The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
105
|
sequence length |
245
|
structure length |
245
|
Chain Sequence |
WSAEDKHKEGVNSHLWIVNRAIDIMSRNTTLVKQDRVAQLNEWRTELENGIYAANYENPYYDNSTFASHFYDPDNGKTYIPFAKQAKETGAKYFKLAGESYKNKDMKQAFFYLGLSLHYLGDVNQPMHAANFTNLSYPQGFHSKYENFVDTIKDNYKVTDGNGYWNWKGTNPEEWIHGAAVVAKQDYSGIVNDNTKDWFVKAAVSQEYADKWRAEVTPMTGKRLMDAQRVTAGYIQLWFDTYGDR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Using X-ray crystallography of the Asp55Asn mutant of the phosphatidylcholine-preferring phospholipase C from Bacillus cereus to support the mechanistic role of Asp55 as the general base.
pubmed doi rcsb |
| molecule keywords |
PHOSPHOLIPASE C
|
| molecule tags |
Hydrolase
|
| source organism |
Bacillus cereus
|
| total genus |
105
|
| structure length |
245
|
| sequence length |
245
|
| ec nomenclature |
ec
3.1.4.3: Phospholipase C. |
| pdb deposition date | 2003-04-29 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00882 | Zn_dep_PLPC | Zinc dependent phospholipase C |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | P1 Nuclease | P1 Nuclease |
#chains in the Genus database with same CATH superfamily 1P6D A; 1CA1 A; 2FGN A; 1QMD A; 4CWM A; 1AK0 A; 1GYG A; 3SNG A; 1P6E A; 4CXO A; 5FBD A; 2WXU A; 3W52 A; 1AH7 A; 4CXP A; 2HUC A; 2WY6 A; 4CXV A; 5FBC A; 1OLP A; 1KHO A; 5FBA A; 1QM6 A; 4JDG A; 5FB9 A; 5FBF A; 2FFZ A; 2WXT A; 5FBB A; 4DJ4 A; 1P5X A; 5FBG A; #chains in the Genus database with same CATH topology 1P6D A; 1CA1 A; 2FGN A; 1QMD A; 4CWM A; 1AK0 A; 1GYG A; 3SNG A; 1P6E A; 4CXO A; 5FBD A; 2WXU A; 3W52 A; 1AH7 A; 4CXP A; 2HUC A; 2WY6 A; 4CXV A; 5FBC A; 1OLP A; 1KHO A; 5FBA A; 1QM6 A; 4JDG A; 5FB9 A; 5FBF A; 2FFZ A; 2WXT A; 5FBB A; 4DJ4 A; 1P5X A; 5FBG A; #chains in the Genus database with same CATH homology 1P6D A; 1CA1 A; 2FGN A; 1QMD A; 4CWM A; 1AK0 A; 1GYG A; 3SNG A; 1P6E A; 4CXO A; 5FBD A; 2WXU A; 3W52 A; 1AH7 A; 4CXP A; 2HUC A; 2WY6 A; 4CXV A; 5FBC A; 1OLP A; 1KHO A; 5FBA A; 1QM6 A; 4JDG A; 5FB9 A; 5FBF A; 2FFZ A; 2WXT A; 5FBB A; 4DJ4 A; 1P5X A; 5FBG A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...