BA 3RVXA 1M6DA 3H6SA 2AGAA 3B79A 4RKXA 4D8EA 6PADA 3PSEA 4YVAA 1Y08A 3F5VA 2B1MA 3BBAA 1AYWA 5CVOB 3WXEA 2NQGA 1O0EA 4BQVA 2JTCA 2VHSA 4D8IA 1CQDA 2YJ9A 2YJBA 3QSDA 3IOQA 8PCHA 2AUZA 1NB5A 4X6HA 1QXPA 1SNKA 3C0RA 1KXRA 1SP4B 3MTNA 3P5XA 4AXLA 1EWLA 1TLOA 2GIAB 2P7UA 2FUDA 3CH2X 1X9YA 2IT9A 1U9WA 1PPPA 4P6EA 4A5UA 4BOZA 4BXMA 2NQAA 3DF0A 3CBJA 4YYWA 2DZYA 5EGWA 3ZUAA 1MS6A 3N1HA 5JH3A 2C0YA 2NQIA 3H8CA 3P5WA 4Q8GA 2P0RA 1F2AA 3KW9A 2HXZA 1CV8A 1GECE 3R9YA 4DMYA 2C62A 4DMXA 2DC8A 1NL6A 2ATOA 1EWOA 1NQCA 2G8EA 4N8WA 3O65A 1CTEA 1ZCMA 4PP1A 4OEMA 3H8BA 1NB3A 4USGA 4CDFB 3KX1A 2E00A 2UZJA 3OBHA 2IBIA 4XUIA 3N1LA 2Y5BA 1F2BA 1YK8A 3LXSA 4QRGA 4YYUA 3LFYA 1CS8A 4BOSA 4BS6A 4QRXA 3CBKA 3WXGA 3I06A 3CM1A 2PREA 4M0WA 3BB7A 1YVBA 5JA7A 4OVZB 1K3BB 3BWKA 1ITOA 2R6NA 1POPA 3I3TA 4QRVA 3O1GA 1YZBA 2J7QA 3P5VA
chains in the Genus database with same CATH topology
4RF0A 4IP3A 4BOUA 2JTCA 4D8IA 3W30A 2GIAA 3K44A 3MTVA 2HWKA 4RF1A 4IUMA 3B21A 1PVJA 3C0RA 2GJED 3PRMA 2GIDA 3MP2A 2JRIA 3PT2A 5FGPA 2GIAB 3PHXA 4BOQA 4BOPA 2BU3A 4OW0A 4GUAA 2M4FA 4P16A 3TMPA 4A5UA 4BOZA 4BXMA 2GIDB 3BY4A 4MM3B 2BTWA 4BODA 3E9SA 3ZNHA 5E6JA 5KO3A 4BF3A 4PT5A 3OQCA 3MJ5A 2BTWB 3RNVA 4WURA 4XZXA 3IFUA 3TRKA 3W31A 4HXDB 4ZTBA 3PHUA 1DKIA 2DOSA 3O65A 4RNAA 3PHWA 4R3DA 2UZJA 3OBHA 2Z84A 5EZSA 4J38A 4BOBA 4OVZA 2GJEA 4MI7A 5EZQA 2J7QC 4BOSA 2FE8A 3CM1A 4M0WA 3BB7A 4D8BA 4OVZB 5JZEA 3PRPA 2AGAA 4RKXA 4REZA 4D8EA 3PSEA 1YZBA 2J7QA 3BBAA 1UKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MTV A; 
#chains in the Genus database with same CATH topology
 2P86 A;  2DCA A;  3RVV A;  3TNX A;  4BOU A;  2G7Y A;  3BPM A;  4YYV A;  1PE6 A;  3KFQ A;  2BDL A;  4W4U A;  1PXV A;  1ME4 A;  2DZZ A;  2HWK A;  4RF1 A;  4IUM A;  3IMA A;  3CH3 X;  4G54 A;  4YV8 A;  1PVJ A;  2FTD A;  1AU4 A;  4MZO A;  4CZW A;  4BPV A;  2B1N A;  3PT2 A;  1CB5 A;  2R9F A;  1U9Q X;  2AU1 A;  1QMY A;  1AU0 A;  3OVZ A;  2M4F A;  3D6S A;  3N3K A;  3TMP A;  1YK7 A;  5FPW A;  1CPJ A;  2BTW A;  1QOL A;  2HH5 A;  1PPD A;  3ERV A;  4W5C A;  4XR7 A;  3C9E A;  1ICF A;  1CJL A;  4BS5 A;  2HHN A;  3ZNH A;  4ZUX U;  1U9V A;  3OF8 A;  4YYQ A;  3RNV A;  2XU5 A;  1QDQ A;  1IWD A;  3BOW A;  1PCF A;  3PBH A;  2JQF R;  3TRK A;  1AEC A;  3W31 A;  4HXD B;  4ZTB A;  9PAP A;  1YAL A;  1Y4H A;  5CVN B;  1DKI A;  2FO5 A;  4RNA A;  4RY2 A;  4R3D A;  4KOQ A;  2E01 A;  3H89 A;  1EWP A;  2OP3 A;  4BSQ A;  2J7Q C;  2XU1 A;  1GCB A;  3IV2 A;  2E03 A;  1AYV A;  1EWM A;  1THE A;  2PAD A;  2O6X A;  2JQG R;  1GMY A;  1MHW A;  1AU3 A;  5CVM A;  2F7D A;  3V6E A;  3K24 A;  5K16 A;  4REZ A;  1YT7 A;  1L3A A;  4CDD B;  1S4V A;  2F1G A;  3OF9 A;  4BG7 A;  3KKU A;  4RF0 A;  2AS8 A;  3RA0 A;  4IP3 A;  2R9N A;  4I07 A;  5CHV A;  5F02 A;  2AVW A;  3HHI A;  3IUT A;  3K44 A;  3MTV A;  1EF7 A;  1GLO A;  3B21 A;  1F2C A;  1NLJ A;  5PAD A;  2FRQ A;  4X6J A;  2GID A;  3MP2 A;  3WXF A;  2JRI A;  2PHE A;  5FGP A;  1KFX L;  3IHP A;  3BPF A;  3K9M A;  3HD3 A;  4KLB A;  4OW0 A;  3BC3 A;  4GUA A;  3S3R A;  4YYR A;  3U8E A;  3N1I A;  2R9C A;  3OIS A;  4N79 A;  1PPN A;  2FT2 A;  3RVW A;  1MIR A;  1MEG A;  1XKG A;  4AGH A;  5KO3 A;  2OUL A;  3PW3 A;  3KWB X;  4X6I A;  1HUC B;  5J94 A;  2BTW B;  2YJC A;  4MZS A;  1PBH A;  4WUR A;  2AYN A;  2AIM A;  1PAD A;  1A6R A;  3IFU A;  1ZIV A;  1MDW A;  4MSX A;  2NVN A;  3N3G A;  4QBB A;  2PBH A;  2OZ2 A;  2ACT A;  4OEL A;  1TL9 A;  2DCD A;  2FYE A;  2DJG B;  2Z84 A;  5EZS A;  1U9X A;  4J38 A;  4BOB A;  4MI7 A;  2FQ9 A;  5EF4 A;  2XU3 A;  2R9O A;  3K8U A;  3QJ3 A;  1CVZ A;  3KWZ A;  3GCB A;  3N1K A;  2WBF X;  2NQD B;  1PIP A;  2BDZ A;  3N4C A;  1CSB B;  2H7J A;  4FJC A;  5JZE A;  3PRP A;  2GHU A;  3R9Z A;  4WA6 A;  3AI8 A;  1VJV A;  3MHS A;  7PCK A;  2VHF A;  1UKF A;  2G6D A;  1PPO A;  2GFO A;  1FH0 A;  1F29 A;  3MHH A;  1AIM A;  3W30 A;  4Q8H A;  2AYO A;  2GIA A;  3F75 A;  3USV A;  1JQP A;  1BGO A;  1MEM A;  2PNS A;  2GJE D;  2XU4 A;  2E02 A;  3PRM A;  1ATK A;  3HHA A;  4CDC B;  3H7D A;  2CIO A;  3PHX A;  4P6G A;  2DC7 A;  4QH6 A;  4BOQ A;  4KOO A;  1KHP A;  2DJF B;  4BOP A;  2DC9 A;  2BU3 A;  2YJ8 A;  2R9M A;  4P16 A;  2CB5 A;  1NPZ A;  3NHE A;  3V6C A;  2GID B;  3BY4 A;  4MM3 B;  3KSE A;  1TU6 A;  4BOD A;  1ME3 A;  4I04 A;  1BY8 A;  2DCB A;  4FIP A;  3E9S A;  2G8J A;  3N1J A;  5E6J A;  4BF3 A;  4PT5 A;  2Y6E A;  4AXM A;  1PCI A;  3OQC A;  3MJ5 A;  5A24 A;  1STF E;  2HD5 A;  1BP4 A;  1DF0 A;  1AYU A;  1DEU A;  1VSN A;  3P5U A;  4PAD A;  4XZX A;  1KHQ A;  2FRA A;  2IPP B;  4FK5 A;  3M99 A;  3MOR A;  3S3Q A;  3QT4 A;  3O0U A;  3PHU A;  4YYS A;  2DOS A;  4N4Z A;  3BCN A;  3E1Z B;  3PDF A;  4PP2 E;  2DCC A;  3PHW A;  4PI3 A;  3OVX A;  1U5I A;  4CDE B;  4I05 A;  3HWN A;  2YJ2 A;  2GJE A;  4OVZ A;  1AU2 A;  2AUX A;  3PNR A;  1Q6K A;  4HWY A;  4KOP A;  5CHT A;  2DC6 A;  5EZQ A;  3IEJ A;  1BQI A;  2ARY A;  2FE8 A;  4BHM A;  4K7C A;  4D8B A;  1KFU L;  4W5B A;  3RVX A;  1M6D A;  3H6S A;  2AGA A;  3B79 A;  4RKX A;  4D8E A;  6PAD A;  3PSE A;  4YVA A;  1Y08 A;  3F5V A;  2B1M A;  3BBA A;  1AYW A;  5CVO B;  3WXE A;  2NQG A;  1O0E A;  4BQV A;  2JTC A;  2VHS A;  4D8I A;  1CQD A;  2YJ9 A;  2YJB A;  3QSD A;  3IOQ A;  8PCH A;  2AUZ A;  1NB5 A;  4X6H A;  1QXP A;  1SNK A;  3C0R A;  1KXR A;  1SP4 B;  3MTN A;  3P5X A;  4AXL A;  1EWL A;  1TLO A;  2GIA B;  2P7U A;  2FUD A;  3CH2 X;  1X9Y A;  2IT9 A;  1U9W A;  1PPP A;  4P6E A;  4A5U A;  4BOZ A;  4BXM A;  2NQA A;  3DF0 A;  3CBJ A;  4YYW A;  2DZY A;  5EGW A;  3ZUA A;  1MS6 A;  3N1H A;  5JH3 A;  2C0Y A;  2NQI A;  3H8C A;  3P5W A;  4Q8G A;  2P0R A;  1F2A A;  3KW9 A;  2HXZ A;  1CV8 A;  1GEC E;  3R9Y A;  4DMY A;  2C62 A;  4DMX A;  2DC8 A;  1NL6 A;  2ATO A;  1EWO A;  1NQC A;  2G8E A;  4N8W A;  3O65 A;  1CTE A;  1ZCM A;  4PP1 A;  4OEM A;  3H8B A;  1NB3 A;  4USG A;  4CDF B;  3KX1 A;  2E00 A;  2UZJ A;  3OBH A;  2IBI A;  4XUI A;  3N1L A;  2Y5B A;  1F2B A;  1YK8 A;  3LXS A;  4QRG A;  4YYU A;  3LFY A;  1CS8 A;  4BOS A;  4BS6 A;  4QRX A;  3CBK A;  3WXG A;  3I06 A;  3CM1 A;  2PRE A;  4M0W A;  3BB7 A;  1YVB A;  5JA7 A;  4OVZ B;  1K3B B;  3BWK A;  1ITO A;  2R6N A;  1POP A;  3I3T A;  4QRV A;  3O1G A;  1YZB A;  2J7Q A;  3P5V A; 
#chains in the Genus database with same CATH homology
 4RF0 A;  4IP3 A;  4BOU A;  2JTC A;  4D8I A;  3W30 A;  2GIA A;  3K44 A;  3MTV A;  2HWK A;  4RF1 A;  4IUM A;  3B21 A;  1PVJ A;  3C0R A;  2GJE D;  3PRM A;  2GID A;  3MP2 A;  2JRI A;  3PT2 A;  5FGP A;  2GIA B;  3PHX A;  4BOQ A;  4BOP A;  2BU3 A;  4OW0 A;  4GUA A;  2M4F A;  4P16 A;  3TMP A;  4A5U A;  4BOZ A;  4BXM A;  2GID B;  3BY4 A;  4MM3 B;  2BTW A;  4BOD A;  3E9S A;  3ZNH A;  5E6J A;  5KO3 A;  4BF3 A;  4PT5 A;  3OQC A;  3MJ5 A;  2BTW B;  3RNV A;  4WUR A;  4XZX A;  3IFU A;  3TRK A;  3W31 A;  4HXD B;  4ZTB A;  3PHU A;  1DKI A;  2DOS A;  3O65 A;  4RNA A;  3PHW A;  4R3D A;  2UZJ A;  3OBH A;  2Z84 A;  5EZS A;  4J38 A;  4BOB A;  4OVZ A;  2GJE A;  4MI7 A;  5EZQ A;  2J7Q C;  4BOS A;  2FE8 A;  3CM1 A;  4M0W A;  3BB7 A;  4D8B A;  4OVZ B;  5JZE A;  3PRP A;  2AGA A;  4RKX A;  4REZ A;  4D8E A;  3PSE A;  1YZB A;  2J7Q A;  3BBA A;  1UKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...