3MTVA

The crystal structure of the prrsv nonstructural protein nsp1
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
203
structure length
203
Chain Sequence
ADVYDIGRGAVMYVAGGKVSWAPRGGNEVKFEPVPKELKLVANRLHTSFPPHHVVDMSKFTFITPGSGVSMRVEYQYGCLPADTVPEGNCWWRLLDSLPPEVQYKEIRHANQFGYQTKHGVPGKYLQRRLQVNGLRAVTDTHGPIVIQYFSVKESWIRHLKLVEEPSLPGFEDLLRIRVEPNTSPLAGKDEKIFRFGSHKWYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of porcine reproductive and respiratory syndrome virus nonstructural protein Nsp1beta reveals a novel metal-dependent nuclease
pubmed doi rcsb
source organism Porcine reproductive and respiratory syndrome virus
molecule tags Hydrolase
molecule keywords Papain-like cysteine protease
total genus 42
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2010-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05411 Peptidase_C32 Equine arteritis virus putative proteinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.31.30 Mainly Beta Roll Transcriptional Co-activator pc4; Chain A Transcriptional Co-activator pc4; Chain A 3mtvA01
3.90.70.70 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3mtvA02
3MTVA
chains in the Genus database with same CATH superfamily
3H6SA 1UKFA 3OF9A 3TRKA 4W5BA 2AUZA 1BY8A 2AGAA 4OVZA 3W31A 4MI7A 4BODA 2GJEA 3RVVA 3IFUA 1NQCA 1ICFA 2FUDA 1NB3A 5CVNB 2Z84A 6PADA 2DJGB 3BOWA 1ME3A 5PADA 1CQDA 1PPOA 3CH3X 1THEA 2GIAB 3R9YA 4PI3A 3U8EA 1TLOA 1U9VA 4PP2E 3MHHA 3CM1A 3P5XA 3ERVA 2PBHA 1Q6KA 4Q8GA 4CDFB 2WBFX 2DCCA 1L3AA 1KXRA 2IBIA 3BC3A 1K3BB 1VJVA 2DOSA 4OELA 5EGWA 3K24A 4RNAA 3KWBX 2AYOA 4BQVA 3IV2A 2H7JA 3OQCA 4X6IA 4K7CA 1BQIA 1GECE 3HHIA 1U9XA 3BWKA 4USGA 2O6XA 3E9SA 2IPPB 1AYUA 2OULA 5JZEA 1F2AA 4OEMA 3K9MA 3CBJA 2FE8A 2FRQA 1S4VA 3MP2A 3HD3A 4I05A 3LFYA 1U9QX 2PADA 1BGOA 5F02A 2B1NA 1PPPA 2G8EA 2AYNA 4DMYA 3PHXA 1QOLA 3NHEA 4OVZB 1AYVA 4X6HA 1XKGA 1X9YA 4MZOA 2R9MA 1PPDA 3H89A 2B1MA 2R6NA 1SNKA 1MHWA 2JQGR 2CIOA 3F75A 1EWOA 4BXMA 3I06A 4PADA 2NQAA 4D8EA 2GIAA 1PIPA 3RVXA 4GUAA 2XU3A 4ZUXU 2G7YA 1KFUL 2NVNA 1F29A 1AU3A 4BOUA 2PHEA 1GCBA 1YK8A 1U5IA 3LXSA 4QBBA 1PCIA 3F5VA 4PT5A 3AI8A 1MS6A 4AGHA 1M6DA 2AIMA 1QDQA 3V6CA 2GIDA 2CB5A 3IHPA 1EWLA 2DC7A 2PREA 4YYQA 4J38A 1MEGA 2R9NA 2F1GA 2E03A 4OW0A 4BHMA 1ITOA 1KFXL 3N1KA 1CPJA 4RF0A 2DJFB 3KX1A 1ZCMA 4ZTBA 5FPWA 4P6EA 1MEMA 1CTEA 1PE6A 4YYWA 3OVZA 3PBHA 4YV8A 4RF1A 4XZXA 2XU5A 1FH0A 3N1HA 3BY4A 4IP3A 4QRXA 4D8BA 2BTWB 1PVJA 1CV8A 2E00A 2YJBA 1GMYA 1YZBA 2GIDB 1EF7A 2Y5BA 4YYUA 5A24A 4BSQA 3P5VA 4W4UA 2GJED 4AXMA 1CB5A 3MJ5A 2HHNA 3I3TA 1YVBA 2XU1A 2DZZA 1MIRA 2DCDA 3PRMA 3O1GA 4FJCA 4MSXA 3R9ZA 3D6SA 4WA6A 5CHVA 2YJ9A 3N1LA 1BP4A 1EWPA 3QT4A 5EF4A 1AECA 2G8JA 1QXPA 1ME4A 3N1IA 4BOBA 1O0EA 4BF3A 1DEUA 2P86A 3OBHA 4BOPA 1ATKA 4R3DA 4YYRA 3S3QA 2HH5A 3CBKA 2R9CA 4YYSA 3KWZA 1STFE 2FO5A 2BTWA 2JTCA 2HD5A 2R9FA 2BDLA 2YJCA 5JH3A 4A5UA 1QMYA 3ZUAA 1PXVA 5FGPA 1Y4HA 3P5WA 2G6DA 3USVA 2YJ2A 5JA7A 4BG7A 2DZYA 3IEJA 4DMXA 4RY2A 3K44A 2GHUA 1CVZA 4MM3B 4P6GA 4QRVA 3K8UA 3S3RA 2JQFR 3O65A 2P0RA 3H7DA 1KHPA 4I04A 2R9OA 2VHFA 2DC6A 4N4ZA 1MDWA 2BU3A 2OP3A 4D8IA 2C0YA 2E01A 5CHTA 1F2CA 4P16A 2NQDB 1PCFA 3ZNHA 1VSNA 3M99A 2FTDA 4BPVA 3HHAA 4FK5A 3GCBA 4BS5A 4YYVA 1A6RA 2DC9A 4W5CA 4G54A 2BDZA 1YK7A 3MHSA 4X6JA 3BB7A 3MTNA 3H8BA 2DCBA 4MZSA 2XU4A 4BOZA 4M0WA 2NQGA 3B21A 2F7DA 4YVAA 1CS8A 3PDFA 1NB5A 3RVWA 1Y08A 3KW9A 2M4FA 3IUTA 2FRAA 3RNVA 9PAPA 1NL6A 3IMAA 4QH6A 3BPMA 3DF0A 4BS6A 2FYEA 5EZQA 5J94A 4HXDB 4CDCB 1U9WA 3RA0A 4PP1A 3TNXA 3PSEA 4BOQA 3TMPA 3WXEA 3PHWA 4N8WA 2Y6EA 1JQPA 1NLJA 2HXZA 5EZSA 3IOQA 1NPZA 3PW3A 2IT9A 1TL9A 2YJ8A 5CVMA 4XR7A 1CJLA 3BCNA 2ARYA 3WXFA 1DKIA 3WXGA 3BPFA 2FQ9A 5CVOB 3KKUA 4XUIA 2GFOA 3O0UA 1CSBB 1TU6A 1YALA 1SP4B 4WURA 2ATOA 4Q8HA 1POPA 3C0RA 3PHUA 5K16A 4I07A 1KHQA 2E02A 4KOQA 2AU1A 2NQIA 2J7QA 3MORA 4CDDB 3BBAA 5KO3A 1AU0A 8PCHA 2HWKA 2OZ2A 3E1ZB 1AU4A 1GLOA 1YT7A 3KSEA 2AVWA 1AIMA 2AS8A 2ACTA 1PADA 2FT2A 4KOPA 1PPNA 1F2BA 7PCKA 3OISA 1IWDA 3PT2A 3N1JA 5E6JA 2C62A 4CZWA 1PBHA 3N3GA 4BOSA 4QRGA 2P7UA 1AYWA 2AUXA 4REZA 3P5UA 1AU2A 1HUCB 3B79A 4HWYA 2UZJA 2VHSA 2JRIA 3H8CA 3OVXA 3CH2X 4N79A 2DC8A 4CDEB 2DCAA 4KOOA 3OF8A 4IUMA 3N4CA 3V6EA 2J7QC 3PRPA 1DF0A 4AXLA 1ZIVA 4FIPA 3PNRA 3N3KA 3W30A 2PNSA 4KLBA 3QSDA 1EWMA 3C9EA 3MTVA 3KFQA 4RKXA 3QJ3A 3HWNA
chains in the Genus database with same CATH topology
5EZSA 4BXMA 1UKFA 3TRKA 4D8EA 2GIAA 2JTCA 2BTWA 2AGAA 4OVZA 3W31A 4GUAA 4MI7A 4A5UA 4BODA 2GJEA 5FGPA 1DKIA 3IFUA 4BOUA 2Z84A 4PT5A 3K44A 4MM3B 4WURA 2GIAB 2GIDA 3C0RA 3PHUA 3O65A 4J38A 3CM1A 2J7QA 3BBAA 2BU3A 5KO3A 4OW0A 2HWKA 4D8IA 4RF0A 4P16A 2DOSA 3ZNHA 4ZTBA 4RNAA 3OQCA 3PT2A 4RF1A 4XZXA 3BB7A 5E6JA 3BY4A 3E9SA 4IP3A 4D8BA 2BTWB 5JZEA 4BOZA 1PVJA 4BOSA 4M0WA 1YZBA 3B21A 2GIDB 2FE8A 4REZA 3MP2A 2GJED 2M4FA 3RNVA 2UZJA 2JRIA 3MJ5A 3PRMA 5EZQA 4IUMA 4HXDB 2J7QC 3PHXA 3PRPA 4OVZB 3W30A 3PSEA 4BOQA 3TMPA 3PHWA 3MTVA 4BOBA 4RKXA 4BF3A 3OBHA 4BOPA 4R3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MTV A; 
#chains in the Genus database with same CATH topology
 3H6S A;  1UKF A;  3OF9 A;  3TRK A;  4W5B A;  2AUZ A;  1BY8 A;  2AGA A;  4OVZ A;  3W31 A;  4MI7 A;  4BOD A;  2GJE A;  3RVV A;  3IFU A;  1NQC A;  1ICF A;  2FUD A;  1NB3 A;  5CVN B;  2Z84 A;  6PAD A;  2DJG B;  3BOW A;  1ME3 A;  5PAD A;  1CQD A;  1PPO A;  3CH3 X;  1THE A;  2GIA B;  3R9Y A;  4PI3 A;  3U8E A;  1TLO A;  1U9V A;  4PP2 E;  3MHH A;  3CM1 A;  3P5X A;  3ERV A;  2PBH A;  1Q6K A;  4Q8G A;  4CDF B;  2WBF X;  2DCC A;  1L3A A;  1KXR A;  2IBI A;  3BC3 A;  1K3B B;  1VJV A;  2DOS A;  4OEL A;  5EGW A;  3K24 A;  4RNA A;  3KWB X;  2AYO A;  4BQV A;  3IV2 A;  2H7J A;  3OQC A;  4X6I A;  4K7C A;  1BQI A;  1GEC E;  3HHI A;  1U9X A;  3BWK A;  4USG A;  2O6X A;  3E9S A;  2IPP B;  1AYU A;  2OUL A;  5JZE A;  1F2A A;  4OEM A;  3K9M A;  3CBJ A;  2FE8 A;  2FRQ A;  1S4V A;  3MP2 A;  3HD3 A;  4I05 A;  3LFY A;  1U9Q X;  2PAD A;  1BGO A;  5F02 A;  2B1N A;  1PPP A;  2G8E A;  2AYN A;  4DMY A;  3PHX A;  1QOL A;  3NHE A;  4OVZ B;  1AYV A;  4X6H A;  1XKG A;  1X9Y A;  4MZO A;  2R9M A;  1PPD A;  3H89 A;  2B1M A;  2R6N A;  1SNK A;  1MHW A;  2JQG R;  2CIO A;  3F75 A;  1EWO A;  4BXM A;  3I06 A;  4PAD A;  2NQA A;  4D8E A;  2GIA A;  1PIP A;  3RVX A;  4GUA A;  2XU3 A;  4ZUX U;  2G7Y A;  1KFU L;  2NVN A;  1F29 A;  1AU3 A;  4BOU A;  2PHE A;  1GCB A;  1YK8 A;  1U5I A;  3LXS A;  4QBB A;  1PCI A;  3F5V A;  4PT5 A;  3AI8 A;  1MS6 A;  4AGH A;  1M6D A;  2AIM A;  1QDQ A;  3V6C A;  2GID A;  2CB5 A;  3IHP A;  1EWL A;  2DC7 A;  2PRE A;  4YYQ A;  4J38 A;  1MEG A;  2R9N A;  2F1G A;  2E03 A;  4OW0 A;  4BHM A;  1ITO A;  1KFX L;  3N1K A;  1CPJ A;  4RF0 A;  2DJF B;  3KX1 A;  1ZCM A;  4ZTB A;  5FPW A;  4P6E A;  1MEM A;  1CTE A;  1PE6 A;  4YYW A;  3OVZ A;  3PBH A;  4YV8 A;  4RF1 A;  4XZX A;  2XU5 A;  1FH0 A;  3N1H A;  3BY4 A;  4IP3 A;  4QRX A;  4D8B A;  2BTW B;  1PVJ A;  1CV8 A;  2E00 A;  2YJB A;  1GMY A;  1YZB A;  2GID B;  1EF7 A;  2Y5B A;  4YYU A;  5A24 A;  4BSQ A;  3P5V A;  4W4U A;  2GJE D;  4AXM A;  1CB5 A;  3MJ5 A;  2HHN A;  3I3T A;  1YVB A;  2XU1 A;  2DZZ A;  1MIR A;  2DCD A;  3PRM A;  3O1G A;  4FJC A;  4MSX A;  3R9Z A;  3D6S A;  4WA6 A;  5CHV A;  2YJ9 A;  3N1L A;  1BP4 A;  1EWP A;  3QT4 A;  5EF4 A;  1AEC A;  2G8J A;  1QXP A;  1ME4 A;  3N1I A;  4BOB A;  1O0E A;  4BF3 A;  1DEU A;  2P86 A;  3OBH A;  4BOP A;  1ATK A;  4R3D A;  4YYR A;  3S3Q A;  2HH5 A;  3CBK A;  2R9C A;  4YYS A;  3KWZ A;  1STF E;  2FO5 A;  2BTW A;  2JTC A;  2HD5 A;  2R9F A;  2BDL A;  2YJC A;  5JH3 A;  4A5U A;  1QMY A;  3ZUA A;  1PXV A;  5FGP A;  1Y4H A;  3P5W A;  2G6D A;  3USV A;  2YJ2 A;  5JA7 A;  4BG7 A;  2DZY A;  3IEJ A;  4DMX A;  4RY2 A;  3K44 A;  2GHU A;  1CVZ A;  4MM3 B;  4P6G A;  4QRV A;  3K8U A;  3S3R A;  2JQF R;  3O65 A;  2P0R A;  3H7D A;  1KHP A;  4I04 A;  2R9O A;  2VHF A;  2DC6 A;  4N4Z A;  1MDW A;  2BU3 A;  2OP3 A;  4D8I A;  2C0Y A;  2E01 A;  5CHT A;  1F2C A;  4P16 A;  2NQD B;  1PCF A;  3ZNH A;  1VSN A;  3M99 A;  2FTD A;  4BPV A;  3HHA A;  4FK5 A;  3GCB A;  4BS5 A;  4YYV A;  1A6R A;  2DC9 A;  4W5C A;  4G54 A;  2BDZ A;  1YK7 A;  3MHS A;  4X6J A;  3BB7 A;  3MTN A;  3H8B A;  2DCB A;  4MZS A;  2XU4 A;  4BOZ A;  4M0W A;  2NQG A;  3B21 A;  2F7D A;  4YVA A;  1CS8 A;  3PDF A;  1NB5 A;  3RVW A;  1Y08 A;  3KW9 A;  2M4F A;  3IUT A;  2FRA A;  3RNV A;  9PAP A;  1NL6 A;  3IMA A;  4QH6 A;  3BPM A;  3DF0 A;  4BS6 A;  2FYE A;  5EZQ A;  5J94 A;  4HXD B;  4CDC B;  1U9W A;  3RA0 A;  4PP1 A;  3TNX A;  3PSE A;  4BOQ A;  3TMP A;  3WXE A;  3PHW A;  4N8W A;  2Y6E A;  1JQP A;  1NLJ A;  2HXZ A;  5EZS A;  3IOQ A;  1NPZ A;  3PW3 A;  2IT9 A;  1TL9 A;  2YJ8 A;  5CVM A;  4XR7 A;  1CJL A;  3BCN A;  2ARY A;  3WXF A;  1DKI A;  3WXG A;  3BPF A;  2FQ9 A;  5CVO B;  3KKU A;  4XUI A;  2GFO A;  3O0U A;  1CSB B;  1TU6 A;  1YAL A;  1SP4 B;  4WUR A;  2ATO A;  4Q8H A;  1POP A;  3C0R A;  3PHU A;  5K16 A;  4I07 A;  1KHQ A;  2E02 A;  4KOQ A;  2AU1 A;  2NQI A;  2J7Q A;  3MOR A;  4CDD B;  3BBA A;  5KO3 A;  1AU0 A;  8PCH A;  2HWK A;  2OZ2 A;  3E1Z B;  1AU4 A;  1GLO A;  1YT7 A;  3KSE A;  2AVW A;  1AIM A;  2AS8 A;  2ACT A;  1PAD A;  2FT2 A;  4KOP A;  1PPN A;  1F2B A;  7PCK A;  3OIS A;  1IWD A;  3PT2 A;  3N1J A;  5E6J A;  2C62 A;  4CZW A;  1PBH A;  3N3G A;  4BOS A;  4QRG A;  2P7U A;  1AYW A;  2AUX A;  4REZ A;  3P5U A;  1AU2 A;  1HUC B;  3B79 A;  4HWY A;  2UZJ A;  2VHS A;  2JRI A;  3H8C A;  3OVX A;  3CH2 X;  4N79 A;  2DC8 A;  4CDE B;  2DCA A;  4KOO A;  3OF8 A;  4IUM A;  3N4C A;  3V6E A;  2J7Q C;  3PRP A;  1DF0 A;  4AXL A;  1ZIV A;  4FIP A;  3PNR A;  3N3K A;  3W30 A;  2PNS A;  4KLB A;  3QSD A;  1EWM A;  3C9E A;  3MTV A;  3KFQ A;  4RKX A;  3QJ3 A;  3HWN A; 
#chains in the Genus database with same CATH homology
 5EZS A;  4BXM A;  1UKF A;  3TRK A;  4D8E A;  2GIA A;  2JTC A;  2BTW A;  2AGA A;  4OVZ A;  3W31 A;  4GUA A;  4MI7 A;  4A5U A;  4BOD A;  2GJE A;  5FGP A;  1DKI A;  3IFU A;  4BOU A;  2Z84 A;  4PT5 A;  3K44 A;  4MM3 B;  4WUR A;  2GIA B;  2GID A;  3C0R A;  3PHU A;  3O65 A;  4J38 A;  3CM1 A;  2J7Q A;  3BBA A;  2BU3 A;  5KO3 A;  4OW0 A;  2HWK A;  4D8I A;  4RF0 A;  4P16 A;  2DOS A;  3ZNH A;  4ZTB A;  4RNA A;  3OQC A;  3PT2 A;  4RF1 A;  4XZX A;  3BB7 A;  5E6J A;  3BY4 A;  3E9S A;  4IP3 A;  4D8B A;  2BTW B;  5JZE A;  4BOZ A;  1PVJ A;  4BOS A;  4M0W A;  1YZB A;  3B21 A;  2GID B;  2FE8 A;  4REZ A;  3MP2 A;  2GJE D;  2M4F A;  3RNV A;  2UZJ A;  2JRI A;  3MJ5 A;  3PRM A;  5EZQ A;  4IUM A;  4HXD B;  2J7Q C;  3PHX A;  3PRP A;  4OVZ B;  3W30 A;  3PSE A;  4BOQ A;  3TMP A;  3PHW A;  3MTV A;  4BOB A;  4RKX A;  4BF3 A;  3OBH A;  4BOP A;  4R3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...