3MTVA

The crystal structure of the prrsv nonstructural protein nsp1
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
203
structure length
203
Chain Sequence
ADVYDIGRGAVMYVAGGKVSWAPRGGNEVKFEPVPKELKLVANRLHTSFPPHHVVDMSKFTFITPGSGVSMRVEYQYGCLPADTVPEGNCWWRLLDSLPPEVQYKEIRHANQFGYQTKHGVPGKYLQRRLQVNGLRAVTDTHGPIVIQYFSVKESWIRHLKLVEEPSLPGFEDLLRIRVEPNTSPLAGKDEKIFRFGSHKWYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of porcine reproductive and respiratory syndrome virus nonstructural protein Nsp1beta reveals a novel metal-dependent nuclease
pubmed doi rcsb
source organism Porcine reproductive and respiratory syndrome virus
molecule tags Hydrolase
molecule keywords Papain-like cysteine protease
total genus 42
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2010-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05411 Peptidase_C32 Equine arteritis virus putative proteinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.31.30 Mainly Beta Roll Transcriptional Co-activator pc4; Chain A Transcriptional Co-activator pc4; Chain A 3mtvA01
3.90.70.70 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3mtvA02
3MTVA
chains in the Genus database with same CATH superfamily
4RNAA 4BOPA 1YK7A 3MJ5A 2NQDB 1Y08A 2AUZA 1SP4B 1U9WA 4WURA 3PHWA 2FRQA 3WXEA 3CBKA 4P16A 2NQIA 1BQIA 4GUAA 2PADA 3PT2A 3NHEA 4Q8GA 3RVWA 2R9MA 3HWNA 1AYWA 3H8CA 2BU3A 1U9VA 1YZBA 4MI7A 5PADA 2YJ8A 3OVXA 2FO5A 4CDDB 3TRKA 4BG7A 2E00A 1CV8A 4YVAA 1PPOA 2OP3A 3OF8A 1F2BA 3MP2A 2DOSA 1YALA 3K44A 1GECE 2DJGB 3MTNA 2AYOA 3LXSA 2DCDA 4USGA 4MZSA 2GJEA 1ME3A 4QRVA 5CVOB 5JH3A 4DMYA 4X6HA 2HWKA 2PHEA 4PP1A 4PP2E 1KHQA 3OVZA 2PNSA 3KWBX 4N8WA 1STFE 1U5IA 3QT4A 1TL9A 2FYEA 3BPMA 3BC3A 1GLOA 2DJFB 3K9MA 2M4FA 1PXVA 1CVZA 1QMYA 1CQDA 4I07A 4WA6A 1GCBA 4A5UA 2PREA 2JTCA 2DC9A 1AYUA 1ME4A 2Y6EA 4HWYA 3IV2A 2P86A 3CH2X 3PSEA 1PE6A 4XZXA 4YV8A 1XKGA 1VJVA 4IUMA 4PI3A 2BDLA 1O0EA 2XU1A 3N1LA 2VHSA 1AU2A 1ATKA 1DF0A 1YK8A 4KLBA 2DC6A 2AIMA 1KXRA 1U9QX 3V6CA 1EF7A 1IWDA 1BY8A 1PADA 1K3BB 5J94A 4HXDB 4KOQA 2GIAA 4BOQA 2DZZA 2WBFX 3HD3A 3I3TA 2HXZA 4N79A 4AXMA 3TNXA 3PHUA 1U9XA 3PDFA 5CVMA 3DF0A 2R9OA 3P5UA 2AUXA 2R9NA 1JQPA 1X9YA 4QH6A 3N1IA 2HHNA 3M99A 3PBHA 3O0UA 3PNRA 3F75A 1AU0A 1M6DA 1TLOA 3IEJA 4MZOA 3AI8A 3QJ3A 3N1KA 8PCHA 2OULA 4XR7A 3OISA 3ZNHA 5KO3A 3W31A 7PCKA 3N4CA 4QRXA 2JQFR 4OW0A 2FT2A 1YT7A 3I06A 2GFOA 2Z84A 4Q8HA 1NQCA 1A6RA 1PVJA 2IT9A 5A24A 3RA0A 2GIDA 4CDEB 1AIMA 3TMPA 1NB3A 2XU5A 1KHPA 4YYVA 2DCBA 4BOSA 1POPA 1F29A 1VSNA 3ERVA 1PPNA 5K16A 1CB5A 2DCAA 2G6DA 1YVBA 5EF4A 1BGOA 2IBIA 1MEMA 2CIOA 3IHPA 4PT5A 1MIRA 3H7DA 2O6XA 2YJ2A 1FH0A 3KW9A 5EZSA 3IOQA 1AU4A 4DMXA 4RF1A 3WXGA 2R6NA 6PADA 1KFXL 3P5XA 4XUIA 2GIAB 1ICFA 3B21A 2GJED 3CH3X 1NL6A 4YYRA 1KFUL 4BS6A 1SNKA 4YYUA 3OBHA 3CBJA 2H7JA 2GIDB 2JRIA 2DC7A 5E6JA 4BF3A 2DZYA 4REZA 4BS5A 4BOBA 3MORA 3B79A 4BODA 5JZEA 1MDWA 1PPPA 2GHUA 2P7UA 4I05A 5EGWA 4OEMA 4FJCA 1CPJA 3KKUA 2AS8A 1ITOA 5CVNB 3BB7A 3N1HA 1QOLA 3BCNA 1PIPA 2FTDA 4OELA 3KWZA 4I04A 5FPWA 3PRMA 1CS8A 2PBHA 3W30A 2YJCA 4CZWA 2BTWB 4K7CA 3C9EA 3IMAA 2G8EA 3BBAA 4YYWA 2HD5A 3HHAA 2R9CA 2C62A 1NPZA 2G7YA 4OVZB 4BSQA 4W5BA 1F2CA 2J7QA 3N3KA 3K24A 2NQAA 1L3AA 4RKXA 2DCCA 5CHTA 2G8JA 4FK5A 4D8EA 5CHVA 3PRPA 1PPDA 2AVWA 4KOPA 3R9ZA 1Q6KA 3O65A 2FUDA 2E02A 5F02A 2B1NA 4P6EA 3WXFA 4G54A 2XU4A 2AGAA 3F5VA 3GCBA 1BP4A 1EWMA 5JA7A 3IUTA 2OZ2A 4P6GA 3USVA 1CJLA 3E9SA 3BWKA 1ZCMA 1AYVA 4BOUA 1NLJA 4RY2A 4CDFB 3E1ZB 3OF9A 4FIPA 3PHXA 2C0YA 3KFQA 3HHIA 4ZTBA 2NQGA 3LFYA 2VHFA 9PAPA 3V6EA 4BPVA 3CM1A 2F1GA 1AU3A 4MM3B 4D8IA 3BPFA 4BQVA 2E01A 3ZUAA 3N3GA 4J38A 4M0WA 1ZIVA 2ATOA 1DKIA 4RF0A 1PCIA 4R3DA 3H6SA 3P5VA 2F7DA 1MHWA 2BDZA 4CDCB 3H8BA 1CTEA 4YYSA 3MHSA 1THEA 2YJ9A 2J7QC 4D8BA 3BOWA 2FRAA 3QSDA 2ACTA 1EWOA 1EWLA 5EZQA 1MEGA 2Y5BA 3KX1A 3C0RA 4W4UA 3U8EA 4QBBA 2E03A 2UZJA 5FGPA 3D6SA 2IPPB 4ZUXU 1CSBB 4QRGA 4BOZA 4OVZA 1Y4HA 3RVVA 1S4VA 2HH5A 2R9FA 1MS6A 4KOOA 4YYQA 3P5WA 3K8UA 2XU3A 4W5CA 1NB5A 2AYNA 2FQ9A 3BY4A 4BHMA 1TU6A 1EWPA 3RNVA 4AXLA 3H89A 1DEUA 2YJBA 4X6JA 3OQCA 4AGHA 2AU1A 4N4ZA 2BTWA 1PCFA 2CB5A 3S3QA 4PADA 2DC8A 4BXMA 2ARYA 2P0RA 2JQGR 3MHHA 3PW3A 1F2AA 3KSEA 1AECA 1QXPA 1GMYA 3N1JA 4MSXA 2B1MA 3RVXA 2FE8A 1QDQA 3MTVA 3O1GA 1UKFA 1HUCB 3IFUA 1PBHA 2NVNA 3R9YA 3S3RA 4IP3A 4X6IA
chains in the Genus database with same CATH topology
4RNAA 4ZTBA 2GIDB 2JRIA 4BOPA 3MJ5A 4HXDB 5E6JA 2GIAA 3CM1A 4BF3A 4BOQA 4MM3B 4WURA 3PHWA 4D8IA 4REZA 4BOBA 4P16A 4BODA 3PHUA 5JZEA 4GUAA 3PT2A 4J38A 4M0WA 1DKIA 4RF0A 3BB7A 4R3DA 2BU3A 1YZBA 4MI7A 3TRKA 3W30A 3PRMA 2BTWB 2J7QC 4D8BA 3MP2A 2DOSA 3ZNHA 5KO3A 3K44A 3W31A 3BBAA 5EZQA 3C0RA 4OVZB 4OW0A 2GJEA 2Z84A 2UZJA 5FGPA 2J7QA 4BOZA 4OVZA 1PVJA 2HWKA 4RKXA 2GIDA 4D8EA 3TMPA 3PRPA 4BOSA 3BY4A 3O65A 3RNVA 3OQCA 2BTWA 2M4FA 2AGAA 4A5UA 2JTCA 4BXMA 4PT5A 3E9SA 3PSEA 4XZXA 4BOUA 5EZSA 4RF1A 4IUMA 2FE8A 3MTVA 1UKFA 3IFUA 2GIAB 3B21A 2GJED 3PHXA 3OBHA 4IP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MTV A; 
#chains in the Genus database with same CATH topology
 4RNA A;  4BOP A;  1YK7 A;  3MJ5 A;  2NQD B;  1Y08 A;  2AUZ A;  1SP4 B;  1U9W A;  4WUR A;  3PHW A;  2FRQ A;  3WXE A;  3CBK A;  4P16 A;  2NQI A;  1BQI A;  4GUA A;  2PAD A;  3PT2 A;  3NHE A;  4Q8G A;  3RVW A;  2R9M A;  3HWN A;  1AYW A;  3H8C A;  2BU3 A;  1U9V A;  1YZB A;  4MI7 A;  5PAD A;  2YJ8 A;  3OVX A;  2FO5 A;  4CDD B;  3TRK A;  4BG7 A;  2E00 A;  1CV8 A;  4YVA A;  1PPO A;  2OP3 A;  3OF8 A;  1F2B A;  3MP2 A;  2DOS A;  1YAL A;  3K44 A;  1GEC E;  2DJG B;  3MTN A;  2AYO A;  3LXS A;  2DCD A;  4USG A;  4MZS A;  2GJE A;  1ME3 A;  4QRV A;  5CVO B;  5JH3 A;  4DMY A;  4X6H A;  2HWK A;  2PHE A;  4PP1 A;  4PP2 E;  1KHQ A;  3OVZ A;  2PNS A;  3KWB X;  4N8W A;  1STF E;  1U5I A;  3QT4 A;  1TL9 A;  2FYE A;  3BPM A;  3BC3 A;  1GLO A;  2DJF B;  3K9M A;  2M4F A;  1PXV A;  1CVZ A;  1QMY A;  1CQD A;  4I07 A;  4WA6 A;  1GCB A;  4A5U A;  2PRE A;  2JTC A;  2DC9 A;  1AYU A;  1ME4 A;  2Y6E A;  4HWY A;  3IV2 A;  2P86 A;  3CH2 X;  3PSE A;  1PE6 A;  4XZX A;  4YV8 A;  1XKG A;  1VJV A;  4IUM A;  4PI3 A;  2BDL A;  1O0E A;  2XU1 A;  3N1L A;  2VHS A;  1AU2 A;  1ATK A;  1DF0 A;  1YK8 A;  4KLB A;  2DC6 A;  2AIM A;  1KXR A;  1U9Q X;  3V6C A;  1EF7 A;  1IWD A;  1BY8 A;  1PAD A;  1K3B B;  5J94 A;  4HXD B;  4KOQ A;  2GIA A;  4BOQ A;  2DZZ A;  2WBF X;  3HD3 A;  3I3T A;  2HXZ A;  4N79 A;  4AXM A;  3TNX A;  3PHU A;  1U9X A;  3PDF A;  5CVM A;  3DF0 A;  2R9O A;  3P5U A;  2AUX A;  2R9N A;  1JQP A;  1X9Y A;  4QH6 A;  3N1I A;  2HHN A;  3M99 A;  3PBH A;  3O0U A;  3PNR A;  3F75 A;  1AU0 A;  1M6D A;  1TLO A;  3IEJ A;  4MZO A;  3AI8 A;  3QJ3 A;  3N1K A;  8PCH A;  2OUL A;  4XR7 A;  3OIS A;  3ZNH A;  5KO3 A;  3W31 A;  7PCK A;  3N4C A;  4QRX A;  2JQF R;  4OW0 A;  2FT2 A;  1YT7 A;  3I06 A;  2GFO A;  2Z84 A;  4Q8H A;  1NQC A;  1A6R A;  1PVJ A;  2IT9 A;  5A24 A;  3RA0 A;  2GID A;  4CDE B;  1AIM A;  3TMP A;  1NB3 A;  2XU5 A;  1KHP A;  4YYV A;  2DCB A;  4BOS A;  1POP A;  1F29 A;  1VSN A;  3ERV A;  1PPN A;  5K16 A;  1CB5 A;  2DCA A;  2G6D A;  1YVB A;  5EF4 A;  1BGO A;  2IBI A;  1MEM A;  2CIO A;  3IHP A;  4PT5 A;  1MIR A;  3H7D A;  2O6X A;  2YJ2 A;  1FH0 A;  3KW9 A;  5EZS A;  3IOQ A;  1AU4 A;  4DMX A;  4RF1 A;  3WXG A;  2R6N A;  6PAD A;  1KFX L;  3P5X A;  4XUI A;  2GIA B;  1ICF A;  3B21 A;  2GJE D;  3CH3 X;  1NL6 A;  4YYR A;  1KFU L;  4BS6 A;  1SNK A;  4YYU A;  3OBH A;  3CBJ A;  2H7J A;  2GID B;  2JRI A;  2DC7 A;  5E6J A;  4BF3 A;  2DZY A;  4REZ A;  4BS5 A;  4BOB A;  3MOR A;  3B79 A;  4BOD A;  5JZE A;  1MDW A;  1PPP A;  2GHU A;  2P7U A;  4I05 A;  5EGW A;  4OEM A;  4FJC A;  1CPJ A;  3KKU A;  2AS8 A;  1ITO A;  5CVN B;  3BB7 A;  3N1H A;  1QOL A;  3BCN A;  1PIP A;  2FTD A;  4OEL A;  3KWZ A;  4I04 A;  5FPW A;  3PRM A;  1CS8 A;  2PBH A;  3W30 A;  2YJC A;  4CZW A;  2BTW B;  4K7C A;  3C9E A;  3IMA A;  2G8E A;  3BBA A;  4YYW A;  2HD5 A;  3HHA A;  2R9C A;  2C62 A;  1NPZ A;  2G7Y A;  4OVZ B;  4BSQ A;  4W5B A;  1F2C A;  2J7Q A;  3N3K A;  3K24 A;  2NQA A;  1L3A A;  4RKX A;  2DCC A;  5CHT A;  2G8J A;  4FK5 A;  4D8E A;  5CHV A;  3PRP A;  1PPD A;  2AVW A;  4KOP A;  3R9Z A;  1Q6K A;  3O65 A;  2FUD A;  2E02 A;  5F02 A;  2B1N A;  4P6E A;  3WXF A;  4G54 A;  2XU4 A;  2AGA A;  3F5V A;  3GCB A;  1BP4 A;  1EWM A;  5JA7 A;  3IUT A;  2OZ2 A;  4P6G A;  3USV A;  1CJL A;  3E9S A;  3BWK A;  1ZCM A;  1AYV A;  4BOU A;  1NLJ A;  4RY2 A;  4CDF B;  3E1Z B;  3OF9 A;  4FIP A;  3PHX A;  2C0Y A;  3KFQ A;  3HHI A;  4ZTB A;  2NQG A;  3LFY A;  2VHF A;  9PAP A;  3V6E A;  4BPV A;  3CM1 A;  2F1G A;  1AU3 A;  4MM3 B;  4D8I A;  3BPF A;  4BQV A;  2E01 A;  3ZUA A;  3N3G A;  4J38 A;  4M0W A;  1ZIV A;  2ATO A;  1DKI A;  4RF0 A;  1PCI A;  4R3D A;  3H6S A;  3P5V A;  2F7D A;  1MHW A;  2BDZ A;  4CDC B;  3H8B A;  1CTE A;  4YYS A;  3MHS A;  1THE A;  2YJ9 A;  2J7Q C;  4D8B A;  3BOW A;  2FRA A;  3QSD A;  2ACT A;  1EWO A;  1EWL A;  5EZQ A;  1MEG A;  2Y5B A;  3KX1 A;  3C0R A;  4W4U A;  3U8E A;  4QBB A;  2E03 A;  2UZJ A;  5FGP A;  3D6S A;  2IPP B;  4ZUX U;  1CSB B;  4QRG A;  4BOZ A;  4OVZ A;  1Y4H A;  3RVV A;  1S4V A;  2HH5 A;  2R9F A;  1MS6 A;  4KOO A;  4YYQ A;  3P5W A;  3K8U A;  2XU3 A;  4W5C A;  1NB5 A;  2AYN A;  2FQ9 A;  3BY4 A;  4BHM A;  1TU6 A;  1EWP A;  3RNV A;  4AXL A;  3H89 A;  1DEU A;  2YJB A;  4X6J A;  3OQC A;  4AGH A;  2AU1 A;  4N4Z A;  2BTW A;  1PCF A;  2CB5 A;  3S3Q A;  4PAD A;  2DC8 A;  4BXM A;  2ARY A;  2P0R A;  2JQG R;  3MHH A;  3PW3 A;  1F2A A;  3KSE A;  1AEC A;  1QXP A;  1GMY A;  3N1J A;  4MSX A;  2B1M A;  3RVX A;  2FE8 A;  1QDQ A;  3MTV A;  3O1G A;  1UKF A;  1HUC B;  3IFU A;  1PBH A;  2NVN A;  3R9Y A;  3S3R A;  4IP3 A;  4X6I A; 
#chains in the Genus database with same CATH homology
 4RNA A;  4ZTB A;  2GID B;  2JRI A;  4BOP A;  3MJ5 A;  4HXD B;  5E6J A;  2GIA A;  3CM1 A;  4BF3 A;  4BOQ A;  4MM3 B;  4WUR A;  3PHW A;  4D8I A;  4REZ A;  4BOB A;  4P16 A;  4BOD A;  3PHU A;  5JZE A;  4GUA A;  3PT2 A;  4J38 A;  4M0W A;  1DKI A;  4RF0 A;  3BB7 A;  4R3D A;  2BU3 A;  1YZB A;  4MI7 A;  3TRK A;  3W30 A;  3PRM A;  2BTW B;  2J7Q C;  4D8B A;  3MP2 A;  2DOS A;  3ZNH A;  5KO3 A;  3K44 A;  3W31 A;  3BBA A;  5EZQ A;  3C0R A;  4OVZ B;  4OW0 A;  2GJE A;  2Z84 A;  2UZJ A;  5FGP A;  2J7Q A;  4BOZ A;  4OVZ A;  1PVJ A;  2HWK A;  4RKX A;  2GID A;  4D8E A;  3TMP A;  3PRP A;  4BOS A;  3BY4 A;  3O65 A;  3RNV A;  3OQC A;  2BTW A;  2M4F A;  2AGA A;  4A5U A;  2JTC A;  4BXM A;  4PT5 A;  3E9S A;  3PSE A;  4XZX A;  4BOU A;  5EZS A;  4RF1 A;  4IUM A;  2FE8 A;  3MTV A;  1UKF A;  3IFU A;  2GIA B;  3B21 A;  2GJE D;  3PHX A;  3OBH A;  4IP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...