3MTVA

The crystal structure of the prrsv nonstructural protein nsp1
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
203
structure length
203
Chain Sequence
b'ADVYDIGRGAVMYVAGGKVSWAPRGGNEVKFEPVPKELKLVANRLHTSFPPHHVVDMSKFTFITPGSGVSMRVEYQYGCLPADTVPEGNCWWRLLDSLPPEVQYKEIRHANQFGYQTKHGVPGKYLQRRLQVNGLRAVTDTHGPIVIQYFSVKESWIRHLKLVEEPSLPGFEDLLRIRVEPNTSPLAGKDEKIFRFGSHKWYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Papain-like cysteine protease
publication title The crystal structure of porcine reproductive and respiratory syndrome virus nonstructural protein Nsp1beta reveals a novel metal-dependent nuclease
pubmed doi rcsb
source organism Porcine reproductive and respiratory syndrome virus
molecule tags Hydrolase
total genus 42
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2010-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05411 Peptidase_C32 Equine arteritis virus putative proteinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.31.30 Mainly Beta Roll Transcriptional Co-activator pc4; Chain A Transcriptional Co-activator pc4; Chain A 3mtvA01
3.90.70.70 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3mtvA02
3MTVA
chains in the Genus database with same CATH superfamily
5FGPA 1MS6A 2M4FA 2F1GA 5CHTA 3OVZA 2J7QC 4AXMA 3F75A 1NB5A 2IPPB 3MJ5A 4BF3A 3MORA 2PNSA 3F5VA 4FIPA 4YYVA 1CVZA 4QBBA 4XR7A 2DJFB 4W4UA 4ZTBA 4OELA 4I05A 3LFYA 3PW3A 2XU5A 2JRIA 3MTVA 3N3GA 2BDZA 4BQVA 3IMAA 3PDFA 2DC7A 4R3DA 1VSNA 3WXGA 2C0YA 4D8IA 5K16A 1U9VA 2JTCA 4D8EA 3KWBX 4X6IA 2P86A 4FJCA 2B1MA 1MEGA 3PT2A 2YJ8A 2DZYA 4Q8GA 4K7CA 4MSXA 4I04A 1THEA 4MI7A 1PE6A 1GECE 1KHPA 1DF0A 1HUCB 2BTWB 2NVNA 4BG7A 2G7YA 4W5CA 1ME4A 1BP4A 1AYVA 3RNVA 4J38A 2GFOA 2FUDA 2PHEA 4OEMA 4BOSA 3TNXA 2PADA 3MP2A 4M0WA 3U8EA 1YALA 1NL6A 3MHHA 4GUAA 4IP3A 1AYUA 5CHVA 1NLJA 3QSDA 4WA6A 1S4VA 4BS5A 1ME3A 1U9WA 1AYWA 2NQIA 2R9CA 2F7DA 1EWMA 1AECA 3CBKA 5A24A 4DMYA 1GLOA 3BB7A 3HHAA 2GIAB 1PPDA 4G54A 1QXPA 1CTEA 2OP3A 4WURA 2DCBA 1KFXL 2OZ2A 4X6HA 1PIPA 2JQFR 3PSEA 3OF9A 3PBHA 3PHXA 4D8BA 1EWLA 1TU6A 4N4ZA 2CIOA 3IV2A 3ERVA 1GCBA 1U9XA 4REZA 4RKXA 1O0EA 4X6JA 1PBHA 2E01A 1TL9A 3H89A 4KOQA 3OF8A 3RVWA 1M6DA 2FT2A 4KLBA 3PRMA 2FQ9A 3QT4A 1ATKA 1QMYA 2DCDA 2AU1A 3R9ZA 3R9YA 2DZZA 2NQDB 3I06A 4ZUXU 4QRXA 3K24A 4P16A 4I07A 4CDCB 4RY2A 1A6RA 3I3TA 3HHIA 3WXFA 2E03A 2PBHA 1DEUA 2P7UA 4MZSA 2YJBA 5JH3A 1NB3A 2E00A 2HWKA 3S3RA 1STFE 2FYEA 3N1LA 1GMYA 1PXVA 1TLOA 2H7JA 5F02A 2Z84A 1UKFA 3P5XA 4BXMA 1FH0A 1CB5A 3C0RA 1DKIA 2NQGA 1YT7A 3H6SA 4YYUA 1Q6KA 3BC3A 3D6SA 4RNAA 3IUTA 2GIAA 3IEJA 3HWNA 2XU3A 3LXSA 4W5BA 3USVA 1PPNA 1AU4A 4OW0A 1SP4B 2FRAA 3CH2X 1PPPA 3E1ZB 1BY8A 2UZJA 1EF7A 3M99A 3IFUA 3N4CA 1X9YA 1AU2A 2YJ9A 3N1KA 2DCCA 2AYNA 5EF4A 1KXRA 1L3AA 4CZWA 4BODA 4YYRA 2P0RA 4QRVA 1AU3A 1PVJA 3OQCA 1NPZA 3DF0A 1U5IA 2VHSA 3K44A 2R9NA 3IOQA 3KW9A 2GHUA 2G8JA 2FTDA 3KSEA 3PNRA 4BS6A 4IUMA 2DC9A 4CDEB 3QJ3A 4CDDB 2DC8A 2Y5BA 4YV8A 1EWPA 2NQAA 1JQPA 3W30A 1IWDA 4MZOA 3BWKA 1AU0A 2E02A 2HXZA 4BOUA 1CS8A 1KFUL 3B21A 2DC6A 5JA7A 4A5UA 4Q8HA 7PCKA 3RA0A 3PHWA 1VJVA 3N1HA 3RVXA 4PP1A 1EWOA 1Y4HA 1QOLA 3AI8A 2GIDB 2AIMA 3P5UA 4USGA 1F29A 3IHPA 2FRQA 3H7DA 2R9FA 3H8BA 2XU1A 1NQCA 2GJED 4P6GA 3P5WA 2BTWA 3MHSA 4HXDB 4DMXA 1CV8A 9PAPA 2AUXA 3PRPA 2ATOA 3K8UA 5PADA 1PPOA 2PREA 4AGHA 5CVNB 3BPFA 4XUIA 4BSQA 3BPMA 3GCBA 3CH3X 4P6EA 3E9SA 3P5VA 4N8WA 3PHUA 3HD3A 3KFQA 1MIRA 3KX1A 2AUZA 1QDQA 2FE8A 3V6EA 4OVZB 3H8CA 3KKUA 4CDFB 1PADA 2DJGB 2DCAA 2G8EA 2HHNA 1MEMA 2GJEA 1CJLA 1F2AA 1Y08A 2R9MA 2HH5A 5CVOB 4BOPA 1YVBA 2AS8A 1YK7A 4RF1A 1AIMA 1CSBB 4PT5A 1F2CA 4QH6A 3S3QA 3N1IA 2Y6EA 2O6XA 1CQDA 3O1GA 2YJCA 3OISA 2OULA 1K3BB 2JQGR 4BOBA 3KWZA 2ARYA 4MM3B 4BPVA 3O0UA 4YVAA 2DOSA 1PCFA 3MTNA 1ITOA 3RVVA 5FPWA 2IBIA 1ICFA 6PADA 1MDWA 4FK5A 3BBAA 4KOPA 5JZEA 2AGAA 2FO5A 3O65A 3ZUAA 4BHMA 4BOQA 1XKGA 8PCHA 5KO3A 1CPJA 4PP2E 2J7QA 1SNKA 2GIDA 1PCIA 3TMPA 3CM1A 2BDLA 3ZNHA 2AVWA 2R6NA 2VHFA 4PI3A 4N79A 3CBJA 2XU4A 1YZBA 1BQIA 4HWYA 5EZSA 2IT9A 2ACTA 3WXEA 3OBHA 3N1JA 5EZQA 4YYWA 3V6CA 2YJ2A 4AXLA 5EGWA 2WBFX 1POPA 3N3KA 3OVXA 5J94A 4OVZA 2R9OA 4BOZA 1YK8A 1U9QX 2G6DA 5CVMA 3BCNA 4QRGA 1BGOA 1ZCMA 3K9MA 1KHQA 2HD5A 2C62A 3BOWA 4PADA 3BY4A 2AYOA 3C9EA 3TRKA 1MHWA 3NHEA 4RF0A 4XZXA 3B79A 4KOOA 2BU3A 5E6JA 2B1NA 3W31A 2CB5A 1ZIVA 4YYQA 4YYSA 1F2BA
chains in the Genus database with same CATH topology
5FGPA 4WURA 4BODA 2M4FA 4RF1A 4PT5A 2J7QC 3MJ5A 4BF3A 1PVJA 3OQCA 3PSEA 3PHXA 3K44A 4D8BA 4BOBA 4MM3B 2DOSA 4ZTBA 4REZA 4IUMA 4RKXA 3BBAA 2JRIA 3MTVA 5JZEA 2AGAA 3O65A 4R3DA 3W30A 3PRMA 4BOQA 5KO3A 2J7QA 2GIDA 4BOUA 3TMPA 4D8IA 3B21A 2JTCA 3CM1A 4A5UA 4D8EA 3ZNHA 3PHWA 4P16A 3PT2A 1YZBA 5EZSA 4MI7A 2HWKA 2GIDB 3OBHA 2BTWB 2Z84A 5EZQA 1UKFA 3RNVA 2GJED 4J38A 4BXMA 4BOSA 2BTWA 4HXDB 3C0RA 3MP2A 1DKIA 4OVZA 3PRPA 4BOZA 4M0WA 4RNAA 2GIAA 4GUAA 4IP3A 3E9SA 4OW0A 3BY4A 3PHUA 3TRKA 4RF0A 2FE8A 4XZXA 4OVZB 2UZJA 3IFUA 3BB7A 2BU3A 5E6JA 2GIAB 3W31A 2GJEA 4BOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MTV A; 
#chains in the Genus database with same CATH topology
 5FGP A;  1MS6 A;  2M4F A;  2F1G A;  5CHT A;  3OVZ A;  2J7Q C;  4AXM A;  3F75 A;  1NB5 A;  2IPP B;  3MJ5 A;  4BF3 A;  3MOR A;  2PNS A;  3F5V A;  4FIP A;  4YYV A;  1CVZ A;  4QBB A;  4XR7 A;  2DJF B;  4W4U A;  4ZTB A;  4OEL A;  4I05 A;  3LFY A;  3PW3 A;  2XU5 A;  2JRI A;  3MTV A;  3N3G A;  2BDZ A;  4BQV A;  3IMA A;  3PDF A;  2DC7 A;  4R3D A;  1VSN A;  3WXG A;  2C0Y A;  4D8I A;  5K16 A;  1U9V A;  2JTC A;  4D8E A;  3KWB X;  4X6I A;  2P86 A;  4FJC A;  2B1M A;  1MEG A;  3PT2 A;  2YJ8 A;  2DZY A;  4Q8G A;  4K7C A;  4MSX A;  4I04 A;  1THE A;  4MI7 A;  1PE6 A;  1GEC E;  1KHP A;  1DF0 A;  1HUC B;  2BTW B;  2NVN A;  4BG7 A;  2G7Y A;  4W5C A;  1ME4 A;  1BP4 A;  1AYV A;  3RNV A;  4J38 A;  2GFO A;  2FUD A;  2PHE A;  4OEM A;  4BOS A;  3TNX A;  2PAD A;  3MP2 A;  4M0W A;  3U8E A;  1YAL A;  1NL6 A;  3MHH A;  4GUA A;  4IP3 A;  1AYU A;  5CHV A;  1NLJ A;  3QSD A;  4WA6 A;  1S4V A;  4BS5 A;  1ME3 A;  1U9W A;  1AYW A;  2NQI A;  2R9C A;  2F7D A;  1EWM A;  1AEC A;  3CBK A;  5A24 A;  4DMY A;  1GLO A;  3BB7 A;  3HHA A;  2GIA B;  1PPD A;  4G54 A;  1QXP A;  1CTE A;  2OP3 A;  4WUR A;  2DCB A;  1KFX L;  2OZ2 A;  4X6H A;  1PIP A;  2JQF R;  3PSE A;  3OF9 A;  3PBH A;  3PHX A;  4D8B A;  1EWL A;  1TU6 A;  4N4Z A;  2CIO A;  3IV2 A;  3ERV A;  1GCB A;  1U9X A;  4REZ A;  4RKX A;  1O0E A;  4X6J A;  1PBH A;  2E01 A;  1TL9 A;  3H89 A;  4KOQ A;  3OF8 A;  3RVW A;  1M6D A;  2FT2 A;  4KLB A;  3PRM A;  2FQ9 A;  3QT4 A;  1ATK A;  1QMY A;  2DCD A;  2AU1 A;  3R9Z A;  3R9Y A;  2DZZ A;  2NQD B;  3I06 A;  4ZUX U;  4QRX A;  3K24 A;  4P16 A;  4I07 A;  4CDC B;  4RY2 A;  1A6R A;  3I3T A;  3HHI A;  3WXF A;  2E03 A;  2PBH A;  1DEU A;  2P7U A;  4MZS A;  2YJB A;  5JH3 A;  1NB3 A;  2E00 A;  2HWK A;  3S3R A;  1STF E;  2FYE A;  3N1L A;  1GMY A;  1PXV A;  1TLO A;  2H7J A;  5F02 A;  2Z84 A;  1UKF A;  3P5X A;  4BXM A;  1FH0 A;  1CB5 A;  3C0R A;  1DKI A;  2NQG A;  1YT7 A;  3H6S A;  4YYU A;  1Q6K A;  3BC3 A;  3D6S A;  4RNA A;  3IUT A;  2GIA A;  3IEJ A;  3HWN A;  2XU3 A;  3LXS A;  4W5B A;  3USV A;  1PPN A;  1AU4 A;  4OW0 A;  1SP4 B;  2FRA A;  3CH2 X;  1PPP A;  3E1Z B;  1BY8 A;  2UZJ A;  1EF7 A;  3M99 A;  3IFU A;  3N4C A;  1X9Y A;  1AU2 A;  2YJ9 A;  3N1K A;  2DCC A;  2AYN A;  5EF4 A;  1KXR A;  1L3A A;  4CZW A;  4BOD A;  4YYR A;  2P0R A;  4QRV A;  1AU3 A;  1PVJ A;  3OQC A;  1NPZ A;  3DF0 A;  1U5I A;  2VHS A;  3K44 A;  2R9N A;  3IOQ A;  3KW9 A;  2GHU A;  2G8J A;  2FTD A;  3KSE A;  3PNR A;  4BS6 A;  4IUM A;  2DC9 A;  4CDE B;  3QJ3 A;  4CDD B;  2DC8 A;  2Y5B A;  4YV8 A;  1EWP A;  2NQA A;  1JQP A;  3W30 A;  1IWD A;  4MZO A;  3BWK A;  1AU0 A;  2E02 A;  2HXZ A;  4BOU A;  1CS8 A;  1KFU L;  3B21 A;  2DC6 A;  5JA7 A;  4A5U A;  4Q8H A;  7PCK A;  3RA0 A;  3PHW A;  1VJV A;  3N1H A;  3RVX A;  4PP1 A;  1EWO A;  1Y4H A;  1QOL A;  3AI8 A;  2GID B;  2AIM A;  3P5U A;  4USG A;  1F29 A;  3IHP A;  2FRQ A;  3H7D A;  2R9F A;  3H8B A;  2XU1 A;  1NQC A;  2GJE D;  4P6G A;  3P5W A;  2BTW A;  3MHS A;  4HXD B;  4DMX A;  1CV8 A;  9PAP A;  2AUX A;  3PRP A;  2ATO A;  3K8U A;  5PAD A;  1PPO A;  2PRE A;  4AGH A;  5CVN B;  3BPF A;  4XUI A;  4BSQ A;  3BPM A;  3GCB A;  3CH3 X;  4P6E A;  3E9S A;  3P5V A;  4N8W A;  3PHU A;  3HD3 A;  3KFQ A;  1MIR A;  3KX1 A;  2AUZ A;  1QDQ A;  2FE8 A;  3V6E A;  4OVZ B;  3H8C A;  3KKU A;  4CDF B;  1PAD A;  2DJG B;  2DCA A;  2G8E A;  2HHN A;  1MEM A;  2GJE A;  1CJL A;  1F2A A;  1Y08 A;  2R9M A;  2HH5 A;  5CVO B;  4BOP A;  1YVB A;  2AS8 A;  1YK7 A;  4RF1 A;  1AIM A;  1CSB B;  4PT5 A;  1F2C A;  4QH6 A;  3S3Q A;  3N1I A;  2Y6E A;  2O6X A;  1CQD A;  3O1G A;  2YJC A;  3OIS A;  2OUL A;  1K3B B;  2JQG R;  4BOB A;  3KWZ A;  2ARY A;  4MM3 B;  4BPV A;  3O0U A;  4YVA A;  2DOS A;  1PCF A;  3MTN A;  1ITO A;  3RVV A;  5FPW A;  2IBI A;  1ICF A;  6PAD A;  1MDW A;  4FK5 A;  3BBA A;  4KOP A;  5JZE A;  2AGA A;  2FO5 A;  3O65 A;  3ZUA A;  4BHM A;  4BOQ A;  1XKG A;  8PCH A;  5KO3 A;  1CPJ A;  4PP2 E;  2J7Q A;  1SNK A;  2GID A;  1PCI A;  3TMP A;  3CM1 A;  2BDL A;  3ZNH A;  2AVW A;  2R6N A;  2VHF A;  4PI3 A;  4N79 A;  3CBJ A;  2XU4 A;  1YZB A;  1BQI A;  4HWY A;  5EZS A;  2IT9 A;  2ACT A;  3WXE A;  3OBH A;  3N1J A;  5EZQ A;  4YYW A;  3V6C A;  2YJ2 A;  4AXL A;  5EGW A;  2WBF X;  1POP A;  3N3K A;  3OVX A;  5J94 A;  4OVZ A;  2R9O A;  4BOZ A;  1YK8 A;  1U9Q X;  2G6D A;  5CVM A;  3BCN A;  4QRG A;  1BGO A;  1ZCM A;  3K9M A;  1KHQ A;  2HD5 A;  2C62 A;  3BOW A;  4PAD A;  3BY4 A;  2AYO A;  3C9E A;  3TRK A;  1MHW A;  3NHE A;  4RF0 A;  4XZX A;  3B79 A;  4KOO A;  2BU3 A;  5E6J A;  2B1N A;  3W31 A;  2CB5 A;  1ZIV A;  4YYQ A;  4YYS A;  1F2B A; 
#chains in the Genus database with same CATH homology
 5FGP A;  4WUR A;  4BOD A;  2M4F A;  4RF1 A;  4PT5 A;  2J7Q C;  3MJ5 A;  4BF3 A;  1PVJ A;  3OQC A;  3PSE A;  3PHX A;  3K44 A;  4D8B A;  4BOB A;  4MM3 B;  2DOS A;  4ZTB A;  4REZ A;  4IUM A;  4RKX A;  3BBA A;  2JRI A;  3MTV A;  5JZE A;  2AGA A;  3O65 A;  4R3D A;  3W30 A;  3PRM A;  4BOQ A;  5KO3 A;  2J7Q A;  2GID A;  4BOU A;  3TMP A;  4D8I A;  3B21 A;  2JTC A;  3CM1 A;  4A5U A;  4D8E A;  3ZNH A;  3PHW A;  4P16 A;  3PT2 A;  1YZB A;  5EZS A;  4MI7 A;  2HWK A;  2GID B;  3OBH A;  2BTW B;  2Z84 A;  5EZQ A;  1UKF A;  3RNV A;  2GJE D;  4J38 A;  4BXM A;  4BOS A;  2BTW A;  4HXD B;  3C0R A;  3MP2 A;  1DKI A;  4OVZ A;  3PRP A;  4BOZ A;  4M0W A;  4RNA A;  2GIA A;  4GUA A;  4IP3 A;  3E9S A;  4OW0 A;  3BY4 A;  3PHU A;  3TRK A;  4RF0 A;  2FE8 A;  4XZX A;  4OVZ B;  2UZJ A;  3IFU A;  3BB7 A;  2BU3 A;  5E6J A;  2GIA B;  3W31 A;  2GJE A;  4BOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...